254780397

254780397

4-hydroxythreonine-4-phosphate dehydrogenase

GeneID in NCBI database:8209382Locus tag:CLIBASIA_01410
Protein GI in NCBI database:254780397Protein Accession:YP_003064810.1
Gene range:+(298091, 299122)Protein Length:343aa
Gene description:4-hydroxythreonine-4-phosphate dehydrogenase
COG prediction:[H] Pyridoxal phosphate biosynthesis protein
KEGG prediction:pdxA; 4-hydroxythreonine-4-phosphate dehydrogenase (EC:1.1.1.262); K00097 4-hydroxythreonine-4-phosphate dehydrogenase [EC:1.1.1.262]
SEED prediction:4-hydroxythreonine-4-phosphate dehydrogenase (EC 1.1.1.262)
Pathway involved in KEGG:Vitamin B6 metabolism [PATH:las00750]
Subsystem involved in SEED:Pyridoxin (Vitamin B6) Biosynthesis
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340---
MDEFLPLILTQGDPAGIGPDISLKAWASRQITAIPPFIYIGDVDVLNARAKQLNLSVPLYETDCKNAVSIFKKALPIISSPCGAKIVTGTPNPQTASSTIANIEKAVSLTLSGQALAIVTNPIAKFLLYQEKFKFPGHTEFLAELAKKNTGITFKPVMMLSGPQLRTVPVTIHIPIADICRILSTKRIIETSDTVYNAMKKYFGINNPRIAISGLNPHAGENATIGIEEKNIIIPAITYLRNDNKNIIGPLPADSMFHHSARQCYDVAICMYHDQALIPIKTLDFNQTVNITLGLPFVRTSPDHGTAFDIAGSSLTQEESLVSALKIAAQLGYQKNLCNDHEQ
ccccccEEEEccccccccHHHHHHHHHcccHHccccEEEEEcHHHHHHHHHHcccccccEEccccHHccccccEEEEEEcccccccccccccHHHHHHHHHHHHHHHHHHHcccccEEEEccccHHHHHHcccccccHHHHHHHHHccccccccccEEEcccccEEEEEEEccHHHHHHHHHccHHHHHHHHHHHHHHHHHHccccccEEEEEEEccccccccccccHHHHHHHHHHHHHHHcccEEEccccccHHccHHHHHHccEEEEEcccccHHHHHHHHcccEEEEEEccccccccccccHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHccc
ccccEEEEEcccccccccHHHHHHHHHcccccccccEEEEccHHHHHHHHHHccccEEEEEccccccHHHccccEEEEccccccccccccccHHHHHHHHHHHHHHHHHHHcccccEEEccHHcHHHHHHccccccccHHHHHHHHcccccccccEEEEEcccccEEEEEEccccHHHHHHHccHHHHHHHHHHHHHHHHHHccccccEEEEEcccccccccccccHHHHHHHHHHHHHHHHccccccccccccHcccHHHHHcccEEEEEEccccccHHHHccccccEEEEccccEEEEccccccHHHHcccccccHHHHHHHHHHHHHHHHHccccccccc
mdeflpliltqgdpagigpdisLKAWASRqitaippfiyigDVDVLNARAKQlnlsvplyetDCKNAVSIFKKalpiisspcgakivtgtpnpqtassTIANIEKAVSLTLSGQALAIVTNPIAKFLLYqekfkfpghTEFLAELAKkntgitfkpvmmlsgpqlrtvpvtihipIADICRILSTKRIIETSDTVYNAMKKYfginnpriaisglnphagenatigieekniiIPAITylrndnkniigplpadsmfhhsarQCYDVAICMYhdqalipiktldfnqtvnitlglpfvrtspdhgtafdiagssltQEESLVSALKIAAQLGYQKnlcndheq
MDEFLPLIltqgdpagigPDISLKAWASRQITAIPPFIYIGDVDVLNARAKQLNLSVPLYETDCKNAVSIFKKALPIISSPCGAKIVTGTPNPQTASSTIANIEKAVSLTLSGQALAIVTNPIAKFLLYQEKFKFPGHTEFLAELAKKNTGITFKPVMMLSGPQLRTVPVTIHIPIADICRILSTKRIIETSDTVYNAMKKYFGINNPRIAISGLNPHAGENATIGIEEKNIIIPAITYLRNDNKNIIGPLPADSMFHHSARQCYDVAICMYHDQALIPIKTLDFNQTVNITLGLPFVRTSPDHGTAFDIAGSSLTQEESLVSALKIAAQLGYQKNLCNDHEQ
MDEFLPLILTQGDPAGIGPDISLKAWASRQITAIPPFIYIGDVDVLNARAKQLNLSVPLYETDCKNAVSIFKKALPIISSPCGAKIVTGTPNPQTASSTIANIEKAVSLTLSGQALAIVTNPIAKFLLYQEKFKFPGHTEFLAELAKKNTGITFKPVMMLSGPQLRTVPVTIHIPIADICRILSTKRIIETSDTVYNAMKKYFGINNPRIAISGLNPHAGENATIGIEEKNIIIPAITYLRNDNKNIIGPLPADSMFHHSARQCYDVAICMYHDQALIPIKTLDFNQTVNITLGLPFVRTSPDHGTAFDIAGSSLTQEESLVSALKIAAQLGYQKNLCNDHEQ
**EFLPLILTQGDPAGIGPDISLKAWASRQITAIPPFIYIGDVDVLNARAKQLNLSVPLYETDCKNAVSIFKKALPIISSPCGAKIVTGTPNPQTASSTIANIEKAVSLTLSGQALAIVTNPIAKFLLYQEKFKFPGHTEFLAELAKKNTGITFKPVMMLSGPQLRTVPVTIHIPIADICRILSTKRIIETSDTVYNAMKKYFGINNPRIAISGLNPHAGENATIGIEEKNIIIPAITYLRNDNKNIIGPLPADSMFHHSARQCYDVAICMYHDQALIPIKTLDFNQTVNITLGLPFVRTSPDHGTAFDIAGSSLTQEESLVSALKIAAQL************
MDEFLPLILTQGDPAGIGPDISLKAWASRQITAIPPFIYIGDVDVLNARAKQLNLSVPLYETDCKNAVSIFKKALPIISSPCGAKIVTGTPNPQTASSTIANIEKAVSLTLSGQALAIVTNPIAKFLLYQEKFKFPGHTEFLAELAKKNTGITFKPVMMLSGPQLRTVPVTIHIPIADICRILSTKRIIETSDTVYNAMKKYFGINNPRIAISGLNPHAGENATIGIEEKNIIIPAITYLRNDNKNIIGPLPADSMFHHSARQCYDVAICMYHDQALIPIKTLDFNQTVNITLGLPFVRTSPDHGTAFDIAGSSLTQEESLVSALKIAAQLGYQKNLCNDHEQ
*DEFLPLILTQGDPAGIGPDISLKAWASRQITAIPPFIYIGDVDVLNARAKQLNLSVPLYETDCKNAVSIFKKALPIISSPCGAKIVTGTPNPQTASSTIANIEKAVSLTLSGQALAIVTNPIAKFLLYQEKFKFPGHTEFLAELAKKNTGITFKPVMMLSGPQLRTVPVTIHIPIADICRILSTKRIIETSDTVYNAMKKYFGINNPRIAISGLNPHAGENATIGIEEKNIIIPAITYLRNDNKNIIGPLPADSMFHHSARQCYDVAICMYHDQALIPIKTLDFNQTVNITLGLPFVRTSPDHGTAFDIAGSSLTQEESLVSALKIAAQLGYQK********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDEFLPLILTQGDPAGIGPDISLKAWASRQITAIPPFIYIGDVDVLNARAKQLNLSVPLYETDCKNAVSIFKKALPIISSPCGAKIVTGTPNPQTASSTIANIEKAVSLTLSGQALAIVTNPIAKFLLYQEKFKFPGHTEFLAELAKKNTGITFKPVMMLSGPQLRTVPVTIHIPIADICRILSTKRIIETSDTVYNAMKKYFGINNPRIAISGLNPHAGENATIGIEEKNIIIPAITYLRNDNKNIIGPLPADSMFHHSARQCYDVAICMYHDQALIPIKTLDFNQTVNITLGLPFVRTSPDHGTAFDIAGSSLTQEESLVSALKIAAQLGYQKNLCNDHEQ
MDEFLPLILTQGDPAGIGPDISLKAWASRQITAIPPFIYIGDVDVLNARAKQLNLSVPLYETDCKNAVSIFKKALPIISSPCGAKIVTGTPNPQTASSTIANIEKAVSLTLSGQALAIVTNPIAKFLLYQEKFKFPGHTEFLAELAKKNTGITFKPVMMLSGPQLRTVPVTIHIPIADICRILSTKRIIETSDTVYNAMKKYFGINNPRIAISGLNPHAGENATIGIEEKNIIIPAITYLRNDNKNIIGPLPADSMFHHSARQCYDVAICMYHDQALIPIKTLDFNQTVNITLGLPFVRTSPDHGTAFDIAGSSLTQEESLVSALKIAAQLGYQKNLCNDHEQ
MDEFLPLILTQGDPAGIGPDISLKAWASRQITAIPPFIYIGDVDVLNARAKQLNLSVPLYETDCKNAVSIFKKALPIISSPCGAKIVTGTPNPQTASSTIANIEKAVSLTLSGQALAIVTNPIAKFLLYQEKFKFPGHTEFLAELAKKNTGITFKPVMMLSGPQLRTVPVTIHIPIADICRILSTKRIIETSDTVYNAMKKYFGINNPRIAISGLNPHAGENATIGIEEKNIIIPAITYLRNDNKNIIGPLPADSMFHHSARQCYDVAICMYHDQALIPIKTLDFNQTVNITLGLPFVRTSPDHGTAFDIAGSSLTQEESLVSALKIAAQLGYQKNLCNDHEQ

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target343 4-hydroxythreonine-4-phosphate dehydrogenase [Candidatu
315122191341 4-hydroxythreonine-4-phosphate dehydrogenase [Candidatu 1 1e-159
241203945342 4-hydroxythreonine-4-phosphate dehydrogenase [Rhizobium 1 1e-115
209548667342 4-hydroxythreonine-4-phosphate dehydrogenase [Rhizobium 1 1e-114
218509346342 4-hydroxythreonine-4-phosphate dehydrogenase [Rhizobium 1 1e-114
116251331342 4-hydroxythreonine-4-phosphate dehydrogenase [Rhizobium 1 1e-114
86357088342 4-hydroxythreonine-4-phosphate dehydrogenase [Rhizobium 1 1e-113
190891132342 4-hydroxythreonine-4-phosphate dehydrogenase [Rhizobium 1 1e-113
327188009342 4-hydroxythreonine-4-phosphate dehydrogenase protein [R 1 1e-113
222085449341 4-hydroxythreonine-4-phosphate dehydrogenase [Agrobacte 1 1e-108
222148149346 4-hydroxythreonine-4-phosphate dehydrogenase [Agrobacte 1 1e-106
>gi|315122191|ref|YP_004062680.1| 4-hydroxythreonine-4-phosphate dehydrogenase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 341 Back     alignment and organism information
 Score =  566 bits (1458), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 276/332 (83%), Positives = 302/332 (90%)

