254780405

254780405

hypothetical protein CLIBASIA_01450

GeneID in NCBI database:8209390Locus tag:CLIBASIA_01450
Protein GI in NCBI database:254780405Protein Accession:YP_003064818.1
Gene range:-(306139, 306708)Protein Length:189aa
Gene description:hypothetical protein
COG prediction:[L] N6-adenine-specific methylase
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------19
MNKIRIIGGKFQRRLLHTPQNRSIRPSDSRTKKALFDILTHVYPVFLDSTRMLNIFAGTGSVGFEALSRGCHYVLFVDNNSESIRLIRRNSELLGVEKNCNIFFRDVLRLGKIGNISPFQLVYLDPPYGQGLAQQALAIIDKEGWLEPNALVIIEEYAGTCISVGAAFHFLQERKYGDTKIYFFSYNPV
ccccEEEEEEcccEEEEccccccccccHHHHHHHHHHHHHHHHHccccccEEEEccccccHHHHHHHcccccEEEEEEccHHHHHHHHHHHHHccccccEEEEEccHHHHHHccccccccEEEEcccccccHHHHHHHHHHHccccccccEEEEEcccccccccccccEEEEEEccccEEEEEEEEccc
cccEEEEEEcccccccccccccccccccHHHHHHHHHHHccccccHcccccEEcHHcccHHHHHHHHHccccEEEEEcccHHHHHHHHHHHHHcccccccEEEcHHHHHHHHcccccccEEEEEccccHccHHHHHHHHHHHcccccccEEEEEEccccccccccccHHHHEEcccccEEEEEEEEccc
MNKIRIIGGKFQrrllhtpqnrsirpsdsrTKKALFDILTHVYPVFLDSTRMLNIFAGTGSVGFEALSRGCHYvlfvdnnsesIRLIRRNsellgvekncNIFFRDVLrlgkignispfqlvyldppygqglAQQALAIIdkegwlepnALVIIEEYAGTCISVGAAFHFlqerkygdtkiYFFSYNPV
mnkiriiggkfqrrllhtpqnrsirpsdsrTKKALFDILTHVYPVFLDSTRMLNIFAGTGSVGFEALSRGCHYVLfvdnnsesiRLIRrnsellgveknCNIFFRDVLRLGKIGNISPFQLVYLDPPYGQGLAQQALAIIDKEGWLEPNALVIIEEYAGTCISVGAAFHFLQERKYGDTKIYFFSYNPV
MNKIRIIGGKFQRRLLHTPQNRSIRPSDSRTKKALFDILTHVYPVFLDSTRMLNIFAGTGSVGFEALSRGCHYVLFVDNNSESIRLIRRNSELLGVEKNCNIFFRDVLRLGKIGNISPFQLVYLDPPYGQGLAQQALAIIDKEGWLEPNALVIIEEYAGTCISVGAAFHFLQERKYGDTKIYFFSYNPV
*NKIRIIGGKFQRRLLHTPQNRSIRPSDSRTKKALFDILTHVYPVFLDSTRMLNIFAGTGSVGFEALSRGCHYVLFVDNNSESIRLIRRNSELLGVEKNCNIFFRDVLRLGKIGNISPFQLVYLDPPYGQGLAQQALAIIDKEGWLEPNALVIIEEYAGTCISVGAAFHFLQERKYGDTKIYFFSYNPV
MNKIRIIGGKFQRRLLHTPQ*********RTKKALFDILTHVYPVFLDSTRMLNIFAGTGSVGFEALSRGCHYVLFVDNNSESIRLIRRNSELLGVEKNCNIFFRDVLRLGKIGNISPFQLVYLDPPYGQGLAQQALAIIDKEGWLEPNALVIIEEYAGTCISVGAAFHFLQERKYGDTKIYFFSYNPV
*NKIRIIGGKFQRRLLHTPQNRSIRPSDSRTKKALFDILTHVYPVFLDSTRMLNIFAGTGSVGFEALSRGCHYVLFVDNNSESIRLIRRNSELLGVEKNCNIFFRDVLRLGKIGNISPFQLVYLDPPYGQGLAQQALAIIDKEGWLEPNALVIIEEYAGTCISVGAAFHFLQERKYGDTKIYFFSYNP*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNKIRIIGGKFQRRLLHTPQNRSIRPSDSRTKKALFDILTHVYPVFLDSTRMLNIFAGTGSVGFEALSRGCHYVLFVDNNSESIRLIRRNSELLGVEKNCNIFFRDVLRLGKIGNISPFQLVYLDPPYGQGLAQQALAIIDKEGWLEPNALVIIEEYAGTCISVGAAFHFLQERKYGDTKIYFFSYNPV
MNKIRIIGGKFQRRLLHTPQNRSIRPSDSRTKKALFDILTHVYPVFLDSTRMLNIFAGTGSVGFEALSRGCHYVLFVDNNSESIRLIRRNSELLGVEKNCNIFFRDVLRLGKIGNISPFQLVYLDPPYGQGLAQQALAIIDKEGWLEPNALVIIEEYAGTCISVGAAFHFLQERKYGDTKIYFFSYNPV
MNKIRIIGGKFQRRLLHTPQNRSIRPSDSRTKKALFDILTHVYPVFLDSTRMLNIFAGTGSVGFEALSRGCHYVLFVDNNSESIRLIRRNSELLGVEKNCNIFFRDVLRLGKIGNISPFQLVYLDPPYGQGLAQQALAIIDKEGWLEPNALVIIEEYAGTCISVGAAFHFLQERKYGDTKIYFFSYNPV

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target189 hypothetical protein CLIBASIA_01450 [Candidatus Liberib
315122183186 hypothetical protein CKC_02165 [Candidatus Liberibacter 1 2e-84
227820998185 putative methylase protein [Sinorhizobium fredii NGR234 1 6e-48
116250667186 hypothetical protein RL0893 [Rhizobium leguminosarum bv 1 8e-48
86356482186 putative methylase protein [Rhizobium etli CFN 42] Leng 1 1e-47
241203271186 methyltransferase [Rhizobium leguminosarum bv. trifolii 1 1e-47
190890545186 methylase [Rhizobium etli CIAT 652] Length = 186 1 4e-47
222147688186 hypothetical protein Avi_0907 [Agrobacterium vitis S4] 1 5e-47
222085016188 methylase protein [Agrobacterium radiobacter K84] Lengt 1 6e-47
325292074185 methyltransferase [Agrobacterium sp. H13-3] Length = 18 1 1e-46
163758413187 hypothetical protein HPDFL43_02270 [Hoeflea phototrophi 1 1e-46
>gi|315122183|ref|YP_004062672.1| hypothetical protein CKC_02165 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 186 Back     alignment and organism information
 Score =  315 bits (808), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 146/186 (78%), Positives = 170/186 (91%)

Query: 4   IRIIGGKFQRRLLHTPQNRSIRPSDSRTKKALFDILTHVYPVFLDSTRMLNIFAGTGSVG 63
           +RI+GGKF+ RLL+TP+NRSIRPSDSRTKKALFDILTHVYP +L STRML++FAGTGSVG
Sbjct: 1   MRIVGGKFRGRLLYTPKNRSIRPSDSRTKKALFDILTHVYPDYLASTRMLDMFAGTGSVG 60

Query: 64  FEALSRGCHYVLFVDNNSESIRLIRRNSELLGVEKNCNIFFRDVLRLGKIGNISPFQLVY 123
           FEALSRGCHYVLFVDNN+ESIRLIR+NSE LGVEK+CNIFF+DVL L KIGNI PF+L+Y
Sbjct: 61  FEALSRGCHYVLFVDNNAESIRLIRKNSEFLGVEKSCNIFFKDVLHLRKIGNIKPFKLLY 120

Query: 124 LDPPYGQGLAQQALAIIDKEGWLEPNALVIIEEYAGTCISVGAAFHFLQERKYGDTKIYF 183
           LDPPYGQG  Q+ L  +D+EGWLEPNALV++EEYAG+ +SVG+AF FLQ RKYGDTKI+F
Sbjct: 121 LDPPYGQGFVQEVLDTVDEEGWLEPNALVVVEEYAGSDVSVGSAFKFLQYRKYGDTKIHF 180

Query: 184 FSYNPV 189
           F Y+PV
Sbjct: 181 FYYHPV 186


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|227820998|ref|YP_002824968.1| putative methylase protein [Sinorhizobium fredii NGR234] Length = 185 Back     alignment and organism information
>gi|116250667|ref|YP_766505.1| hypothetical protein RL0893 [Rhizobium leguminosarum bv. viciae 3841] Length = 186 Back     alignment and organism information
>gi|86356482|ref|YP_468374.1| putative methylase protein [Rhizobium etli CFN 42] Length = 186 Back     alignment and organism information
>gi|241203271|ref|YP_002974367.1| methyltransferase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 186 Back     alignment and organism information
>gi|190890545|ref|YP_001977087.1| methylase [Rhizobium etli CIAT 652] Length = 186 Back     alignment and organism information
>gi|222147688|ref|YP_002548645.1| hypothetical protein Avi_0907 [Agrobacterium vitis S4] Length = 186 Back     alignment and organism information
>gi|222085016|ref|YP_002543545.1| methylase protein [Agrobacterium radiobacter K84] Length = 188 Back     alignment and organism information
>gi|325292074|ref|YP_004277938.1| methyltransferase [Agrobacterium sp. H13-3] Length = 185 Back     alignment and organism information
