254780404

254780404

inositol monophosphatase family protein

GeneID in NCBI database:8209389Locus tag:CLIBASIA_01445
Protein GI in NCBI database:254780404Protein Accession:YP_003064817.1
Gene range:-(304932, 305792)Protein Length:286aa
Gene description:inositol monophosphatase family protein
COG prediction:[G] Archaeal fructose-1,6-bisphosphatase and related enzymes of inositol monophosphatase family
KEGG prediction:inositol monophosphatase family protein
SEED prediction:FIG043197: Inositol monophosphatase family protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVM1 TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280------
MSMLHGMFGGMNLLYWYKKLCLMDIDFMYEWKQDLDIVRSAVQGASTVAMQYFLRSPNVWWKHEGSSPVCDADIAVNDYLESFLRPLRPAYGWLSEETDDDLQRLNYETLFVVDPIDGTRAFIEGRNEWCISVAVVHHGRPVIGVVHASALGKEFFVSVGMKSTCNGKNISVSSNQMSDSLAIMASDVSLKGLDSYVRFRRQSSISSLCLRILMIASGEVDVLIVDRNANDWDLAAADLLLECSGGALVDIDRKLLTYNRSQVNHEVLFASAKWHFPSFKQHLSTL
ccHHHHHHHHHHHEEEEccccEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEccccccHHHHHHHHHHHHHHHHHHHHcccccEEEEccccccccccccEEEEEEcccHHHHHHcccccEEEEEEEEEccEEEEEEEEccccccEEEEEcccccccccEEcccccccccccEEEEEccccHHHHHHHHHHccEEEEcHHHHHHHHHHcccccEEEEcccccHHHHHHHHHHHHHcccEEEEEcccEEccccccccccEEEEccHHHHHHHHHHHHcc
ccccccccccHccccHHEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEccccccccHHHHHHHHHHHHHHHHHcccccEEEEEccccccccccccEEEEEcccccccHccccccEEEEEEEEEcccEEEEEEEcccccHEEEEEcccccEccccEEEEccccccccEEEEccccccHHHHHHHHHccccccccHHHHHHHHHccccccEEEcccccHHHHHHHHHHHHHcccEEEccccccccccccHcccccEEEccHHHHHHHHHHHccc
msmlhgmfgGMNLLYWYKKLCLMDIDFMYEWKQDLDIVRSAVQGASTVAMQYFLrspnvwwkhegsspvcdadiAVNDYLESFlrplrpaygwlseetdddlqrlnyetlfvvdpidgtrafiEGRNEWCISVAVVHHGRPVIGVVHASALGKEFFVSVGmkstcngknisvssnqmSDSLAIMAsdvslkgldSYVRFRRQSSISSLCLRILMIASGEVDVLIVDRNANDWDLAAADLLLECsggalvdiDRKLLTYNRSQVNHEVLFASakwhfpsfkqhlstl
MSMLHGMFGGMNLLYWYKKLCLMDIDFMYEWKQDLDIVRSAVQGASTVAMQYFLRSPNVWWKHEGSSPVCDADIAVNDYLESFLRPLRPAYGWLSEETDDDLQRLNYETLFVVDPIDGTRAFIEGRNEWCISVAVVHHGRPVIGVVHASALGKEFFVSVGMKSTCNGKNISVSSNQMSDSLAIMASDVSLKGLDSYVRFRRQSSISSLCLRILMIASGEVDVLIVDRNANDWDLAAADLLLECSGGALVDIDRKLLTYNRSQVNHEVLFasakwhfpsfkqhlstl
MSMLHGMFGGMNLLYWYKKLCLMDIDFMYEWKQDLDIVRSAVQGASTVAMQYFLRSPNVWWKHEGSSPVCDADIAVNDYLESFLRPLRPAYGWLSEETDDDLQRLNYETLFVVDPIDGTRAFIEGRNEWCISVAVVHHGRPVIGVVHASALGKEFFVSVGMKSTCNGKNISVSSNQMSDSLAIMASDVSLKGLDSYVRFRRQSSISSLCLRILMIASGEVDVLIVdrnandwdlaaadlllECSGGALVDIDRKLLTYNRSQVNHEVLFASAKWHFPSFKQHLSTL
*******FGGMNLLYWYKKLCLMDIDFMYEWKQDLDIVRSAVQGASTVAMQYFLRSPNVWWKHEGSSPVCDADIAVNDYLESFLRPLRPAYGWLSEETDDDLQRLNYETLFVVDPIDGTRAFIEGRNEWCISVAVVHHGRPVIGVVHASALGKEFFVSVGMKSTCNGKNI************IMASDVSLKGLDSYVRFRRQSSISSLCLRILMIASGEVDVLIVDRNANDWDLAAADLLLECSGGALVDIDRKLLTYNRSQVNHEVLFASAKWHFPSFKQHLSTL
MSMLHGMFGGMNLLYWYKKLCLMDIDFMYEWKQDLDIVRSAVQGASTVAMQYFLRSPNVWWKHEGSSPVCDADIAVNDYLESFLRPLRPAYGWLSEETDDDLQRLNYETLFVVDPIDGTRAFIEGRNEWCISVAVVHHGRPVIGVVHASALGKEFFVSVGMKSTCNGKNISVSSNQMSDSLAIMASDVSLKGLDSYVRFRRQSSISSLCLRILMIASGEVDVLIVDRNANDWDLAAADLLLECSGGALVDIDRKLLTYNRSQVNHEVLFASAKWHFPSFKQHLSTL
*SMLHGMFGGMNLLYWYKKLCLMDIDFMYEWKQDLDIVRSAVQGASTVAMQYFLRSPNVWWKHEGSSPVCDADIAVNDYLESFLRPLRPAYGWLSEETDDDLQRLNYETLFVVDPIDGTRAFIEGRNEWCISVAVVHHGRPVIGVVHASALGKEFFVSVGMKSTCNGKNISVSSNQMSDSLAIMASDVSLKGLDSYVRFRRQSSISSLCLRILMIASGEVDVLIVDRNANDWDLAAADLLLECSGGALVDIDRKLLTYNRSQVNHEVLFASAKWHFPSFKQHLSTL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSMLHGMFGGMNLLYWYKKLCLMDIDFMYEWKQDLDIVRSAVQGASTVAMQYFLRSPNVWWKHEGSSPVCDADIAVNDYLESFLRPLRPAYGWLSEETDDDLQRLNYETLFVVDPIDGTRAFIEGRNEWCISVAVVHHGRPVIGVVHASALGKEFFVSVGMKSTCNGKNISVSSNQMSDSLAIMASDVSLKGLDSYVRFRRQSSISSLCLRILMIASGEVDVLIVDRNANDWDLAAADLLLECSGGALVDIDRKLLTYNRSQVNHEVLFASAKWHFPSFKQHLSTL
MSMLHGMFGGMNLLYWYKKLCLMDIDFMYEWKQDLDIVRSAVQGASTVAMQYFLRSPNVWWKHEGSSPVCDADIAVNDYLESFLRPLRPAYGWLSEETDDDLQRLNYETLFVVDPIDGTRAFIEGRNEWCISVAVVHHGRPVIGVVHASALGKEFFVSVGMKSTCNGKNISVSSNQMSDSLAIMASDVSLKGLDSYVRFRRQSSISSLCLRILMIASGEVDVLIVDRNANDWDLAAADLLLECSGGALVDIDRKLLTYNRSQVNHEVLFASAKWHFPSFKQHLSTL
MSMLHGMFGGMNLLYWYKKLCLMDIDFMYEWKQDLDIVRSAVQGASTVAMQYFLRSPNVWWKHEGSSPVCDADIAVNDYLESFLRPLRPAYGWLSEETDDDLQRLNYETLFVVDPIDGTRAFIEGRNEWCISVAVVHHGRPVIGVVHASALGKEFFVSVGMKSTCNGKNISVSSNQMSDSLAIMASDVSLKGLDSYVRFRRQSSISSLCLRILMIASGEVDVLIVDRNANDWDLAAADLLLECSGGALVDIDRKLLTYNRSQVNHEVLFASAKWHFPSFKQHLSTL