Query: 5   LPLILTQGDPAGIGPDISLKAWASRQITAIPPFIYIGDVDVLNARAKQLNLSVPLYETDC 64
           LPLILTQGDPAGIGPDISLKAWA+R+I +IPPFIYIGD DVLN RAKQLNL++PLYETDC
Sbjct: 8   LPLILTQGDPAGIGPDISLKAWANRRIRSIPPFIYIGDPDVLNERAKQLNLNIPLYETDC 67

Query: 65  KNAVSIFKKALPIISSPCGAKIVTGTPNPQTASSTIANIEKAVSLTLSGQALAIVTNPIA 124
            +AVS F+KALPIISSPCG KI+TG P P+TAS+TIANIEKAVSLTLSGQALA+VTNP++
Sbjct: 68  AHAVSSFEKALPIISSPCGFKIITGIPQPKTASNTIANIEKAVSLTLSGQALAMVTNPVS 127

Query: 125 KFLLYQEKFKFPGHTEFLAELAKKNTGITFKPVMMLSGPQLRTVPVTIHIPIADICRILS 184
           KFLLY+EKF F GHTEFLAELAKKNTGIT+KPVMMLS PQLRTVPVTIHIP+A+I  ILS
Sbjct: 128 KFLLYKEKFNFLGHTEFLAELAKKNTGITYKPVMMLSNPQLRTVPVTIHIPLANIVHILS 187

Query: 185 TKRIIETSDTVYNAMKKYFGINNPRIAISGLNPHAGENATIGIEEKNIIIPAITYLRNDN 244
            K IIET  TV+NAM+K F IN+PRIAISGLNPHAGENATIG+EEK+II PAI  L+ +N
Sbjct: 188 KKLIIETCHTVHNAMEKNFKINHPRIAISGLNPHAGENATIGMEEKDIISPAIVQLKKEN 247

Query: 245 KNIIGPLPADSMFHHSARQCYDVAICMYHDQALIPIKTLDFNQTVNITLGLPFVRTSPDH 304
           KNIIGPLPADSMFHHSARQ YDVAICMYHDQALIP+KTL FNQTVNITLGLPF+RTSPDH
Sbjct: 248 KNIIGPLPADSMFHHSARQNYDVAICMYHDQALIPVKTLSFNQTVNITLGLPFIRTSPDH 307

Query: 305 GTAFDIAGSSLTQEESLVSALKIAAQLGYQKN 336
           GTAFDIAG     EESLVSALKIAAQLGYQKN
Sbjct: 308 GTAFDIAGGPNVHEESLVSALKIAAQLGYQKN 339


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|241203945|ref|YP_002975041.1| 4-hydroxythreonine-4-phosphate dehydrogenase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 342 Back     alignment and organism information
>gi|209548667|ref|YP_002280584.1| 4-hydroxythreonine-4-phosphate dehydrogenase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 342 Back     alignment and organism information
>gi|218509346|ref|ZP_03507224.1| 4-hydroxythreonine-4-phosphate dehydrogenase [Rhizobium etli Brasil 5] Length = 342 Back     alignment and organism information
>gi|116251331|ref|YP_767169.1| 4-hydroxythreonine-4-phosphate dehydrogenase [Rhizobium leguminosarum bv. viciae 3841] Length = 342 Back     alignment and organism information
>gi|86357088|ref|YP_468980.1| 4-hydroxythreonine-4-phosphate dehydrogenase [Rhizobium etli CFN 42] Length = 342 Back     alignment and organism information
>gi|190891132|ref|YP_001977674.1| 4-hydroxythreonine-4-phosphate dehydrogenase [Rhizobium etli CIAT 652] Length = 342 Back     alignment and organism information
>gi|327188009|gb|EGE55239.1| 4-hydroxythreonine-4-phosphate dehydrogenase protein [Rhizobium etli CNPAF512] Length = 342 Back     alignment and organism information
>gi|222085449|ref|YP_002543979.1| 4-hydroxythreonine-4-phosphate dehydrogenase [Agrobacterium radiobacter K84] Length = 341 Back     alignment and organism information
>gi|222148149|ref|YP_002549106.1| 4-hydroxythreonine-4-phosphate dehydrogenase [Agrobacterium vitis S4] Length = 346 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target343 4-hydroxythreonine-4-phosphate dehydrogenase [Candidatu
PRK05312336 PRK05312, pdxA, 4-hydroxythreonine-4-phosphate dehydrog 1e-142
TIGR00557320 TIGR00557, pdxA, 4-hydroxythreonine-4-phosphate dehydro 1e-119
pfam04166299 pfam04166, PdxA, Pyridoxal phosphate biosynthetic prote 5e-87
PRK00232332 PRK00232, pdxA, 4-hydroxythreonine-4-phosphate dehydrog 2e-81
PRK02746345 PRK02746, pdxA, 4-hydroxythreonine-4-phosphate dehydrog 4e-78
PRK03743332 PRK03743, pdxA, 4-hydroxythreonine-4-phosphate dehydrog 2e-61
PRK01909329 PRK01909, pdxA, 4-hydroxythreonine-4-phosphate dehydrog 4e-57
PRK03371326 PRK03371, pdxA, 4-hydroxythreonine-4-phosphate dehydrog 4e-52
PRK03946307 PRK03946, pdxA, 4-hydroxythreonine-4-phosphate dehydrog 8e-47
COG1995332 COG1995, PdxA, Pyridoxal phosphate biosynthesis protein 1e-100
>gnl|CDD|180008 PRK05312, pdxA, 4-hydroxythreonine-4-phosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|161928 TIGR00557, pdxA, 4-hydroxythreonine-4-phosphate dehydrogenase Back     alignment and domain information
>gnl|CDD|112956 pfam04166, PdxA, Pyridoxal phosphate biosynthetic protein PdxA Back     alignment and domain information
>gnl|CDD|178940 PRK00232, pdxA, 4-hydroxythreonine-4-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|179467 PRK02746, pdxA, 4-hydroxythreonine-4-phosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|179641 PRK03743, pdxA, 4-hydroxythreonine-4-phosphate dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|179351 PRK01909, pdxA, 4-hydroxythreonine-4-phosphate dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|179572 PRK03371, pdxA, 4-hydroxythreonine-4-phosphate dehydrogenase 2; Provisional Back     alignment and domain information
>gnl|CDD|179681 PRK03946, pdxA, 4-hydroxythreonine-4-phosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|32178 COG1995, PdxA, Pyridoxal phosphate biosynthesis protein [Coenzyme metabolism] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 343 4-hydroxythreonine-4-phosphate dehydrogenase [Candidatu
PRK05312336 pdxA 4-hydroxythreonine-4-phosphate dehydrogenase; Prov 100.0
PRK00232334 pdxA 4-hydroxythreonine-4-phosphate dehydrogenase; Revi 100.0
PRK03743333 pdxA 4-hydroxythreonine-4-phosphate dehydrogenase; Vali 100.0
PRK03367329 consensus 100.0
PRK04607330 consensus 100.0
PRK03877328 consensus 100.0
PRK02848341 consensus 100.0
PRK04507323 consensus 100.0
PRK01909329 pdxA 4-hydroxythreonine-4-phosphate dehydrogenase; Vali 100.0
PRK03371326 pdxA 4-hydroxythreonine-4-phosphate dehydrogenase 2; Pr 100.0
PRK02746332 pdxA 4-hydroxythreonine-4-phosphate dehydrogenase; Prov 100.0
COG1995332 PdxA Pyridoxal phosphate biosynthesis protein [Coenzyme 100.0
PRK03946304 pdxA 4-hydroxythreonine-4-phosphate dehydrogenase; Prov 100.0
TIGR00557325 pdxA 4-hydroxythreonine-4-phosphate dehydrogenase; Inte 100.0
PRK11890312 phosphate acetyltransferase; Provisional 99.3
PRK05805301 phosphate butyryltransferase; Validated 99.03
PRK09653324 eutD phosphotransacetylase; Reviewed 99.01
PRK07742299 phosphate butyryltransferase; Validated 98.91
COG0280327 Pta Phosphotransacetylase [Energy production and conver 98.88
PRK05331317 putative glycerol-3-phosphate acyltransferase PlsX; Pro 98.67
PRK13846316 putative glycerol-3-phosphate acyltransferase PlsX; Pro 98.6
pfam02504322 FA_synthesis Fatty acid synthesis protein. The plsX gen 98.58
COG0416338 PlsX Fatty acid/phospholipid biosynthesis enzyme [Lipid 98.29
TIGR00182344 plsX fatty acid/phospholipid synthesis protein PlsX; In 97.48
TIGR02706295 P_butyryltrans phosphate butyryltransferase; InterPro: 97.29
pfam04166299 PdxA Pyridoxal phosphate biosynthetic protein PdxA. In 100.0
PRK08190465 bifunctional enoyl-CoA hydratase/phosphate acetyltransf 98.47
PRK13845437 putative glycerol-3-phosphate acyltransferase PlsX; Pro 97.73
pfam01515319 PTA_PTB Phosphate acetyl/butaryl transferase. This fami 99.08
PRK12861762 malic enzyme; Reviewed 98.75
PRK07232753 malic enzyme; Reviewed 98.74
PRK12862761 malic enzyme; Reviewed 98.68
PRK05632702 phosphate acetyltransferase; Reviewed 98.17
TIGR02088350 LEU3_arch isopropylmalate/isohomocitrate dehydrogenases 98.13
PRK08997334 isocitrate dehydrogenase; Provisional 97.27
pfam00180349 Iso_dh Isocitrate/isopropylmalate dehydrogenase. 97.25
COG0473348 LeuB Isocitrate/isopropylmalate dehydrogenase [Amino ac 97.04
PRK08194352 tartrate dehydrogenase; Provisional 96.88
PRK09222 482 isocitrate dehydrogenase; Validated 96.8
PRK00772352 3-isopropylmalate dehydrogenase; Provisional 96.69
PRK03437345 3-isopropylmalate dehydrogenase; Provisional 96.62
KOG0785365 consensus 94.04
TIGR03270202 methan_mark_4 putative methanogen marker protein 4. Mem 96.97
PRK06451415 isocitrate dehydrogenase; Validated 96.87
PRK07362474 isocitrate dehydrogenase; Validated 96.8
PRK07006409 isocitrate dehydrogenase; Reviewed 96.61
COG0538407 Icd Isocitrate dehydrogenases [Energy production and co 94.96
TIGR00169370 leuB 3-isopropylmalate dehydrogenase; InterPro: IPR0044 93.47
TIGR02924 481 ICDH_alpha isocitrate dehydrogenase; InterPro: IPR01427 96.51
TIGR02089355 TTC tartrate dehydrogenase; InterPro: IPR011829 Tartrat 96.47
TIGR00651322 pta phosphate acetyltransferase; InterPro: IPR004614 Ph 91.83
PRK09222 482 isocitrate dehydrogenase; Validated 91.41
TIGR00169370 leuB 3-isopropylmalate dehydrogenase; InterPro: IPR0044 91.08
PRK03437345 3-isopropylmalate dehydrogenase; Provisional 91.05
>PRK05312 pdxA 4-hydroxythreonine-4-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK00232 pdxA 4-hydroxythreonine-4-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>PRK03743 pdxA 4-hydroxythreonine-4-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK03367 consensus Back     alignment and domain information
>PRK04607 consensus Back     alignment and domain information
>PRK03877 consensus Back     alignment and domain information
>PRK02848 consensus Back     alignment and domain information
>PRK04507 consensus Back     alignment and domain information
>PRK01909 pdxA 4-hydroxythreonine-4-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK03371 pdxA 4-hydroxythreonine-4-phosphate dehydrogenase 2; Provisional Back     alignment and domain information
>PRK02746 pdxA 4-hydroxythreonine-4-phosphate dehydrogenase; Provisional Back     alignment and domain information
>COG1995 PdxA Pyridoxal phosphate biosynthesis protein [Coenzyme metabolism] Back     alignment and domain information
>PRK03946 pdxA 4-hydroxythreonine-4-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR00557 pdxA 4-hydroxythreonine-4-phosphate dehydrogenase; InterPro: IPR005255 Pyridoxal phosphate is the active form of vitamin B6 (pyridoxine or pyridoxal) Back     alignment and domain information
>PRK11890 phosphate acetyltransferase; Provisional Back     alignment and domain information
>PRK05805 phosphate butyryltransferase; Validated Back     alignment and domain information
>PRK09653 eutD phosphotransacetylase; Reviewed Back     alignment and domain information
>PRK07742 phosphate butyryltransferase; Validated Back     alignment and domain information
>COG0280 Pta Phosphotransacetylase [Energy production and conversion] Back     alignment and domain information
>PRK05331 putative glycerol-3-phosphate acyltransferase PlsX; Provisional Back     alignment and domain information
>PRK13846 putative glycerol-3-phosphate acyltransferase PlsX; Provisional Back     alignment and domain information
>pfam02504 FA_synthesis Fatty acid synthesis protein Back     alignment and domain information
>COG0416 PlsX Fatty acid/phospholipid biosynthesis enzyme [Lipid metabolism] Back     alignment and domain information
>TIGR00182 plsX fatty acid/phospholipid synthesis protein PlsX; InterPro: IPR003664 The plsX gene is part of the bacterial fab gene cluster which encodes several key fatty acid biosynthetic enzymes Back     alignment and domain information
>TIGR02706 P_butyryltrans phosphate butyryltransferase; InterPro: IPR014079 Members of this family are phosphate butyryltransferase enzymes, also called phosphotransbutyrylase Back     alignment and domain information
>pfam04166 PdxA Pyridoxal phosphate biosynthetic protein PdxA Back     alignment and domain information
>PRK08190 bifunctional enoyl-CoA hydratase/phosphate acetyltransferase; Validated Back     alignment and domain information
>PRK13845 putative glycerol-3-phosphate acyltransferase PlsX; Provisional Back     alignment and domain information
>pfam01515 PTA_PTB Phosphate acetyl/butaryl transferase Back     alignment and domain information
>PRK12861 malic enzyme; Reviewed Back     alignment and domain information
>PRK07232 malic enzyme; Reviewed Back     alignment and domain information
>PRK12862 malic enzyme; Reviewed Back     alignment and domain information
>PRK05632 phosphate acetyltransferase; Reviewed Back     alignment and domain information
>TIGR02088 LEU3_arch isopropylmalate/isohomocitrate dehydrogenases; InterPro: IPR011828 This entry represents a group of archaeal decarboxylating dehydrogenases which include the leucine biosynthesis enzyme 3-isopropylmalate dehydrogenase (LeuB, LEU3) and the methanogenic cofactor CoB biosynthesis enzyme isohomocitrate dehydrogenase (AksF) Back     alignment and domain information
>PRK08997 isocitrate dehydrogenase; Provisional Back     alignment and domain information
>pfam00180 Iso_dh Isocitrate/isopropylmalate dehydrogenase Back     alignment and domain information
>COG0473 LeuB Isocitrate/isopropylmalate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08194 tartrate dehydrogenase; Provisional Back     alignment and domain information
>PRK09222 isocitrate dehydrogenase; Validated Back     alignment and domain information
>PRK00772 3-isopropylmalate dehydrogenase; Provisional Back     alignment and domain information
>PRK03437 3-isopropylmalate dehydrogenase; Provisional Back     alignment and domain information
>KOG0785 consensus Back     alignment and domain information
>TIGR03270 methan_mark_4 putative methanogen marker protein 4 Back     alignment and domain information
>PRK06451 isocitrate dehydrogenase; Validated Back     alignment and domain information
>PRK07362 isocitrate dehydrogenase; Validated Back     alignment and domain information
>PRK07006 isocitrate dehydrogenase; Reviewed Back     alignment and domain information
>COG0538 Icd Isocitrate dehydrogenases [Energy production and conversion] Back     alignment and domain information
>TIGR00169 leuB 3-isopropylmalate dehydrogenase; InterPro: IPR004429 Several NAD- or NADP-dependent dehydrogenases, including 3-isopropylmalate dehydrogenase, tartrate dehydrogenase, and the dimeric forms of isocitrate dehydrogenase, share a nucleotide binding domain unrelated to that of lactate dehydrogenase and its homologs Back     alignment and domain information
>TIGR02924 ICDH_alpha isocitrate dehydrogenase; InterPro: IPR014273 This entry represents a group of isocitrate dehydrogenases found mainly in the alphaproteobacteria Back     alignment and domain information
>TIGR02089 TTC tartrate dehydrogenase; InterPro: IPR011829 Tartrate dehydrogenase catalyzes the oxidation of both meso- and (+)-tartrate as well as a D-malate Back     alignment and domain information
>TIGR00651 pta phosphate acetyltransferase; InterPro: IPR004614 Phosphate acetyltransferase (2 Back     alignment and domain information
>PRK09222 isocitrate dehydrogenase; Validated Back     alignment and domain information
>TIGR00169 leuB 3-isopropylmalate dehydrogenase; InterPro: IPR004429 Several NAD- or NADP-dependent dehydrogenases, including 3-isopropylmalate dehydrogenase, tartrate dehydrogenase, and the dimeric forms of isocitrate dehydrogenase, share a nucleotide binding domain unrelated to that of lactate dehydrogenase and its homologs Back     alignment and domain information
>PRK03437 3-isopropylmalate dehydrogenase; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target343 4-hydroxythreonine-4-phosphate dehydrogenase [Candidatu
1ps6_A328 Crystal Structure Of E.Coli Pdxa Length = 328 4e-59
3lxy_A334 Crystal Structure Of 4-Hydroxythreonine-4-Phosphate 5e-58
2hi1_A330 The Structure Of A Putative 4-Hydroxythreonine-4-Ph 7e-56
1ps7_A329 Crystal Structure Of E.Coli Pdxa Length = 329 1e-54
1ptm_A329 Crystal Structure Of E.Coli Pdxa Length = 329 7e-54
1yxo_A328 Crystal Structure Of Pyridoxal Phosphate Biosynthet 2e-53
1r8k_A329 Pdxa Protein; Nad-Dependent DehydrogenaseCARBOXYLAS 9e-48
>gi|38492838|pdb|1PS6|A Chain A, Crystal Structure Of E.Coli Pdxa Length = 328 Back     alignment and structure
 Score =  233 bits (593), Expect = 4e-59,   Method: Composition-based stats.
 Identities = 109/333 (32%), Positives = 168/333 (50%), Gaps = 9/333 (2%)