>gi|163758413|ref|ZP_02165501.1| hypothetical protein HPDFL43_02270 [Hoeflea phototrophica DFL-43] Length = 187 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target189 hypothetical protein CLIBASIA_01450 [Candidatus Liberib
pfam03602181 pfam03602, Cons_hypoth95, Conserved hypothetical protei 1e-41
PRK10909199 PRK10909, rsmD, 16S rRNA m(2)G966-methyltransferase; Pr 1e-20
TIGR00095189 TIGR00095, TIGR00095, RNA methyltransferase, RsmD famil 9e-20
COG0742187 COG0742, COG0742, N6-adenine-specific methylase [DNA re 2e-43
COG1092393 COG1092, COG1092, Predicted SAM-dependent methyltransfe 7e-06
COG2263198 COG2263, COG2263, Predicted RNA methylase [Translation, 2e-05
PRK15128396 PRK15128, PRK15128, 23S rRNA m(5)C1962 methyltransferas 4e-05
TIGR02469124 TIGR02469, CbiT, precorrin-6Y C5,15-methyltransferase ( 6e-04
cd02440107 cd02440, AdoMet_MTases, S-adenosylmethionine-dependent 0.001
COG4123248 COG4123, COG4123, Predicted O-methyltransferase [Genera 0.001
COG2520341 COG2520, COG2520, Predicted methyltransferase [General 0.004
COG1041347 COG1041, COG1041, Predicted DNA modification methylase 2e-04
>gnl|CDD|146308 pfam03602, Cons_hypoth95, Conserved hypothetical protein 95 Back     alignment and domain information
>gnl|CDD|182830 PRK10909, rsmD, 16S rRNA m(2)G966-methyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|129203 TIGR00095, TIGR00095, RNA methyltransferase, RsmD family Back     alignment and domain information
>gnl|CDD|31085 COG0742, COG0742, N6-adenine-specific methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|31289 COG1092, COG1092, Predicted SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information
>gnl|CDD|32444 COG2263, COG2263, Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|185082 PRK15128, PRK15128, 23S rRNA m(5)C1962 methyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|162871 TIGR02469, CbiT, precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit Back     alignment and domain information
>gnl|CDD|100107 cd02440, AdoMet_MTases, S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>gnl|CDD|33880 COG4123, COG4123, Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>gnl|CDD|32590 COG2520, COG2520, Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>gnl|CDD|31243 COG1041, COG1041, Predicted DNA modification methylase [DNA replication, recombination, and repair] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 189 hypothetical protein CLIBASIA_01450 [Candidatus Liberib
PRK10909198 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional 100.0
pfam03602181 Cons_hypoth95 Conserved hypothetical protein 95. 100.0
COG0742187 N6-adenine-specific methylase [DNA replication, recombi 100.0
TIGR00095210 TIGR00095 putative methyltransferase; InterPro: IPR0043 100.0
PRK11805307 N5-glutamine S-adenosyl-L-methionine-dependent methyltr 99.78
PRK09328277 N5-glutamine S-adenosyl-L-methionine-dependent methyltr 99.74
PRK09329285 N5-glutamine S-adenosyl-L-methionine-dependent methyltr 99.71
PRK01544 503 bifunctional N5-glutamine S-adenosyl-L-methionine-depen 99.69
COG2890280 HemK Methylase of polypeptide chain release factors [Tr 99.62
PRK00517298 prmA ribosomal protein L11 methyltransferase; Reviewed 99.61
pfam06325294 PrmA Ribosomal protein L11 methyltransferase (PrmA). Th 99.6
TIGR00406330 prmA ribosomal protein L11 methyltransferase; InterPro: 99.6
COG2264300 PrmA Ribosomal protein L11 methylase [Translation, ribo 99.56
COG1041347 Predicted DNA modification methylase [DNA replication, 99.4
KOG3420185 consensus 99.23
TIGR02085386 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransferase R 98.97
PRK04338 376 N(2),N(2)-dimethylguanosine tRNA methyltransferase; Pro 98.95
pfam02005 375 TRM N2,N2-dimethylguanosine tRNA methyltransferase. Thi 98.92
PRK04457262 spermidine synthase; Provisional 98.12
KOG4058199 consensus 96.78
pfam11599249 AviRa RRNA methyltransferase AviRa. This family of prot 95.82
COG1092393 Predicted SAM-dependent methyltransferases [General fun 99.81
PRK11783716 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional 99.71
pfam10672286 Methyltrans_SAM S-adenosylmethionine-dependent methyltr 99.69
PRK03522375 rumB 23S rRNA methyluridine methyltransferase; Reviewed 99.65
TIGR00479434 rumA 23S rRNA (uracil-5-)-methyltransferase RumA; Inter 99.62
PRK05031363 tRNA (uracil-5-)-methyltransferase; Validated 99.61
pfam05175170 MTS Methyltransferase small domain. This domain is foun 99.6
pfam05958353 tRNA_U5-meth_tr tRNA (Uracil-5-)-methyltransferase. Thi 99.59
COG2263198 Predicted RNA methylase [Translation, ribosomal structu 99.59
PRK13168440 rumA 23S rRNA 5-methyluridine methyltransferase; Review 99.59
pfam02475199 Met_10 Met-10+ like-protein. The methionine-10 mutant a 99.55
pfam01170171 UPF0020 Putative RNA methylase family UPF0020. This dom 99.52
PRK00377198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provi 99.48
PRK07402196 precorrin-6B methylase; Provisional 99.41
COG2242187 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] 99.39
TIGR00537183 hemK_rel_arch methylase, putative; InterPro: IPR004557 99.35
PRK08287186 cobalt-precorrin-6Y C(15)-methyltransferase; Validated 99.35
COG2520341 Predicted methyltransferase [General function predictio 99.34
TIGR02469135 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylat 99.32
cd02440107 AdoMet_MTases S-adenosylmethionine-dependent methyltran 99.29
PRK07580230 Mg-protoporphyrin IX methyl transferase; Validated 99.26
PRK09489342 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provi 99.25
TIGR01983275 UbiG ubiquinone biosynthesis O-methyltransferase; Inter 99.22
COG0116381 Predicted N6-adenine-specific DNA methylase [DNA replic 99.22
TIGR02021224 BchM-ChlM magnesium protoporphyrin O-methyltransferase; 99.21
KOG1499 346 consensus 99.16
COG2521287 Predicted archaeal methyltransferase [General function 99.15
PRK05134233 3-demethylubiquinone-9 3-methyltransferase; Provisional 99.11
pfam01596204 Methyltransf_3 O-methyltransferase. Members of this fam 99.08