Query: 3   EFLPLILTQGDPAGIGPDISLKAWASRQITAIPPFIYIGDVDVLNARAKQLNLSVPLYET 62
           +   +++T G+PAGIGPD+ ++  A R+       +   D  +L  RA  L L + L   
Sbjct: 2   KTQRVVITPGEPAGIGPDLVVQ-LAQREWP--VELVVCADATLLTNRAAMLGLPLTLRPY 58

Query: 63  DCKNAVSIF-KKALPIISSPCGAKIVTGTPNPQTASSTIANIEKAVSLTLSGQALAIVTN 121
              +         L ++     A +  G    +     +  + +A    L+G+  A++T 
Sbjct: 59  SPNSPAQPQTAGTLTLLPVALRAPVTAGQLAVENGHYVVETLARACDGCLNGEFAALITG 118

Query: 122 PIAKFLLYQEKFKFPGHTEFLAELAKKNTGITFKPVMMLSGPQLRTVPVTIHIPIADICR 181
           P+ K ++      F GHTEF  E ++       K VMML+  +LR    T H+P+ DI  
Sbjct: 119 PVHKGVINDAGIPFTGHTEFFEERSQA-----KKVVMMLATEELRVALATTHLPLRDIAD 173

Query: 182 ILSTKRIIETSDTVYNAMKKYFGINNPRIAISGLNPHAGENATIGIEEKNIIIPAITYLR 241
            ++   + E    +++ ++  FGI  PRI + GLNPHAGE   +G EE + IIP +  LR
Sbjct: 174 AITPALLHEVIAILHHDLRTKFGIAEPRILVCGLNPHAGEGGHMGTEEIDTIIPVLNELR 233

Query: 242 NDNKNIIGPLPADSMFHHSARQCYDVAICMYHDQALIPIKTLDFNQTVNITLGLPFVRTS 301
                + GPLPAD++F        D  + MYHDQ L  +K   F + VNITLGLPF+RTS
Sbjct: 234 AQGMKLNGPLPADTLFQPKYLDNADAVLAMYHDQGLPVLKYQGFGRGVNITLGLPFIRTS 293

Query: 302 PDHGTAFDIAGSSLTQEESLVSALKIAAQLGYQ 334
            DHGTA ++AG       S ++AL +A ++   
Sbjct: 294 VDHGTALELAGRGKADVGSFITALNLAIKMIVN 326


>gi|290790350|pdb|3LXY|A Chain A, Crystal Structure Of 4-Hydroxythreonine-4-Phosphate Dehydrogenase From Yersinia Pestis Co92 Length = 334 Back     alignment and structure
>gi|112491359|pdb|2HI1|A Chain A, The Structure Of A Putative 4-Hydroxythreonine-4-Phosphate Dehydrogenase From Salmonella Typhimurium. Length = 330 Back     alignment and structure
>gi|38492840|pdb|1PS7|A Chain A, Crystal Structure Of E.Coli Pdxa Length = 329 Back     alignment and structure
>gi|38492845|pdb|1PTM|A Chain A, Crystal Structure Of E.Coli Pdxa Length = 329 Back     alignment and structure
>gi|62738825|pdb|1YXO|A Chain A, Crystal Structure Of Pyridoxal Phosphate Biosynthetic Protein Pdxa Pa0593 Length = 328 Back     alignment and structure
>gi|39654841|pdb|1R8K|A Chain A, Pdxa Protein; Nad-Dependent DehydrogenaseCARBOXYLASE; Subunit Of Pyridoxine Phosphate Biosynthetic Protein Pdxj- Pdxa [salmonella Typhimurium] Length = 329 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target343 4-hydroxythreonine-4-phosphate dehydrogenase [Candidatu
3lxy_A334 4-hydroxythreonine-4-phosphate dehydrogenase; PDXA, NAD 7e-84
1ptm_A329 4-hydroxythreonine-4-phosphate dehydrogenase; crystal s 3e-79
1yxo_A328 4-hydroxythreonine-4-phosphate dehydrogenase 1; PA0593, 3e-61
2hi1_A330 4-hydroxythreonine-4-phosphate dehydrogenase 2; pyridox 1e-57
>3lxy_A 4-hydroxythreonine-4-phosphate dehydrogenase; PDXA, NAD- dependent, metal-binding, NAD, NADP, oxidoreductase, pyridoxine biosynthesis; HET: SUC; 1.70A {Yersinia pestis} PDB: 1ps6_A* 1ptm_A 1ps7_A 1r8k_A Length = 334 Back     alignment and structure
 Score =  305 bits (783), Expect = 7e-84
 Identities = 117/332 (35%), Positives = 175/332 (52%), Gaps = 9/332 (2%)

Query: 6   PLILTQGDPAGIGPDISLKAWASRQITAIPPFIYIGDVDVLNARAKQLNLSVPLYETDCK 65
            L++T G+PAG+GPD+++              +   D  +L ARA QLNL + L E    
Sbjct: 10  RLVITPGEPAGVGPDLAITLAQQDWPV---ELVVCADPALLLARASQLNLPLQLREYQAD 66

Query: 66  N-AVSIFKKALPIISSPCGAKIVTGTPNPQTASSTIANIEKAVSLTLSGQALAIVTNPIA 124
             A++    +L I+       +V G  +   +   +  + KA    +SG+  A+VT P+ 
Sbjct: 67  QPAIAQQAGSLTILPVKTAVNVVPGKLDVGNSHYVVETLAKACDGAISGEFAALVTGPVQ 126

Query: 125 KFLLYQEKFKFPGHTEFLAELAKKNTGITFKPVMMLSGPQLRTVPVTIHIPIADICRILS 184
           K ++      F GHTEF A+ +        + VMML+  +LR    T H+P+  +   ++
Sbjct: 127 KSIINDAGIPFIGHTEFFADRSH-----CQRVVMMLATEELRVALATTHLPLLAVPGAIT 181

Query: 185 TKRIIETSDTVYNAMKKYFGINNPRIAISGLNPHAGENATIGIEEKNIIIPAITYLRNDN 244
              + E    + N +K  FGI  P+I + GLNPHAGE   +G EE + IIPA+  LR   
Sbjct: 182 QASLHEVITILDNDLKTKFGITQPQIYVCGLNPHAGEGGHMGHEEIDTIIPALNTLRQQG 241

Query: 245 KNIIGPLPADSMFHHSARQCYDVAICMYHDQALIPIKTLDFNQTVNITLGLPFVRTSPDH 304
            N+IGPLPAD++F     Q  D  + MYHDQ L  +K   F + VNITLGLPF+RTS DH
Sbjct: 242 INLIGPLPADTLFQPKYLQHADAVLAMYHDQGLPVLKYQGFGRAVNITLGLPFIRTSVDH 301

Query: 305 GTAFDIAGSSLTQEESLVSALKIAAQLGYQKN 336
           GTA ++A +      S ++AL +A ++    N
Sbjct: 302 GTALELAATGTADVGSFITALNLAIKMINNSN 333


>1ptm_A 4-hydroxythreonine-4-phosphate dehydrogenase; crystal strucrure, PDXA, pyridoxal 5'-phosphate biosynthesis, PLP; 1.96A {Escherichia coli} SCOP: c.77.1.3 PDB: 1ps7_A 1ps6_A* 1r8k_A Length = 329 Back     alignment and structure
>1yxo_A 4-hydroxythreonine-4-phosphate dehydrogenase 1; PA0593,pyridoxine biosynthesis,oxidoreductase, structural genomics, PSI; 2.01A {Pseudomonas aeruginosa} Length = 328 Back     alignment and structure
>2hi1_A 4-hydroxythreonine-4-phosphate dehydrogenase 2; pyridoxal phosphate biosynthesis, structural genomics, PSI-2; 2.30A {Salmonella typhimurium LT2} Length = 330 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target343 4-hydroxythreonine-4-phosphate dehydrogenase [Candidatu
3lxy_A334 4-hydroxythreonine-4-phosphate dehydrogenase; PDXA, NAD 100.0
1yxo_A328 4-hydroxythreonine-4-phosphate dehydrogenase 1; PA0593, 100.0
2hi1_A330 4-hydroxythreonine-4-phosphate dehydrogenase 2; pyridox 100.0
1td9_A329 Phosphate acetyltransferase; structural genomics, BSGC 99.05
1vmi_A355 Putative phosphate acetyltransferase; NP_416953.1, stru 99.04
2af4_C333 Phosphate acetyltransferase; PTA dimer with one COA lig 98.99
1r5j_A337 Putative phosphotransacetylase; lactate dehydrogenase-l 98.85
1u7n_A336 Fatty acid/phospholipid synthesis protein PLSX; structu 98.27
1vi1_A345 Fatty acid/phospholipid synthesis protein PLSX; structu 98.16
1yco_A279 Branched-chain phosphotransacylase; structural genomics 98.14
2e0c_A409 409AA long hypothetical NADP-dependent isocitrate dehyd 97.79
1hqs_A423 Isocitrate dehydrogenase; glyoxylate bypass, bsidh, tri 97.59
2d4v_A429 Isocitrate dehydrogenase; alpha and beta protein, isoci 96.89
2iv0_A412 Isocitrate dehydrogenase; oxidoreductase, tricarboxylic 96.78
3dms_A427 Isocitrate dehydrogenase [NADP]; structural genomics, s 96.67
2qfy_A427 Isocitrate dehydrogenase [NADP]; rossmann fold, oxidore 95.15
2uxq_A402 Isocitrate dehydrogenase native; psychrophilic, cold ad 94.48
1zor_A399 Isocitrate dehydrogenase; wild type enzyme, CIS-proline 91.77
3blx_B354 Isocitrate dehydrogenase [NAD] subunit 2; TCA cycle, ox 97.37
1vlc_A366 3-isopropylmalate dehydrogenase; TM0556, structural gen 97.35
3blx_A349 Isocitrate dehydrogenase [NAD] subunit 1; TCA cycle, ox 97.3
1wpw_A336 3-isopropylmalate dehydrogenase; oxidoreductase; 2.80A 97.2
2d1c_A 496 Isocitrate dehydrogenase; structural genomics, NPPSFA, 97.19
1a05_A358 IPMDH, IMDH, 3-isopropylmalate dehydrogenase; oxidoredu 97.19
1x0l_A333 Homoisocitrate dehydrogenase; oxidoreductase, decarboxy 97.13
1v53_A366 3-isopropylmalate dehydrogenase; IPMDH, HOMO dimer, X-R 97.06
1cnz_A363 IPMDH, IMDH, protein (3-isopropylmalate dehydrogenase); 97.03
1g2u_A345 IPMDH, 3-isopropylmalate dehydrogenase; beta-barrel, NA 96.95
3flk_A364 Tartrate dehydrogenase/decarboxylase; cytoplasm, lyase, 96.82
1w0d_A337 3-isopropylmalate dehydrogenase; oxidoreductase, leucin 96.8
1tyo_A435 Isocitrate dehydrogenase; enzyme-ethenonadp complex, ox 96.73
1lwd_A413 Isocitrate dehydrogenase; tricarboxylic acid cycle, oxi 95.66
>3lxy_A 4-hydroxythreonine-4-phosphate dehydrogenase; PDXA, NAD- dependent, metal-binding, NAD, NADP, oxidoreductase, pyridoxine biosynthesis; HET: SUC; 1.70A {Yersinia pestis} PDB: 1ps6_A* 1ptm_A 1ps7_A 1r8k_A Back     alignment and structure
Probab=100.00  E-value=0  Score=877.29  Aligned_cols=327  Identities=35%  Similarity=0.574  Sum_probs=311.8

Q ss_pred             CCCCCEEEECCCCCCCCHHHHHHHHCCCCHHCCCCEEEECCHHHHHHHHHHCCCCCCEEECCCCHHC-CCCCCCEEEECC
Q ss_conf             8888389971898774789999984285232489899993999999999981899744753861011-126785376103
Q gi|254780397|r    2 DEFLPLILTQGDPAGIGPDISLKAWASRQITAIPPFIYIGDVDVLNARAKQLNLSVPLYETDCKNAV-SIFKKALPIISS   80 (343)
Q Consensus         2 ~k~~pI~IT~GDPaGIGpEIilKal~~~~~~~~~~~viigd~~~l~~~~k~l~~~~~i~~i~~~~~~-~~~~~~i~i~~~   80 (343)
                      ++++||+||+|||+||||||++|+|++.   ..++++++||+++++++++.+++++++..++..++. ....+.++++++
T Consensus         6 ~~~~rIaIT~GDPaGIGpEIilk~~~~~---~~~~~iiigd~~~l~~~~~~l~~~~~~~~i~~~~~~~~~~~~~l~v~~~   82 (334)
T 3lxy_A            6 NHNNRLVITPGEPAGVGPDLAITLAQQD---WPVELVVCADPALLLARASQLNLPLQLREYQADQPAIAQQAGSLTILPV   82 (334)
T ss_dssp             CCCSEEEEECCCTTSSHHHHHHHHTTSC---CSSEEEEEECHHHHHHHHHHTTCCCEEEECCTTSCCCCCCTTEEEEEEC
T ss_pred             CCCCCEEEECCCCCHHHHHHHHHHHHCC---CCCCEEEEECHHHHHHHHHHCCCCCEEEEECCCCHHHCCCCCCEEEECC
T ss_conf             6999589975887541799999997167---9998699989999999999759996178847851322146783354001


Q ss_pred             CCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEECHHHHHHHHHHCCCCCCHHHHHHHHHCCCCCCCCCCCCCC
Q ss_conf             33220013553100000246778877664301234304432234477764101325647899998342358866521123
Q gi|254780397|r   81 PCGAKIVTGTPNPQTASSTIANIEKAVSLTLSGQALAIVTNPIAKFLLYQEKFKFPGHTEFLAELAKKNTGITFKPVMML  160 (343)
Q Consensus        81 ~~~~~~~~G~~s~~~g~~~~~sl~~A~~l~~~g~~~alVT~PInK~~l~~aG~~f~GhTE~La~~~~~~~~~~~~~~Mll  160 (343)
                      +...++.+|+++.++|+++++||+.|+++|++|+++||||+||||++|+.+|++|+|||||||++++.+     +++|||
T Consensus        83 ~~~~~~~~G~~~~~~g~~~~~~l~~A~~~~~~g~~daiVT~PInK~~i~~aG~~f~GHTE~la~~~~~~-----~~~Mml  157 (334)
T 3lxy_A           83 KTAVNVVPGKLDVGNSHYVVETLAKACDGAISGEFAALVTGPVQKSIINDAGIPFIGHTEFFADRSHCQ-----RVVMML  157 (334)
T ss_dssp             CCSSCCCTTCCCGGGHHHHHHHHHHHHHHHHHTSSSCEEECCCCHHHHHHTTCCCSCHHHHHHHHHTCS-----CCEEEE
T ss_pred             CCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCEEEECCHHHHHHHHCCCCCCCCEEEEEECCCCC-----CCHHHE
T ss_conf             235657889757323389999999999885324104899776125667643888587345653002788-----701103