PRK00216239 ubiE ubiquinone/menaquinone biosynthesis methyltransfer 99.03
PRK08317241 hypothetical protein; Provisional 98.98
COG4122219 Predicted O-methyltransferase [General function predict 98.97
pfam02384 312 N6_Mtase N-6 DNA Methylase. Restriction-modification (R 98.96
pfam01209233 Ubie_methyltran ubiE/COQ5 methyltransferase family. 98.95
PRK11036256 putative metallothionein SmtA; Provisional 98.94
KOG2730263 consensus 98.94
KOG1500 517 consensus 98.93
COG2226238 UbiE Methylase involved in ubiquinone/menaquinone biosy 98.9
pfam10294171 Methyltransf_16 Putative methyltransferase. 98.88
PRK01683252 trans-aconitate 2-methyltransferase; Provisional 98.86
smart00828224 PKS_MT Methyltransferase in polyketide synthase (PKS) e 98.85
COG2519256 GCD14 tRNA(1-methyladenosine) methyltransferase and rel 98.85
TIGR01934242 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis meth 98.8
PRK10901428 16S rRNA methyltransferase B; Provisional 98.74
PRK10258251 biotin biosynthesis protein BioC; Provisional 98.71
COG2227243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzo 98.7
PRK11783 716 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional 98.69
pfam02353273 CMAS Cyclopropane-fatty-acyl-phospholipid synthase. Thi 98.69
PRK11873258 arsM arsenite S-adenosylmethyltransferase; Reviewed 98.68
TIGR02072272 BioC biotin biosynthesis protein BioC; InterPro: IPR011 98.67
PRK11207198 tellurite resistance protein TehB; Provisional 98.66
pfam0824195 Methyltransf_11 Methyltransferase domain. Members of th 98.59
PRK00312213 pcm protein-L-isoaspartate O-methyltransferase; Reviewe 98.59
PTZ00338 296 dimethyladenosine transferase; Provisional 98.57
pfam01189277 Nol1_Nop2_Fmu NOL1/NOP2/sun family. 98.57
PRK11933 471 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Revi 98.55
TIGR00755 277 ksgA dimethyladenosine transferase; InterPro: IPR011530 98.55
COG0030259 KsgA Dimethyladenosine transferase (rRNA methylation) [ 98.55
pfam01135205 PCMT Protein-L-isoaspartate(D-aspartate) O-methyltransf 98.53
PRK13944205 protein-L-isoaspartate O-methyltransferase; Provisional 98.53
pfam01564240 Spermine_synth Spermine/spermidine synthase. Spermine a 98.53
PRK03612516 spermidine synthase; Provisional 98.51
COG0144355 Sun tRNA and rRNA cytosine-C5-methylases [Translation, 98.5
PTZ00098263 phosphoethanolamine N-methyltransferase; Provisional 98.48
PRK13942214 protein-L-isoaspartate O-methyltransferase; Provisional 98.45
COG2518209 Pcm Protein-L-isoaspartate carboxylmethyltransferase [P 98.41
pfam0824298 Methyltransf_12 Methyltransferase domain. Members of th 98.33
PRK12335289 tellurite resistance protein TehB; Provisional 98.31
TIGR00308 462 TRM1 N2,N2-dimethylguanosine tRNA methyltransferase; In 98.3
PRK00811283 spermidine synthase; Provisional 98.28
KOG1227351 consensus 98.27
COG3897218 Predicted methyltransferase [General function predictio 98.25
smart00650169 rADc Ribosomal RNA adenine dimethylases. 98.25
KOG1663237 consensus 98.24
pfam00398258 RrnaAD Ribosomal RNA adenine dimethylase. 98.23
COG2230283 Cfa Cyclopropane fatty acid synthase and related methyl 98.22
PRK13943 317 protein-L-isoaspartate O-methyltransferase; Provisional 98.19
pfam08003315 Methyltransf_9 Protein of unknown function (DUF1698). T 98.16
KOG1270282 consensus 98.12
COG0421282 SpeE Spermidine synthase [Amino acid transport and meta 98.11
KOG1253 525 consensus 98.08
PHA02056279 putative methyltransferase 98.01
PRK06202233 hypothetical protein; Provisional 97.99
KOG1271227 consensus 97.99
TIGR01177358 TIGR01177 conserved hypothetical protein TIGR01177; Int 97.98
pfam00145 319 DNA_methylase C-5 cytosine-specific DNA methylase. 97.96
PRK00107216 gidB glucose-inhibited division protein B; Reviewed 97.93
pfam01861243 DUF43 Protein of unknown function DUF43. This family in 97.92
KOG1661237 consensus 97.92
pfam02527184 GidB rRNA small subunit methyltransferase G. This is a 97.9
COG3963194 Phospholipid N-methyltransferase [Lipid metabolism] 97.88
COG4976287 Predicted methyltransferase (contains TPR repeat) [Gene 97.86
PRK01581363 speE spermidine synthase; Validated 97.86
COG0270 328 Dcm Site-specific DNA methylase [DNA replication, recom 97.84
KOG2899288 consensus 97.83
pfam08123205 DOT1 Histone methylation protein DOT1. The DOT1 domain 97.78
PRK11705383 cyclopropane fatty acyl phospholipid synthase; Provisio 97.77
KOG1540296 consensus 97.76
PRK11727326 putative SAM-dependent methyltransferase; Provisional 97.74
pfam04378245 DUF519 Protein of unknown function (DUF519). Bacterial 97.72
TIGR00138197 gidB methyltransferase GidB; InterPro: IPR003682 GidB ( 97.67
), spermine synthase () and putrescine N-methyltransferase () . The Thermotoga maritima spermidine synthase monomer consists of two domains: an N-terminal domain composed of six beta-strands, and a Rossmann-like C- terminal domain . The larger C-terminal catalytic core domain consists of a seven-stranded beta-sheet flanked by nine alpha helices. This domain resembles a topology observed in a number of nucleotide and dinucleotide-binding enzymes, and in S-adenosyl-L-methionine (AdoMet)- dependent methyltransferase (MTases) . ; GO: 0003824 catalytic activity." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR00417">TIGR00417284 speE spermidine synthase; InterPro: IPR001045 Synonym(s 97.67
COG1189245 Predicted rRNA methylase [Translation, ribosomal struct 97.66
KOG0820 315 consensus 97.62
KOG4300252 consensus 97.6