Q ss_pred             CCCCCEEEEECCCCCHHHHHHHCCHHHHHHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCCCCCCCCHHHHHHHHHH
Q ss_conf             32211266530453133343201024567888989999985313456707999636654453100001210244588864
Q gi|254780397|r  161 SGPQLRTVPVTIHIPIADICRILSTKRIIETSDTVYNAMKKYFGINNPRIAISGLNPHAGENATIGIEEKNIIIPAITYL  240 (343)
Q Consensus       161 ~~~~L~V~l~TtHiPLk~V~~~it~~~I~~ki~~~~~~l~~~~gi~~PkIaV~gLNPHAGE~G~~G~EE~~iI~PaI~~~  240 (343)
                      ++++|||+|+|+|||||+|++.||+++|.+++++++++|+++||+++||||||||||||||+|+||+||+++|.|||+++
T Consensus       158 ~~~~LrV~lvTtHIpLk~V~~~It~~~I~~~i~~~~~~l~~~~gi~~PrIaV~gLNPHAGE~G~~G~EE~~iI~Pai~~~  237 (334)
T 3lxy_A          158 ATEELRVALATTHLPLLAVPGAITQASLHEVITILDNDLKTKFGITQPQIYVCGLNPHAGEGGHMGHEEIDTIIPALNTL  237 (334)
T ss_dssp             EETTEEEEESSCSCCGGGHHHHCCHHHHHHHHHHHHHHHHHTSCCSSCCEEEECSSGGGGGGGTTCSHHHHTHHHHHHHH
T ss_pred             EECCCEEEEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHH
T ss_conf             21672799980675088876424177899999999999998449976648997038986323653057889899999999


Q ss_pred             HHCCCCCCCCCCCHHHEECCCCCCCCEEEEEECCHHHHHHHHHCCCCEEEEEEECCEEEECCCCCCCHHHCCCCCCCHHH
Q ss_conf             21587643455511210002236676899985120225555414477279992087647558875522213368668389
Q gi|254780397|r  241 RNDNKNIIGPLPADSMFHHSARQCYDVAICMYHDQALIPIKTLDFNQTVNITLGLPFVRTSPDHGTAFDIAGSSLTQEES  320 (343)
Q Consensus       241 ~~~g~~v~GP~paDt~F~~~~~~~~D~vlamYHDQglip~K~l~f~~~Vn~t~GLp~irtSpdHGTafdiagk~~a~~~s  320 (343)
                      |++|++++|||||||+|.++.+++||+||||||||||||||+++|++|||+|+|||||||||||||||||||||+||++|
T Consensus       238 ~~~gi~v~GP~paDt~F~~~~~~~~D~vvamYHDQglip~K~l~f~~~VnvtlGLp~iRtSpdHGTA~dIagkg~A~~~s  317 (334)
T 3lxy_A          238 RQQGINLIGPLPADTLFQPKYLQHADAVLAMYHDQGLPVLKYQGFGRAVNITLGLPFIRTSVDHGTALELAATGTADVGS  317 (334)
T ss_dssp             HHTTCCEEEEECHHHHTSHHHHTTCSEEEESSHHHHHHHHHHHHTTCCEEEEESSSSCEEEESSCCCGGGTTTTCSCCHH
T ss_pred             HHCCCCCCCCCCHHHHHHHHCCCCCCEEEECCCCCCCHHHHHCCCCCCEEEECCCCEEEECCCCCCHHHHHCCCCCCHHH
T ss_conf             86499867884807886540015799999776465204342215776679973899568789987166661789899799


Q ss_pred             HHHHHHHHHHHHHHHH
Q ss_conf             9999999999998520
Q gi|254780397|r  321 LVSALKIAAQLGYQKN  336 (343)
Q Consensus       321 ~~~ai~~a~~~~~~~~  336 (343)
                      |++||++|.+|++||+
T Consensus       318 ~~~Ai~~a~~~~~~r~  333 (334)
T 3lxy_A          318 FITALNLAIKMINNSN  333 (334)
T ss_dssp             HHHHHHHHHHHHHHC-
T ss_pred             HHHHHHHHHHHHHHCC
T ss_conf             9999999999997437



>1yxo_A 4-hydroxythreonine-4-phosphate dehydrogenase 1; PA0593,pyridoxine biosynthesis,oxidoreductase, structural genomics, PSI; 2.01A {Pseudomonas aeruginosa} Back     alignment and structure
>2hi1_A 4-hydroxythreonine-4-phosphate dehydrogenase 2; pyridoxal phosphate biosynthesis, structural genomics, PSI-2; 2.30A {Salmonella typhimurium LT2} Back     alignment and structure
>1td9_A Phosphate acetyltransferase; structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; 2.75A {Bacillus subtilis} SCOP: c.77.1.5 PDB: 1xco_A Back     alignment and structure
>1vmi_A Putative phosphate acetyltransferase; NP_416953.1, structural genomics, JCSG, protein structure initiative, PSI; 2.32A {Escherichia coli} SCOP: c.77.1.5 Back     alignment and structure
>2af4_C Phosphate acetyltransferase; PTA dimer with one COA ligand bound PER monomer, acyltransferase; HET: COA; 2.15A {Methanosarcina thermophila} SCOP: c.77.1.5 PDB: 1qzt_A* 2af3_C* Back     alignment and structure
>1r5j_A Putative phosphotransacetylase; lactate dehydrogenase-like nucleotide-binding fold, structural genomics, BSGC structure funded by NIH; 2.70A {Streptococcus pyogenes} SCOP: c.77.1.5 Back     alignment and structure
>1u7n_A Fatty acid/phospholipid synthesis protein PLSX; structural genomics, enterococcus faecalis V583, PSI, protein structure initiative; HET: MSE; 2.26A {Enterococcus faecalis} SCOP: c.77.1.4 Back     alignment and structure
>1vi1_A Fatty acid/phospholipid synthesis protein PLSX; structural genomics, unknown function; HET: MSE; 2.95A {Bacillus subtilis} SCOP: c.77.1.4 Back     alignment and structure
>1yco_A Branched-chain phosphotransacylase; structural genomics, protein structure initiative, PSI, PTB, nysgxrc; 2.40A {Enterococcus faecalis V583} Back     alignment and structure
>2e0c_A 409AA long hypothetical NADP-dependent isocitrate dehydrogenase; homedimer, oxidoreductase; 2.00A {Sulfolobus tokodaii str} PDB: 2dht_A 2e5m_A* Back     alignment and structure
>1hqs_A Isocitrate dehydrogenase; glyoxylate bypass, bsidh, tricarboxylic acid cycle, oxidoreductase, protein phosphorylation, NADP; HET: CME CIT; 1.55A {Bacillus subtilis} SCOP: c.77.1.1 Back     alignment and structure
>2d4v_A Isocitrate dehydrogenase; alpha and beta protein, isocitrate/isopropylmalate dehydrogenase-like fold, oxidoreductase; HET: FLC NAD; 1.90A {Acidithiobacillus thiooxidans} Back     alignment and structure
>2iv0_A Isocitrate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, domain swapping, phosphorylation, aromatic cluster, NADP; 2.5A {Archaeoglobus fulgidus} Back     alignment and structure
>3dms_A Isocitrate dehydrogenase [NADP]; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.65A {Burkholderia pseudomallei} PDB: 1pb1_A* 1ai3_A* 1ika_A* 1ai2_A* 1p8f_A* 1pb3_A 1sjs_A 3icd_A 3lcb_C* 4icd_A* 5icd_A* 9icd_A* 1bl5_A* 1cw7_A* 1idd_A 1ide_A* 1hj6_A* 7icd_A 8icd_A* 6icd_A ... Back     alignment and structure
>2qfy_A Isocitrate dehydrogenase [NADP]; rossmann fold, oxidoreductase; HET: AKG; 2.10A {Saccharomyces cerevisiae} PDB: 2qfw_A* 2qfx_A* 2qfv_A* Back     alignment and structure
>2uxq_A Isocitrate dehydrogenase native; psychrophilic, cold adaptation, thermal stability, oxidoreductase; HET: SO4 PEG; 1.75A {Desulfotalea psychrophila} PDB: 2uxr_A* Back     alignment and structure
>1zor_A Isocitrate dehydrogenase; wild type enzyme, CIS-proline, thermostable, oxidoreductase; 2.24A {Thermotoga maritima MSB8} Back     alignment and structure
>3blx_B Isocitrate dehydrogenase [NAD] subunit 2; TCA cycle, oxidative metabolism, allostery, decarboxylase, allosteric enzyme, magnesium; 2.70A {Saccharomyces cerevisiae} PDB: 3blw_B* 3blv_B Back     alignment and structure
>1vlc_A 3-isopropylmalate dehydrogenase; TM0556, structural genomics, JCSG, PSI, protein structure initiative, joint center for structural genomics; 1.90A {Thermotoga maritima} SCOP: c.77.1.1 Back     alignment and structure
>3blx_A Isocitrate dehydrogenase [NAD] subunit 1; TCA cycle, oxidative metabolism, allostery, decarboxylase, allosteric enzyme, magnesium; 2.70A {Saccharomyces cerevisiae} PDB: 3blw_A 3blv_A* Back     alignment and structure
>1wpw_A 3-isopropylmalate dehydrogenase; oxidoreductase; 2.80A {Sulfolobus tokodaii} SCOP: c.77.1.1 Back     alignment and structure
>2d1c_A Isocitrate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAP CIT; 1.80A {Thermus thermophilus HB8} Back     alignment and structure
>1a05_A IPMDH, IMDH, 3-isopropylmalate dehydrogenase; oxidoreductase, decarboxylating dehydrogenase, leucine biosynthesis; HET: IPM; 2.00A {Acidithiobacillus ferrooxidans} SCOP: c.77.1.1 Back     alignment and structure
>1x0l_A Homoisocitrate dehydrogenase; oxidoreductase, decarboxylating dehydrogenase, lysine biosynthesis; 1.85A {Thermus thermophilus} Back     alignment and structure
>1v53_A 3-isopropylmalate dehydrogenase; IPMDH, HOMO dimer, X-RAY analysis, oxidoreductase; 2.85A {Bacillus coagulans} SCOP: c.77.1.1 PDB: 2ayq_A 1v5b_A Back     alignment and structure
>1cnz_A IPMDH, IMDH, protein (3-isopropylmalate dehydrogenase); oxidoreductase, leucine biosynthetic pathway, NAD-dependant enzyme; 1.76A {Salmonella typhimurium} SCOP: c.77.1.1 PDB: 1cm7_A Back     alignment and structure
>1g2u_A IPMDH, 3-isopropylmalate dehydrogenase; beta-barrel, NAD binding, oxidoreductase; 2.10A {Thermus thermophilus HB8} SCOP: c.77.1.1 PDB: 1osj_A 1gc8_A 1xaa_A 1osi_A 1hex_A 1xab_A 2ztw_A* 1gc9_A 1ipd_A 1wal_A 1dpz_A 1dr0_A 1dr8_A 1idm_A 1xac_A 1xad_A Back     alignment and structure
>3flk_A Tartrate dehydrogenase/decarboxylase; cytoplasm, lyase, magnesium, manganese, NAD, oxidoreductase; HET: NAD; 2.00A {Pseudomonas putida} PDB: 3fmx_X* Back     alignment and structure
>1w0d_A 3-isopropylmalate dehydrogenase; oxidoreductase, leucine biosynthesis, NAD, structural genomics, PSI, protein structure initiative; 1.65A {Mycobacterium tuberculosis} SCOP: c.77.1.1 PDB: 2g4o_A Back     alignment and structure
>1tyo_A Isocitrate dehydrogenase; enzyme-ethenonadp complex, oxidoreductase; HET: ENP; 2.15A {Aeropyrum pernix} PDB: 1v94_A 1xgv_A 1xkd_A* Back     alignment and structure
>1lwd_A Isocitrate dehydrogenase; tricarboxylic acid cycle, oxidoreductase, NADP; HET: ICT; 1.85A {Sus scrofa} SCOP: c.77.1.1 PDB: 1t0l_A* 1t09_A* 3inm_A* 2cmj_A* 2cmv_A* Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 343 4-hydroxythreonine-4-phosphate dehydrogenase [Candidatu
d1ptma_329 c.77.1.3 (A:) 4-hydroxythreonine-4-phosphate dehydrogen 2e-56
>d1ptma_ c.77.1.3 (A:) 4-hydroxythreonine-4-phosphate dehydrogenase PdxA {Escherichia coli [TaxId: 562]} Length = 329 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Isocitrate/Isopropylmalate dehydrogenase-like
superfamily: Isocitrate/Isopropylmalate dehydrogenase-like
family: PdxA-like
domain: 4-hydroxythreonine-4-phosphate dehydrogenase PdxA
species: Escherichia coli [TaxId: 562]
 Score =  213 bits (543), Expect = 2e-56
 Identities = 108/332 (32%), Positives = 165/332 (49%), Gaps = 9/332 (2%)