) (PCMT) (which is also known as L-isoaspartyl protein carboxyl methyltransferase) is an enzyme that catalyzes the transfer of a methyl group from S- adenosylmethionine to the free carboxyl groups of D-aspartyl or L-isoaspartyl residues in a variety of peptides and proteins. The enzyme does not act on normal L-aspartyl residues L-isoaspartyl and D-aspartyl are the products of the spontaneous deamidation and/or isomerization of normal L-aspartyl and L- asparaginyl residues in proteins. PCMT plays a role in the repair and/or degradation of these damaged proteins; the enzymatic methyl esterification of the abnormal residues can lead to their conversion to normal L-aspartyl residues. The SAM domain is present in most of these proteins.; GO: 0004719 protein-L-isoaspartate (D-aspartate) O-methyltransferase activity, 0006464 protein modification process." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR00080">TIGR00080228 pimt protein-L-isoaspartate O-methyltransferase; InterP 97.59
COG0357215 GidB Predicted S-adenosylmethionine-dependent methyltra 97.58
pfam05891217 Hydroxy-O-Methy Putative hydroxyindole-O-methyltransfer 97.47
TIGR02752231 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methylt 97.37
pfam03291 327 Pox_MCEL mRNA capping enzyme. This family of enzymes ar 97.33
COG2961279 ComJ Protein involved in catabolism of external DNA [Ge 97.26
TIGR00563487 rsmB ribosomal RNA small subunit methyltransferase B; I 97.18
pfam05401201 NodS Nodulation protein S (NodS). This family consists 97.17
TIGR00740247 TIGR00740 methyltransferase, putative; InterPro: IPR005 97.16
pfam01728176 FtsJ FtsJ-like methyltransferase. This family consists 97.08
KOG2920282 consensus 97.06
COG0220227 Predicted S-adenosylmethionine-dependent methyltransfer 96.99
TIGR00452316 TIGR00452 methyltransferase, putative; InterPro: IPR010 96.96
COG4262508 Predicted spermidine synthase with an N-terminal membra 96.86
KOG2198375 consensus 96.86
pfam05185 447 PRMT5 PRMT5 arginine-N-methyltransferase. The human hom 96.82
KOG3010261 consensus 96.82
PRK06922 679 hypothetical protein; Provisional 96.81
TIGR00091216 TIGR00091 tRNA (guanine-N(7)-)-methyltransferase; Inter 96.79
pfam02390199 Methyltransf_4 Putative methyltransferase. This is a fa 96.68
KOG0822 649 consensus 96.32
KOG2361264 consensus 96.22
pfam05219265 DREV DREV methyltransferase. This family contains DREV 96.12
PRK11188209 rrmJ 23S rRNA methyltransferase J; Provisional 96.1
PRK11088272 rrmA 23S rRNA methyltransferase A; Provisional 96.05
KOG2912 419 consensus 96.02
KOG2793248 consensus 96.01
pfam06080201 DUF938 Protein of unknown function (DUF938). This famil 95.66
PRK04266226 fibrillarin; Provisional 95.45
pfam04816204 DUF633 Family of unknown function (DUF633). This family 95.29
KOG1709271 consensus 95.23
KOG1975 389 consensus 95.22
pfam05724203 TPMT Thiopurine S-methyltransferase (TPMT). This family 95.08
pfam01269229 Fibrillarin Fibrillarin. 94.63
pfam03269177 DUF268 Caenorhabditis protein of unknown function, DUF2 94.59
pfam12147311 Hydrolase_5 Putative lysophospholipase. This domain is 94.48
TIGR00438192 rrmJ ribosomal RNA large subunit methyltransferase J; I 94.35
pfam00891239 Methyltransf_2 O-methyltransferase. This family include 94.05
TIGR03587204 Pse_Me-ase pseudaminic acid biosynthesis-associated met 93.94
PRK01544503 bifunctional N5-glutamine S-adenosyl-L-methionine-depen 93.82
PTZ00146296 fibrillarin; Provisional 93.0
COG5459 484 Predicted rRNA methylase [Translation, ribosomal struct 92.65
KOG3201201 consensus 92.64
smart00138264 MeTrc Methyltransferase, chemotaxis proteins. Methylate 92.57
KOG2352482 consensus 92.37
TIGR00497 516 hsdM type I restriction-modification system, M subunit; 91.1
pfam01739194 CheR CheR methyltransferase, SAM binding domain. CheR p 90.61
pfam02951119 GSH-S_N Prokaryotic glutathione synthetase, N-terminal 90.14
TIGR03533284 L3_gln_methyl protein-(glutamine-N5) methyltransferase, 99.8
TIGR03534251 RF_mod_HemK protein-(glutamine-N5) methyltransferase, r 99.76
COG4123248 Predicted O-methyltransferase [General function predict 99.67
COG2265432 TrmA SAM-dependent methyltransferases related to tRNA ( 99.62
KOG2187534 consensus 99.43
KOG2904328 consensus 99.35
TIGR02143361 trmA_only tRNA (uracil-5-)-methyltransferase; InterPro: 99.3
COG2813300 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosom 99.28
pfam03848192 TehB Tellurite resistance protein TehB. 98.72
pfam08704309 GCD14 tRNA methyltransferase complex GCD14 subunit. GCD 98.7
COG1867 380 TRM1 N2,N2-dimethylguanosine tRNA methyltransferase [Tr 98.63
TIGR00536311 hemK_fam methyltransferase, HemK family; InterPro: IPR0 98.44
COG4106257 Tam Trans-aconitate methyltransferase [General function 97.6
KOG1122460 consensus 97.59
PRK00121229 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed 97.58
TIGR00477239 tehB tellurite resistance protein TehB; InterPro: IPR00 97.38
PRK00536262 speE spermidine synthase; Provisional 96.9
KOG3178342 consensus 93.02
pfam09445165 Methyltransf_15 RNA cap guanine-N2 methyltransferase. R 99.59
KOG2671421 consensus 98.4
COG4076252 Predicted RNA methylase [General function prediction on 98.32
pfam04445235 DUF548 Protein of unknown function (DUF548). Protein of 98.29
cd00315 275 Cyt_C5_DNA_methylase Cytosine-C5 specific DNA methylase 98.24
TIGR02081205 metW methionine biosynthesis protein MetW; InterPro: IP 98.2
pfam07021193 MetW Methionine biosynthesis protein MetW. This family 98.15
PRK00274267 ksgA dimethyladenosine transferase; Reviewed 98.12
KOG2078 495 consensus 97.96
TIGR00446284 nop2p NOL1/NOP2/sun family putative RNA methylase; Inte 97.83
PRK05785225 hypothetical protein; Provisional 97.46
TIGR02987 603 met_A_Alw26 type II restriction m6 adenine DNA methyltr 97.35
COG0286 489 HsdM Type I restriction-modification system methyltrans 97.32
TIGR00675 425 dcm DNA-cytosine methyltransferase; InterPro: IPR001525 97.23
KOG1501 636 consensus 96.7
pfam09243 275 Rsm22 Mitochondrial small ribosomal subunit Rsm22. Rsm2 96.53
TIGR01444142 fkbM_fam methyltransferase, FkbM family; InterPro: IPR0 94.52
pfam01795 310 Methyltransf_5 MraW methylase family. Members of this f 94.29
COG2384226 Predicted SAM-dependent methyltransferase [General func 94.04
KOG1201 300 consensus 93.67
PRK00050 309 mraW S-adenosyl-methyltransferase MraW; Provisional 93.1
KOG3191209 consensus 98.85