Query: 1   MDEFLPLILTQGDPAGIGPDISLKAWASRQITAIPPFIYIGDVDVLNARAKQLNLSVPLY 60
           M +   +++T G+PAGIGPD+ ++             +   D  +L  RA  L L + L 
Sbjct: 1   MVKTQRVVITPGEPAGIGPDLVVQLAQREWPV---ELVVCADATLLTNRAAMLGLPLTLR 57

Query: 61  ETDCKN-AVSIFKKALPIISSPCGAKIVTGTPNPQTASSTIANIEKAVSLTLSGQALAIV 119
                + A       L ++     A +  G    +     +  + +A    L+G+  A++
Sbjct: 58  PYSPNSPAQPQTAGTLTLLPVALRAPVTAGQLAVENGHYVVETLARACDGCLNGEFAALI 117

Query: 120 TNPIAKFLLYQEKFKFPGHTEFLAELAKKNTGITFKPVMMLSGPQLRTVPVTIHIPIADI 179
           T P+ K ++      F GHTEF      +      K VMML+  +LR    T H+P+ DI
Sbjct: 118 TGPVHKGVINDAGIPFTGHTEF-----FEERSQAKKVVMMLATEELRVALATTHLPLRDI 172

Query: 180 CRILSTKRIIETSDTVYNAMKKYFGINNPRIAISGLNPHAGENATIGIEEKNIIIPAITY 239
              ++   + E    +++ ++  FGI  PRI + GLNPHAGE   +G EE + IIP +  
Sbjct: 173 ADAITPALLHEVIAILHHDLRTKFGIAEPRILVCGLNPHAGEGGHMGTEEIDTIIPVLNE 232

Query: 240 LRNDNKNIIGPLPADSMFHHSARQCYDVAICMYHDQALIPIKTLDFNQTVNITLGLPFVR 299
           LR     + GPLPAD++F        D  + MYHDQ L  +K   F + VNITLGLPF+R
Sbjct: 233 LRAQGMKLNGPLPADTLFQPKYLDNADAVLAMYHDQGLPVLKYQGFGRGVNITLGLPFIR 292

Query: 300 TSPDHGTAFDIAGSSLTQEESLVSALKIAAQL 331
           TS DHGTA ++AG       S ++AL +A ++
Sbjct: 293 TSVDHGTALELAGRGKADVGSFITALNLAIKM 324


Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target343 4-hydroxythreonine-4-phosphate dehydrogenase [Candidatu
d1ptma_329 4-hydroxythreonine-4-phosphate dehydrogenase PdxA {Esch 100.0
d1xcoa_324 Phosphotransacetylase Pta {Bacillus subtilis [TaxId: 14 99.08
d2af4c1332 Phosphotransacetylase Pta {Methanosarcina thermophila [ 99.02
d1r5ja_329 Phosphotransacetylase Pta {Streptococcus pyogenes [TaxI 98.94
d1vmia_329 Ethanolamine utilization protein EutD {Escherichia coli 98.91
d1vi1a_334 Fatty acid/phospholipid synthesis protein PlsX {Bacillu 98.49
d1u7na_329 Fatty acid/phospholipid synthesis protein PlsX {Enteroc 98.1
d1pb1a_416 Isocitrate dehydrogenase, ICDH {Escherichia coli [TaxId 97.6
d1hqsa_423 Isocitrate dehydrogenase, ICDH {Bacillus subtilis [TaxI 97.36
d1t0la_414 NADP-dependent isocitrate dehydrogenase {Human (Homo sa 97.03
d1lwda_413 NADP-dependent isocitrate dehydrogenase {Pig (Sus scrof 93.57
d1vlca_362 3-isopropylmalate dehydrogenase, IPMDH {Thermotoga mari 97.47
d1wpwa_336 3-isopropylmalate dehydrogenase, IPMDH {Sulfolobus toko 97.44
d1cnza_363 3-isopropylmalate dehydrogenase, IPMDH {Salmonella typh 97.4
d1w0da_337 3-isopropylmalate dehydrogenase, IPMDH {Mycobacterium t 96.97
d1g2ua_345 3-isopropylmalate dehydrogenase, IPMDH {Thermus thermop 96.85
d1v53a1356 3-isopropylmalate dehydrogenase, IPMDH {Bacillus coagul 96.74
d1a05a_357 3-isopropylmalate dehydrogenase, IPMDH {Thiobacillus fe 96.64
>d1ptma_ c.77.1.3 (A:) 4-hydroxythreonine-4-phosphate dehydrogenase PdxA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Isocitrate/Isopropylmalate dehydrogenase-like
superfamily: Isocitrate/Isopropylmalate dehydrogenase-like
family: PdxA-like
domain: 4-hydroxythreonine-4-phosphate dehydrogenase PdxA
species: Escherichia coli [TaxId: 562]
Probab=100.00  E-value=0  Score=879.81  Aligned_cols=328  Identities=33%  Similarity=0.547  Sum_probs=313.6

Q ss_pred             CCCCCCEEEECCCCCCCCHHHHHHHHCCCCHHCCCCEEEECCHHHHHHHHHHCCCCCCEEECCCCHHCC-CCCCCEEEEC
Q ss_conf             988883899718987747899999842852324898999939999999999818997447538610111-2678537610
Q gi|254780397|r    1 MDEFLPLILTQGDPAGIGPDISLKAWASRQITAIPPFIYIGDVDVLNARAKQLNLSVPLYETDCKNAVS-IFKKALPIIS   79 (343)
Q Consensus         1 M~k~~pI~IT~GDPaGIGpEIilKal~~~~~~~~~~~viigd~~~l~~~~k~l~~~~~i~~i~~~~~~~-~~~~~i~i~~   79 (343)
                      |.|.+||+||+|||+||||||++|+|++.   ..+++++|||+++++++++.++++++++.++..++.. ...+.+++++
T Consensus         1 M~k~krIaIT~GDPaGIGPEIilK~~~~~---~~~~~ivigd~~~l~~~~~~l~~~~~i~~i~~~~~~~~~~~~~l~i~~   77 (329)
T d1ptma_           1 MVKTQRVVITPGEPAGIGPDLVVQLAQRE---WPVELVVCADATLLTNRAAMLGLPLTLRPYSPNSPAQPQTAGTLTLLP   77 (329)
T ss_dssp             CCCCCEEEEECCSTTSSHHHHHHHHTTSC---CSSEEEEEECHHHHHHHHHHTTCCCEEEECCTTSCCCCCCTTEEEEEE
T ss_pred             CCCCCEEEEECCCCCHHHHHHHHHHHHHC---CCCCEEEEECHHHHHHHHHHCCCCCEEEECCCCHHHHHCCCCCCCCCC
T ss_conf             99998699982786074899999998516---899879998999999999984999627886872232001254312354


Q ss_pred             CCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEECHHHHHHHHHHCCCCCCHHHHHHHHHCCCCCCCCCCCCC
Q ss_conf             33322001355310000024677887766430123430443223447776410132564789999834235886652112
Q gi|254780397|r   80 SPCGAKIVTGTPNPQTASSTIANIEKAVSLTLSGQALAIVTNPIAKFLLYQEKFKFPGHTEFLAELAKKNTGITFKPVMM  159 (343)
Q Consensus        80 ~~~~~~~~~G~~s~~~g~~~~~sl~~A~~l~~~g~~~alVT~PInK~~l~~aG~~f~GhTE~La~~~~~~~~~~~~~~Ml  159 (343)
                      .+...++++|++++++|+++++||+.|+++|++|+++||||+||||++|+.+|++|+||||||+++++.+     +++||
T Consensus        78 ~~~~~~~~~G~~~~~~g~~a~~~l~~A~~~~~~g~~~alVT~PInK~~i~~ag~~f~GHTE~La~~~~~~-----~~~Mm  152 (329)
T d1ptma_          78 VALRAPVTAGQLAVENGHYVVETLARACDGCLNGEFAALITGPVHKGVINDAGIPFTGHTEFFEERSQAK-----KVVMM  152 (329)
T ss_dssp             CCCSSCCBTTBCCTTHHHHHHHHHHHHHHHHHHTSCSEEEECCCCHHHHHHTTCCCCCHHHHHHHHTTCS-----CCEEE
T ss_pred             CHHCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCEEECCCCHHHHHHHCCCCCCEEEEEHHCCCCCC-----CHHHH
T ss_conf             0000122334432100037899999999998638765143174044555313776431541000022355-----26888


Q ss_pred             CCCCCCEEEEECCCCCHHHHHHHCCHHHHHHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCCCCCCCCHHHHHHHHH
Q ss_conf             33221126653045313334320102456788898999998531345670799963665445310000121024458886
Q gi|254780397|r  160 LSGPQLRTVPVTIHIPIADICRILSTKRIIETSDTVYNAMKKYFGINNPRIAISGLNPHAGENATIGIEEKNIIIPAITY  239 (343)
Q Consensus       160 l~~~~L~V~l~TtHiPLk~V~~~it~~~I~~ki~~~~~~l~~~~gi~~PkIaV~gLNPHAGE~G~~G~EE~~iI~PaI~~  239 (343)
                      |++++|||+|+|||||||+|++.||+++|.+++++++++|+++||+++||||||||||||||+|+||+||+++|.|||++
T Consensus       153 l~~~~L~V~~vTtHipLk~V~~~it~~~i~~~i~~~~~~l~~~~gi~~PrIaV~gLNPHaGE~G~~G~EE~~ii~Pai~~  232 (329)
T d1ptma_         153 LATEELRVALATTHLPLRDIADAITPALLHEVIAILHHDLRTKFGIAEPRILVCGLNPHAGEGGHMGTEEIDTIIPVLNE  232 (329)
T ss_dssp             EESSSCEEEESSCSSCGGGHHHHCCHHHHHHHHHHHHHHHHHTTCCSSCEEEEECSSGGGGGGGTTCSHHHHTHHHHHHH
T ss_pred             HHHHHHHEEEEEECCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCCCCHHHHHHHHHHHHHHH
T ss_conf             77644200110112025555542106889999999999999851985400257511654220011014556778889999


Q ss_pred             HHHCCCCCCCCCCCHHHEECCCCCCCCEEEEEECCHHHHHHHHHCCCCEEEEEEECCEEEECCCCCCCHHHCCCCCCCHH
Q ss_conf             42158764345551121000223667689998512022555541447727999208764755887552221336866838
Q gi|254780397|r  240 LRNDNKNIIGPLPADSMFHHSARQCYDVAICMYHDQALIPIKTLDFNQTVNITLGLPFVRTSPDHGTAFDIAGSSLTQEE  319 (343)
Q Consensus       240 ~~~~g~~v~GP~paDt~F~~~~~~~~D~vlamYHDQglip~K~l~f~~~Vn~t~GLp~irtSpdHGTafdiagk~~a~~~  319 (343)
                      +|++|++++|||||||+|.++++++||+||||||||||||||+++|++|||+|+||||+||||||||||||||||+||+.
T Consensus       233 ~~~~gi~v~GP~paDt~F~~~~~~~~D~vvamYHDQglip~K~~~f~~~vn~tlGLp~irtSpdHGTA~dIagk~~A~~~  312 (329)
T d1ptma_         233 LRAQGMKLNGPLPADTLFQPKYLDNADAVLAMYHDQGLPVLKYQGFGRGVNITLGLPFIRTSVDHGTALELAGRGKADVG  312 (329)
T ss_dssp             HHHTTCEEEEEECHHHHSSHHHHTTCSEEEESSHHHHHHHHHTTCSSSCEEEEESSSSEEEECSSCCCGGGTTSSCCCCH
T ss_pred             HHHCCCCCCCCCCCCHHHHHHHCCCCCEEEEECCCCCCHHHHHCCCCCEEEEECCCCCEEECCCCCCHHHHCCCCCCCHH
T ss_conf             98669554799886024545422774189886243100555541456407984389912768998722434378989969


Q ss_pred             HHHHHHHHHHHHHHHHH
Q ss_conf             99999999999998520
Q gi|254780397|r  320 SLVSALKIAAQLGYQKN  336 (343)
Q Consensus       320 s~~~ai~~a~~~~~~~~  336 (343)
                      ||++|+++|.+|++||+
T Consensus       313 s~~~ai~~a~~~~~~~~  329 (329)
T d1ptma_         313 SFITALNLAIKMIVNTQ  329 (329)
T ss_dssp             HHHHHHHHHHHHHHHHC
T ss_pred             HHHHHHHHHHHHHHCCC
T ss_conf             99999999999986179



>d1xcoa_ c.77.1.5 (A:) Phosphotransacetylase Pta {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2af4c1 c.77.1.5 (C:2-333) Phosphotransacetylase Pta {Methanosarcina thermophila [TaxId: 2210]} Back     information, alignment and structure
>d1r5ja_ c.77.1.5 (A:) Phosphotransacetylase Pta {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1vmia_ c.77.1.5 (A:) Ethanolamine utilization protein EutD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vi1a_ c.77.1.4 (A:) Fatty acid/phospholipid synthesis protein PlsX {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1u7na_ c.77.1.4 (A:) Fatty acid/phospholipid synthesis protein PlsX {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1pb1a_ c.77.1.1 (A:) Isocitrate dehydrogenase, ICDH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hqsa_ c.77.1.1 (A:) Isocitrate dehydrogenase, ICDH {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1t0la_ c.77.1.1 (A:) NADP-dependent isocitrate dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lwda_ c.77.1.1 (A:) NADP-dependent isocitrate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1vlca_ c.77.1.1 (A:) 3-isopropylmalate dehydrogenase, IPMDH {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wpwa_ c.77.1.1 (A:) 3-isopropylmalate dehydrogenase, IPMDH {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1cnza_ c.77.1.1 (A:) 3-isopropylmalate dehydrogenase, IPMDH {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1w0da_ c.77.1.1 (A:) 3-isopropylmalate dehydrogenase, IPMDH {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1g2ua_ c.77.1.1 (A:) 3-isopropylmalate dehydrogenase, IPMDH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1v53a1 c.77.1.1 (A:1-356) 3-isopropylmalate dehydrogenase, IPMDH {Bacillus coagulans [TaxId: 1398]} Back     information, alignment and structure
>d1a05a_ c.77.1.1 (A:) 3-isopropylmalate dehydrogenase, IPMDH {Thiobacillus ferrooxidans [TaxId: 920]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 343 4-hydroxythreonine-4-phosphate dehydrogenase [Cand
1ptm_A_329 (A:) 4-hydroxythreonine-4-phosphate dehydrogenase; 2e-96
2hi1_A_330 (A:) 4-hydroxythreonine-4-phosphate dehydrogenase 4e-96
1yxo_A_328 (A:) 4-hydroxythreonine-4-phosphate dehydrogenase 4e-95
>1ptm_A (A:) 4-hydroxythreonine-4-phosphate dehydrogenase; crystal strucrure, PDXA, pyridoxal 5'-phosphate biosynthesis, PLP; 1.96A {Escherichia coli}Length = 329 Back     alignment and structure
 Score =  347 bits (891), Expect = 2e-96
 Identities = 105/332 (31%), Positives = 160/332 (48%), Gaps = 9/332 (2%)

Query: 6   PLILTQGDPAGIGPDISLKAWASRQITAIPPFIYIGDVDVLNARAKQLNLSVPLYETDCK 65
            +++T G+PAGIGPD+ ++             +   D  +L  RA  L L + L      
Sbjct: 6   RVVITPGEPAGIGPDLVVQLAQREWP---VELVVCADATLLTNRAAXLGLPLTLRPYSPN 62

Query: 66  N-AVSIFKKALPIISSPCGAKIVTGTPNPQTASSTIANIEKAVSLTLSGQALAIVTNPIA 124
           + A       L ++     A +  G    +     +  + +A    L+G+  A++T P+ 
Sbjct: 63  SPAQPQTAGTLTLLPVALRAPVTAGQLAVENGHYVVETLARACDGCLNGEFAALITGPVH 122

Query: 125 KFLLYQEKFKFPGHTEFLAELAKKNTGITFKPVMMLSGPQLRTVPVTIHIPIADICRILS 184
           K ++      F GHTEF  E ++       K V  L+  +LR    T H+P+ DI   ++
Sbjct: 123 KGVINDAGIPFTGHTEFFEERSQ-----AKKVVXXLATEELRVALATTHLPLRDIADAIT 177

Query: 185 TKRIIETSDTVYNAMKKYFGINNPRIAISGLNPHAGENATIGIEEKNIIIPAITYLRNDN 244
              + E    +++ ++  FGI  PRI + GLNPHAGE    G EE + IIP +  LR   
Sbjct: 178 PALLHEVIAILHHDLRTKFGIAEPRILVCGLNPHAGEGGHXGTEEIDTIIPVLNELRAQG 237

Query: 245 KNIIGPLPADSMFHHSARQCYDVAICMYHDQALIPIKTLDFNQTVNITLGLPFVRTSPDH 304
             + GPLPAD++F        D  +  YHDQ L  +K   F + VNITLGLPF+RTS DH
Sbjct: 238 XKLNGPLPADTLFQPKYLDNADAVLAXYHDQGLPVLKYQGFGRGVNITLGLPFIRTSVDH 297

Query: 305 GTAFDIAGSSLTQEESLVSALKIAAQLGYQKN 336
           GTA ++AG       S ++AL +A +      
Sbjct: 298 GTALELAGRGKADVGSFITALNLAIKXIVNTQ 329


>2hi1_A (A:) 4-hydroxythreonine-4-phosphate dehydrogenase 2; pyridoxal phosphate biosynthesis, structural genomics, PSI-2; 2.30A {Salmonella typhimurium LT2}Length = 330 Back     alignment and structure
>1yxo_A (A:) 4-hydroxythreonine-4-phosphate dehydrogenase 1; PA0593,pyridoxine biosynthesis,oxidoreductase, structural genomics, PSI; 2.01A {Pseudomonas aeruginosa}Length = 328 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target343 4-hydroxythreonine-4-phosphate dehydrogenase [Candidatu
1ptm_A_329 4-hydroxythreonine-4-phosphate dehydrogenase; crys 100.0
1yxo_A_328 4-hydroxythreonine-4-phosphate dehydrogenase 1; PA 100.0
2hi1_A_330 4-hydroxythreonine-4-phosphate dehydrogenase 2; py 100.0
1vi1_A_345 Fatty acid/phospholipid synthesis protein PLSX; st 98.81
1hqs_A_423 Isocitrate dehydrogenase; glyoxylate bypass, bsidh 97.2
2iv0_A_412 Isocitrate dehydrogenase; oxidoreductase, tricarbo 97.03
2e0c_A_409 409AA long hypothetical NADP-dependent isocitrate 96.93
1tyo_A_435 Isocitrate dehydrogenase; enzyme-ethenonadp comple 96.7
2qfy_A_1-153_201-427380 Isocitrate dehydrogenase [NADP]; rossmann fold, ox 96.09
1zor_A_1-104_283-399221 Isocitrate dehydrogenase; wild type enzyme, CIS-pr 91.47
2d4v_A_429 Isocitrate dehydrogenase; alpha and beta protein, 97.07
3flk_A_364 Tartrate dehydrogenase/decarboxylase; cytoplasm, l 97.05
3dms_A_427 Isocitrate dehydrogenase [NADP]; structural genomi 96.91
1a05_A_358 IPMDH, IMDH, 3-isopropylmalate dehydrogenase; oxid 96.78
1cnz_A_363 IPMDH, IMDH, protein (3-isopropylmalate dehydrogen 96.47
1x0l_A_333 Homoisocitrate dehydrogenase; oxidoreductase, deca 96.39
1w0d_A_337 3-isopropylmalate dehydrogenase; oxidoreductase, l 96.39
2d1c_A_1-370370 Isocitrate dehydrogenase; structural genomics, NPP 96.36
3blx_B_354 Isocitrate dehydrogenase [NAD] subunit 2; TCA cycl 96.25
1v53_A_366 3-isopropylmalate dehydrogenase; IPMDH, HOMO dimer 96.18
1g2u_A_345 IPMDH, 3-isopropylmalate dehydrogenase; beta-barre 96.15
3blx_A_349 Isocitrate dehydrogenase [NAD] subunit 1; TCA cycl 96.1
1vlc_A_366 3-isopropylmalate dehydrogenase; TM0556, structura 95.79
1wpw_A_336 3-isopropylmalate dehydrogenase; oxidoreductase; 2 95.72
2uxq_A_1-137_182-402358 Isocitrate dehydrogenase native; psychrophilic, co 93.93
1lwd_A_1-139_185-413368 Isocitrate dehydrogenase; tricarboxylic acid cycle 93.73
1yco_A_95-246152 Branched-chain phosphotransacylase; structural gen 97.03
1r5j_A_153-306154 Putative phosphotransacetylase; lactate dehydrogen 96.55
1vmi_A_1-23_155-309178 Putative phosphate acetyltransferase; NP_416953.1, 96.32
2af4_C_144-302159 Phosphate acetyltransferase; PTA dimer with one CO 96.28
1td9_A_151-302152 Phosphate acetyltransferase; structural genomics, 95.96
1u7n_A_120-228109 Fatty acid/phospholipid synthesis protein PLSX; st 90.79
1u7n_A_1-119_283-336173 Fatty acid/phospholipid synthesis protein PLSX; st 95.85
1td9_A_1-150_303-329177 Phosphate acetyltransferase; structural genomics, 95.52
1r5j_A_1-152_307-337183 Putative phosphotransacetylase; lactate dehydrogen 95.43
1vmi_A_24-154_310-355177 Putative phosphate acetyltransferase; NP_416953.1, 95.38
2af4_C_1-143_303-333174 Phosphate acetyltransferase; PTA dimer with one CO 94.53
>1ptm_A (A:) 4-hydroxythreonine-4-phosphate dehydrogenase; crystal strucrure, PDXA, pyridoxal 5'-phosphate biosynthesis, PLP; 1.96A {Escherichia coli} Back     alignment and structure
Probab=100.00  E-value=0  Score=874.31  Aligned_cols=327  Identities=32%  Similarity=0.533  Sum_probs=316.3