PRK10742250 putative methyltransferase; Provisional 98.06
pfam03059277 NAS Nicotianamine synthase protein. Nicotianamine synth 95.68
pfam05971254 Methyltransf_10 Protein of unknown function (DUF890). T 97.98
KOG2915314 consensus 97.92
COG1568354 Predicted methyltransferases [General function predicti 97.28
COG3129292 Predicted SAM-dependent methyltransferase [General func 94.33
COG3392 330 Adenine-specific DNA methylase [DNA replication, recomb 97.77
PRK11524284 putative methyltransferase; Provisional 97.37
pfam01555221 N6_N4_Mtase DNA methylase. Members of this family are D 97.3
PRK10458 470 DNA cytosine methylase; Provisional 95.84
COG0338 274 Dam Site-specific DNA methylase [DNA replication, recom 94.48
PRK10904 271 DNA adenine methylase; Provisional 92.81
pfam02086254 MethyltransfD12 D12 class N6 adenine-specific DNA methy 92.18
TIGR00571 327 dam DNA adenine methylase; InterPro: IPR012326 In proka 91.82
PRK11524 284 putative methyltransferase; Provisional 97.34
PRK13699 227 putative methylase; Provisional 97.09
pfam06962140 rRNA_methylase Putative rRNA methylase. This family con 94.11
TIGR00571327 dam DNA adenine methylase; InterPro: IPR012326 In proka 93.72
pfam10237161 N6-adenineMlase Probable N6-adenine methyltransferase. 93.47
PRK13699227 putative methylase; Provisional 97.21
TIGR00478240 tly hemolysin A; InterPro: IPR004538 Hemolysins are exo 97.0
COG1743 875 Adenine-specific DNA methylase containing a Zn-ribbon [ 96.68
pfam01234261 NNMT_PNMT_TEMT NNMT/PNMT/TEMT family. 90.8
COG0863302 DNA modification methylase [DNA replication, recombinat 93.45
pfam02086254 MethyltransfD12 D12 class N6 adenine-specific DNA methy 92.0
>PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional Back     alignment and domain information
>pfam03602 Cons_hypoth95 Conserved hypothetical protein 95 Back     alignment and domain information
>COG0742 N6-adenine-specific methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00095 TIGR00095 putative methyltransferase; InterPro: IPR004398 This is a family of conserved hypothetical proteins, which includes a putative methylase Back     alignment and domain information
>PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK09329 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>pfam06325 PrmA Ribosomal protein L11 methyltransferase (PrmA) Back     alignment and domain information
>TIGR00406 prmA ribosomal protein L11 methyltransferase; InterPro: IPR004498 Ribosomal protein L11 methyltransferase (2 Back     alignment and domain information
>COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG1041 Predicted DNA modification methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG3420 consensus Back     alignment and domain information
>TIGR02085 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransferase RumB; InterPro: IPR011825 This family consists of RNA methyltransferases designated RumB, formerly YbjF Back     alignment and domain information
>PRK04338 N(2),N(2)-dimethylguanosine tRNA methyltransferase; Provisional Back     alignment and domain information
>pfam02005 TRM N2,N2-dimethylguanosine tRNA methyltransferase Back     alignment and domain information
>PRK04457 spermidine synthase; Provisional Back     alignment and domain information
>KOG4058 consensus Back     alignment and domain information
>pfam11599 AviRa RRNA methyltransferase AviRa Back     alignment and domain information
>COG1092 Predicted SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>pfam10672 Methyltrans_SAM S-adenosylmethionine-dependent methyltransferase Back     alignment and domain information
>PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed Back     alignment and domain information
>TIGR00479 rumA 23S rRNA (uracil-5-)-methyltransferase RumA; InterPro: IPR001566 This protein family was first proposed to be RNA methyltransferases by homology to the TrmA family Back     alignment and domain information
>PRK05031 tRNA (uracil-5-)-methyltransferase; Validated Back     alignment and domain information
>pfam05175 MTS Methyltransferase small domain Back     alignment and domain information
>pfam05958 tRNA_U5-meth_tr tRNA (Uracil-5-)-methyltransferase Back     alignment and domain information
>COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK13168 rumA 23S rRNA 5-methyluridine methyltransferase; Reviewed Back     alignment and domain information
>pfam02475 Met_10 Met-10+ like-protein Back     alignment and domain information
>pfam01170 UPF0020 Putative RNA methylase family UPF0020 Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>PRK07402 precorrin-6B methylase; Provisional Back     alignment and domain information
>COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] Back     alignment and domain information
>TIGR00537 hemK_rel_arch methylase, putative; InterPro: IPR004557 These proteins exhibit homology to the Saccharomyces cerevisiae (yeast) ORF YDR140w (FYV9) Back     alignment and domain information
>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated Back     alignment and domain information
>COG2520 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit; InterPro: IPR014008 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt Back     alignment and domain information
>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>PRK07580 Mg-protoporphyrin IX methyl transferase; Validated Back     alignment and domain information
>PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional Back     alignment and domain information
>TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase; InterPro: IPR010233 This entry represents an O-methyltransferase, which is believed to act at two points in the ubiquinone biosynthetic pathway in bacteria (UbiG) and mitochondria (COQ3) , Back     alignment and domain information
>COG0116 Predicted N6-adenine-specific DNA methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase; InterPro: IPR010251 Chlorophyll and bacteriochlorophyll are essential photosynthetic pigments involved in oxygenic and non-oxygenic photosythesis respectively Back     alignment and domain information
>KOG1499 consensus Back     alignment and domain information
>COG2521 Predicted archaeal methyltransferase [General function prediction only] Back     alignment and domain information
>PRK05134 3-demethylubiquinone-9 3-methyltransferase; Provisional Back     alignment and domain information
>pfam01596 Methyltransf_3 O-methyltransferase Back     alignment and domain information
>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>PRK08317 hypothetical protein; Provisional Back     alignment and domain information
>COG4122 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>pfam02384 N6_Mtase N-6 DNA Methylase Back     alignment and domain information
>pfam01209 Ubie_methyltran ubiE/COQ5 methyltransferase family Back     alignment and domain information
>PRK11036 putative metallothionein SmtA; Provisional Back     alignment and domain information
>KOG2730 consensus Back     alignment and domain information
>KOG1500 consensus Back     alignment and domain information
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>pfam10294 Methyltransf_16 Putative methyltransferase Back     alignment and domain information
>PRK01683 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes Back     alignment and domain information
>COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities Back     alignment and domain information
>PRK10901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK10258 biotin biosynthesis protein BioC; Provisional Back     alignment and domain information
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>pfam02353 CMAS Cyclopropane-fatty-acyl-phospholipid synthase Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>TIGR02072 BioC biotin biosynthesis protein BioC; InterPro: IPR011814 This enzyme, which is found in biotin biosynthetic gene clusters in proteobacteria, firmicutes, green-sulphur bacteria, fusobacterium and bacteroides, is believed to carry out an enzymatic step prior to the formation of pimeloyl-CoA (although attribution of this annotation is not traceable) Back     alignment and domain information
>PRK11207 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>pfam08241 Methyltransf_11 Methyltransferase domain Back     alignment and domain information
>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>PTZ00338 dimethyladenosine transferase; Provisional Back     alignment and domain information
>pfam01189 Nol1_Nop2_Fmu NOL1/NOP2/sun family Back     alignment and domain information
>PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed Back     alignment and domain information
>TIGR00755 ksgA dimethyladenosine transferase; InterPro: IPR011530 This family of proteins represent the rRNA adenine dimethylases (e Back     alignment and domain information
>COG0030 KsgA Dimethyladenosine transferase (rRNA methylation) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>pfam01135 PCMT Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT) Back     alignment and domain information
>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>pfam01564 Spermine_synth Spermine/spermidine synthase Back     alignment and domain information
>PRK03612 spermidine synthase; Provisional Back     alignment and domain information
>COG0144 Sun tRNA and rRNA cytosine-C5-methylases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional Back     alignment and domain information
>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>pfam08242 Methyltransf_12 Methyltransferase domain Back     alignment and domain information
>PRK12335 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>TIGR00308 TRM1 N2,N2-dimethylguanosine tRNA methyltransferase; InterPro: IPR002905 This enzyme 2 Back     alignment and domain information
>PRK00811 spermidine synthase; Provisional Back     alignment and domain information
>KOG1227 consensus Back     alignment and domain information
>COG3897 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>smart00650 rADc Ribosomal RNA adenine dimethylases Back     alignment and domain information
>KOG1663 consensus Back     alignment and domain information
>pfam00398 RrnaAD Ribosomal RNA adenine dimethylase Back     alignment and domain information
>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>pfam08003 Methyltransf_9 Protein of unknown function (DUF1698) Back     alignment and domain information
>KOG1270 consensus Back     alignment and domain information
>COG0421 SpeE Spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1253 consensus Back     alignment and domain information
>PHA02056 putative methyltransferase Back     alignment and domain information
>PRK06202 hypothetical protein; Provisional Back     alignment and domain information
>KOG1271 consensus Back     alignment and domain information
>TIGR01177 TIGR01177 conserved hypothetical protein TIGR01177; InterPro: IPR005885 This family of largely hypothetical proteins is found exclusively in the Archaea and contain a putative RNA methylase domain Back     alignment and domain information
>pfam00145 DNA_methylase C-5 cytosine-specific DNA methylase Back     alignment and domain information
>PRK00107 gidB glucose-inhibited division protein B; Reviewed Back     alignment and domain information
>pfam01861 DUF43 Protein of unknown function DUF43 Back     alignment and domain information
>KOG1661 consensus Back     alignment and domain information
>pfam02527 GidB rRNA small subunit methyltransferase G Back     alignment and domain information
>COG3963 Phospholipid N-methyltransferase [Lipid metabolism] Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>PRK01581 speE spermidine synthase; Validated Back     alignment and domain information