Q ss_pred             CCCCCCEEEECCCCCCCCHHHHHHHHCCCCHHCCCCEEEECCHHHHHHHHHHCCCCCCEEECCCCHHCCCC-CCCEEEEC
Q ss_conf             98888389971898774789999984285232489899993999999999981899744753861011126-78537610
Q gi|254780397|r    1 MDEFLPLILTQGDPAGIGPDISLKAWASRQITAIPPFIYIGDVDVLNARAKQLNLSVPLYETDCKNAVSIF-KKALPIIS   79 (343)
Q Consensus         1 M~k~~pI~IT~GDPaGIGpEIilKal~~~~~~~~~~~viigd~~~l~~~~k~l~~~~~i~~i~~~~~~~~~-~~~i~i~~   79 (343)
                      |++ ++|+||+|||+||||||++|+|++.   +.|++|+|||.++|+++++.++++++++.++..++.+.. .+.+++++
T Consensus         2 M~k-~~IaIT~GDPaGIGPEIi~kal~~~---~~~~~viiGd~~vl~~~~~~lg~~~~~~~i~~~~~~~~~~~~~i~v~~   77 (329)
T 1ptm_A            2 VKT-QRVVITPGEPAGIGPDLVVQLAQRE---WPVELVVCADATLLTNRAAXLGLPLTLRPYSPNSPAQPQTAGTLTLLP   77 (329)
T ss_dssp             CCC-CEEEEECCSTTSSHHHHHHHHTTSC---CSSEEEEEECHHHHHHHHHHTTCCCEEEECCTTSCCCCCCTTEEEEEE
T ss_pred             CCC-CEEEEECCCCCHHHHHHHHHHHHCC---CCCCEEEEECHHHHHHHHHHCCCCCEEEECCCCCHHCCCCCCCEEEEC
T ss_conf             989-8599973785073799999998217---899879998999999999984999627885884110314478037621


Q ss_pred             CCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEECHHHHHHHHHHCCCCCCHHHHHHHHHCCCCCCCCCCCCC
Q ss_conf             33322001355310000024677887766430123430443223447776410132564789999834235886652112
Q gi|254780397|r   80 SPCGAKIVTGTPNPQTASSTIANIEKAVSLTLSGQALAIVTNPIAKFLLYQEKFKFPGHTEFLAELAKKNTGITFKPVMM  159 (343)
Q Consensus        80 ~~~~~~~~~G~~s~~~g~~~~~sl~~A~~l~~~g~~~alVT~PInK~~l~~aG~~f~GhTE~La~~~~~~~~~~~~~~Ml  159 (343)
                      .+...++++|++|+++|+++++|+++|+++|++|++|||||+||||++|+.+|++|+||||||+++++.+     +++||
T Consensus        78 ~~~~~~i~~G~~s~~~G~aa~~~i~~A~~~~~~g~~daiVT~PI~K~a~~~aG~~f~GHTE~la~~~~~~-----~~~mm  152 (329)
T 1ptm_A           78 VALRAPVTAGQLAVENGHYVVETLARACDGCLNGEFAALITGPVHKGVINDAGIPFTGHTEFFEERSQAK-----KVVXX  152 (329)
T ss_dssp             CCCSSCCBTTBCCTTHHHHHHHHHHHHHHHHHHTSCSEEEECCCCHHHHHHTTCCCCCHHHHHHHHTTCS-----CCEEE
T ss_pred             CCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCEEEECCHHHHHHHHCCCCCCCHHHHHHHCCCCC-----CCEEE
T ss_conf             2134676767651346999999999999998438643798477357778855887477106655301578-----72245


Q ss_pred             CCCCCCEEEEECCCCCHHHHHHHCCHHHHHHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCCCCCCCCHHHHHHHHH
Q ss_conf             33221126653045313334320102456788898999998531345670799963665445310000121024458886
Q gi|254780397|r  160 LSGPQLRTVPVTIHIPIADICRILSTKRIIETSDTVYNAMKKYFGINNPRIAISGLNPHAGENATIGIEEKNIIIPAITY  239 (343)
Q Consensus       160 l~~~~L~V~l~TtHiPLk~V~~~it~~~I~~ki~~~~~~l~~~~gi~~PkIaV~gLNPHAGE~G~~G~EE~~iI~PaI~~  239 (343)
                      |.+++|||+++|+||||++|++.||+++|.+++++++++|+++||+++||||||||||||||+|+||+||+++|.|||++
T Consensus       153 l~~~~Lrv~l~T~HipL~~V~~~it~~~i~~~i~~~~~~l~~~~gi~~PrIaV~gLNPHAGe~G~~G~EE~~ii~Pai~~  232 (329)
T 1ptm_A          153 LATEELRVALATTHLPLRDIADAITPALLHEVIAILHHDLRTKFGIAEPRILVCGLNPHAGEGGHXGTEEIDTIIPVLNE  232 (329)
T ss_dssp             EESSSCEEEESSCSSCGGGHHHHCCHHHHHHHHHHHHHHHHHTTCCSSCEEEEECSSGGGGGGGTTCSHHHHTHHHHHHH
T ss_pred             EEECCCEEEEECCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHH
T ss_conf             55257489995444778999998769999999999999999852998871799614898532466651336659999999


Q ss_pred             HHHCCCCCCCCCCCHHHEECCCCCCCCEEEEEECCHHHHHHHHHCCCCEEEEEEECCEEEECCCCCCCHHHCCCCCCCHH
Q ss_conf             42158764345551121000223667689998512022555541447727999208764755887552221336866838
Q gi|254780397|r  240 LRNDNKNIIGPLPADSMFHHSARQCYDVAICMYHDQALIPIKTLDFNQTVNITLGLPFVRTSPDHGTAFDIAGSSLTQEE  319 (343)
Q Consensus       240 ~~~~g~~v~GP~paDt~F~~~~~~~~D~vlamYHDQglip~K~l~f~~~Vn~t~GLp~irtSpdHGTafdiagk~~a~~~  319 (343)
                      +|++|++++||+||||+|.+..+++||+||||||||||||||+++|++|||+|+|||||||||||||||||||||+||++
T Consensus       233 ~~~~g~~v~GP~paDt~F~~~~~~~~D~vvaMYHDQglip~K~l~f~~gVnvTlGLP~iRTS~DHGTAfdIAGkg~A~~~  312 (329)
T 1ptm_A          233 LRAQGXKLNGPLPADTLFQPKYLDNADAVLAXYHDQGLPVLKYQGFGRGVNITLGLPFIRTSVDHGTALELAGRGKADVG  312 (329)
T ss_dssp             HHHTTCEEEEEECHHHHSSHHHHTTCSEEEESSHHHHHHHHHTTCSSSCEEEEESSSSEEEECSSCCCGGGTTSSCCCCH
T ss_pred             HHHCCCCCCCCCCCCHHHHHHCCCCCCEEEECCHHCCCHHHHEECCCCCEEEECCCCEEEECCCCCCHHHHCCCCCCCHH
T ss_conf             98769877899894155654202589889971410044032010467527995489955778998616665078889869


Q ss_pred             HHHHHHHHHHHHHHHHH
Q ss_conf             99999999999998520
Q gi|254780397|r  320 SLVSALKIAAQLGYQKN  336 (343)
Q Consensus       320 s~~~ai~~a~~~~~~~~  336 (343)
                      ||++||++|++|++||+
T Consensus       313 S~~~Ai~lA~~la~~r~  329 (329)
T 1ptm_A          313 SFITALNLAIKXIVNTQ  329 (329)
T ss_dssp             HHHHHHHHHHHHHHHHC
T ss_pred             HHHHHHHHHHHHHHCCC
T ss_conf             99999999999986279



>1yxo_A (A:) 4-hydroxythreonine-4-phosphate dehydrogenase 1; PA0593,pyridoxine biosynthesis,oxidoreductase, structural genomics, PSI; 2.01A {Pseudomonas aeruginosa} Back     alignment and structure
>2hi1_A (A:) 4-hydroxythreonine-4-phosphate dehydrogenase 2; pyridoxal phosphate biosynthesis, structural genomics, PSI-2; 2.30A {Salmonella typhimurium LT2} Back     alignment and structure
>1vi1_A (A:) Fatty acid/phospholipid synthesis protein PLSX; structural genomics, unknown function; HET: MSE; 2.95A {Bacillus subtilis} Back     alignment and structure
>1hqs_A (A:) Isocitrate dehydrogenase; glyoxylate bypass, bsidh, tricarboxylic acid cycle, oxidoreductase, protein phosphorylation, NADP; HET: CME CIT; 1.55A {Bacillus subtilis} Back     alignment and structure
>2iv0_A (A:) Isocitrate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, domain swapping, phosphorylation, aromatic cluster, NADP; 2.5A {Archaeoglobus fulgidus} Back     alignment and structure