>COG0270 Dcm Site-specific DNA methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG2899 consensus Back     alignment and domain information
>pfam08123 DOT1 Histone methylation protein DOT1 Back     alignment and domain information
>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional Back     alignment and domain information
>KOG1540 consensus Back     alignment and domain information
>PRK11727 putative SAM-dependent methyltransferase; Provisional Back     alignment and domain information
>pfam04378 DUF519 Protein of unknown function (DUF519) Back     alignment and domain information
>TIGR00138 gidB methyltransferase GidB; InterPro: IPR003682 GidB (glucose-inhibited division protein B) appears to be present and in a single copy in all complete eubacterial genomes so far Back     alignment and domain information
>TIGR00417 speE spermidine synthase; InterPro: IPR001045 Synonym(s): Spermidine aminopropyltransferase A group of polyamine biosynthetic enzymes involved in the fifth (last) step in the biosynthesis of spermidine from arginine and methionine which includes; spermidine synthase (Back     alignment and domain information
>COG1189 Predicted rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0820 consensus Back     alignment and domain information
>KOG4300 consensus Back     alignment and domain information
>TIGR00080 pimt protein-L-isoaspartate O-methyltransferase; InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (Back     alignment and domain information
>COG0357 GidB Predicted S-adenosylmethionine-dependent methyltransferase involved in bacterial cell division [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>pfam05891 Hydroxy-O-Methy Putative hydroxyindole-O-methyltransferase Back     alignment and domain information
>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase; InterPro: IPR014122 MenG is a generic term for a methyltransferase that catalyses the last step in menaquinone biosynthesis; the exact enzymatic activity differs for different MenG because the menaquinone differ in their prenoid side chains in different species Back     alignment and domain information
>pfam03291 Pox_MCEL mRNA capping enzyme Back     alignment and domain information
>COG2961 ComJ Protein involved in catabolism of external DNA [General function prediction only] Back     alignment and domain information
>TIGR00563 rsmB ribosomal RNA small subunit methyltransferase B; InterPro: IPR004573 This family consists of bacterial sequences related to Escherichia coli rsmB, an rRNA SAM-dependent methyltransferase Back     alignment and domain information
>pfam05401 NodS Nodulation protein S (NodS) Back     alignment and domain information
>TIGR00740 TIGR00740 methyltransferase, putative; InterPro: IPR005271 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>pfam01728 FtsJ FtsJ-like methyltransferase Back     alignment and domain information
>KOG2920 consensus Back     alignment and domain information
>COG0220 Predicted S-adenosylmethionine-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR00452 TIGR00452 methyltransferase, putative; InterPro: IPR010017 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>COG4262 Predicted spermidine synthase with an N-terminal membrane domain [General function prediction only] Back     alignment and domain information
>KOG2198 consensus Back     alignment and domain information
>pfam05185 PRMT5 PRMT5 arginine-N-methyltransferase Back     alignment and domain information
>KOG3010 consensus Back     alignment and domain information
>PRK06922 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00091 TIGR00091 tRNA (guanine-N(7)-)-methyltransferase; InterPro: IPR004395 This predicted S-adenosylmethionine-dependent methyltransferase is found in a single copy in most Bacteria Back     alignment and domain information
>pfam02390 Methyltransf_4 Putative methyltransferase Back     alignment and domain information
>KOG0822 consensus Back     alignment and domain information
>KOG2361 consensus Back     alignment and domain information
>pfam05219 DREV DREV methyltransferase Back     alignment and domain information
>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional Back     alignment and domain information
>PRK11088 rrmA 23S rRNA methyltransferase A; Provisional Back     alignment and domain information
>KOG2912 consensus Back     alignment and domain information
>KOG2793 consensus Back     alignment and domain information
>pfam06080 DUF938 Protein of unknown function (DUF938) Back     alignment and domain information
>PRK04266 fibrillarin; Provisional Back     alignment and domain information
>pfam04816 DUF633 Family of unknown function (DUF633) Back     alignment and domain information
>KOG1709 consensus Back     alignment and domain information
>KOG1975 consensus Back     alignment and domain information
>pfam05724 TPMT Thiopurine S-methyltransferase (TPMT) Back     alignment and domain information
>pfam01269 Fibrillarin Fibrillarin Back     alignment and domain information
>pfam03269 DUF268 Caenorhabditis protein of unknown function, DUF268 Back     alignment and domain information
>pfam12147 Hydrolase_5 Putative lysophospholipase Back     alignment and domain information
>TIGR00438 rrmJ ribosomal RNA large subunit methyltransferase J; InterPro: IPR004512 The ribosomal RNA large subunit methyltransferase J 2 Back     alignment and domain information
>pfam00891 Methyltransf_2 O-methyltransferase Back     alignment and domain information
>TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>PTZ00146 fibrillarin; Provisional Back     alignment and domain information
>COG5459 Predicted rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG3201 consensus Back     alignment and domain information
>smart00138 MeTrc Methyltransferase, chemotaxis proteins Back     alignment and domain information
>KOG2352 consensus Back     alignment and domain information
>TIGR00497 hsdM type I restriction-modification system, M subunit; InterPro: IPR004546 There are four classes of restriction endonucleases: types I, II,III and IV Back     alignment and domain information
>pfam01739 CheR CheR methyltransferase, SAM binding domain Back     alignment and domain information
>pfam02951 GSH-S_N Prokaryotic glutathione synthetase, N-terminal domain Back     alignment and domain information
>TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific Back     alignment and domain information
>TIGR03534 RF_mod_HemK protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>COG4123 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>COG2265 TrmA SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2187 consensus Back     alignment and domain information
>KOG2904 consensus Back     alignment and domain information
>TIGR02143 trmA_only tRNA (uracil-5-)-methyltransferase; InterPro: IPR011869 This family consists exclusively of proteins believed to act as tRNA (uracil-5-)-methyltransferase Back     alignment and domain information
>COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>pfam03848 TehB Tellurite resistance protein TehB Back     alignment and domain information
>pfam08704 GCD14 tRNA methyltransferase complex GCD14 subunit Back     alignment and domain information
>COG1867 TRM1 N2,N2-dimethylguanosine tRNA methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00536 hemK_fam methyltransferase, HemK family; InterPro: IPR004556 The gene hemK from Escherichia coli was found to contribute to heme biosynthesis and originally suggested to be protoporphyrinogen oxidase Back     alignment and domain information
>COG4106 Tam Trans-aconitate methyltransferase [General function prediction only] Back     alignment and domain information
>KOG1122 consensus Back     alignment and domain information
>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed Back     alignment and domain information
>TIGR00477 tehB tellurite resistance protein TehB; InterPro: IPR004537 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB Back     alignment and domain information
>PRK00536 speE spermidine synthase; Provisional Back     alignment and domain information
>KOG3178 consensus Back     alignment and domain information
>pfam09445 Methyltransf_15 RNA cap guanine-N2 methyltransferase Back     alignment and domain information
>KOG2671 consensus Back     alignment and domain information
>COG4076 Predicted RNA methylase [General function prediction only] Back     alignment and domain information
>pfam04445 DUF548 Protein of unknown function (DUF548) Back     alignment and domain information
>cd00315 Cyt_C5_DNA_methylase Cytosine-C5 specific DNA methylases; Methyl transfer reactions play an important role in many aspects of biology Back     alignment and domain information
>TIGR02081 metW methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins Back     alignment and domain information
>pfam07021 MetW Methionine biosynthesis protein MetW Back     alignment and domain information
>PRK00274 ksgA dimethyladenosine transferase; Reviewed Back     alignment and domain information
>KOG2078 consensus Back     alignment and domain information
>TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase; InterPro: IPR011023 This domain is found in archaeal, bacterial and eukaryotic proteins Back     alignment and domain information
>PRK05785 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02987 met_A_Alw26 type II restriction m6 adenine DNA methyltransferase, Alw26I/Eco31I/Esp3I family; InterPro: IPR014329 Members of this entry are the m6-adenine DNA methyltransferase protein, or a fusion protein that also carries m5 cytosine methyltransferase activity of type II restriction systems of the Alw26I/Eco31I/Esp3I family Back     alignment and domain information
>COG0286 HsdM Type I restriction-modification system methyltransferase subunit [Defense mechanisms] Back     alignment and domain information
>TIGR00675 dcm DNA-cytosine methyltransferase; InterPro: IPR001525 C-5 cytosine-specific DNA methylases (2 Back     alignment and domain information
>KOG1501 consensus Back     alignment and domain information
>pfam09243 Rsm22 Mitochondrial small ribosomal subunit Rsm22 Back     alignment and domain information
>TIGR01444 fkbM_fam methyltransferase, FkbM family; InterPro: IPR006342 Members of this group are characterised by two well-conserved short regions separated by a variable region in both sequence and length Back     alignment and domain information
>pfam01795 Methyltransf_5 MraW methylase family Back     alignment and domain information
>COG2384 Predicted SAM-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>KOG1201 consensus Back     alignment and domain information
>PRK00050 mraW S-adenosyl-methyltransferase MraW; Provisional Back     alignment and domain information
>KOG3191 consensus Back     alignment and domain information
>PRK10742 putative methyltransferase; Provisional Back     alignment and domain information
>pfam03059 NAS Nicotianamine synthase protein Back     alignment and domain information
>pfam05971 Methyltransf_10 Protein of unknown function (DUF890) Back     alignment and domain information
>KOG2915 consensus Back     alignment and domain information
>COG1568 Predicted methyltransferases [General function prediction only] Back     alignment and domain information
>COG3129 Predicted SAM-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>COG3392 Adenine-specific DNA methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK11524 putative methyltransferase; Provisional Back     alignment and domain information
>pfam01555 N6_N4_Mtase DNA methylase Back     alignment and domain information
>PRK10458 DNA cytosine methylase; Provisional Back     alignment and domain information
>COG0338 Dam Site-specific DNA methylase [DNA replication, recombination, and repair] Back     alignment and domain information