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target286 inositol monophosphatase family protein [Candidatus Lib
315122184259 inositol monophosphatase family protein [Candidatus Lib 1 1e-119
218674009269 probable inositol monophosphatase protein [Rhizobium et 1 8e-62
15888037268 inositol monophosphatase family protein [Agrobacterium 1 6e-60
241203278269 inositol monophosphatase [Rhizobium leguminosarum bv. t 1 2e-59
116250674269 inositol monophosphate family protein [Rhizobium legumi 1 2e-59
222085020269 inositol monophosphatase protein [Agrobacterium radioba 1 2e-59
209548092269 inositol monophosphatase [Rhizobium leguminosarum bv. t 1 5e-58
222147684270 inositol monophosphatase family protein [Agrobacterium 1 7e-58
86356488269 inositol monophosphatase protein [Rhizobium etli CFN 42 1 1e-57
190890551269 inositol monophosphatase [Rhizobium etli CIAT 652] Leng 1 1e-57
>gi|315122184|ref|YP_004062673.1| inositol monophosphatase family protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 259 Back     alignment and organism information
 Score =  431 bits (1108), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 202/259 (77%), Positives = 231/259 (89%)

Query: 28  MYEWKQDLDIVRSAVQGASTVAMQYFLRSPNVWWKHEGSSPVCDADIAVNDYLESFLRPL 87
           MYEW++DLDIVRSAVQGAS +AM+YFL SPNVWWK+EGSSPVCDADIAVNDYLESFLRPL
Sbjct: 1   MYEWEKDLDIVRSAVQGASAIAMRYFLHSPNVWWKNEGSSPVCDADIAVNDYLESFLRPL 60

Query: 88  RPAYGWLSEETDDDLQRLNYETLFVVDPIDGTRAFIEGRNEWCISVAVVHHGRPVIGVVH 147
           RP+YGWLSEETDDDLQRLN ETLFVVDPIDGTRAFI+GR EWCISVAVVH GRPV  VVH
Sbjct: 61  RPSYGWLSEETDDDLQRLNCETLFVVDPIDGTRAFIDGRKEWCISVAVVHRGRPVTSVVH 120

Query: 148 ASALGKEFFVSVGMKSTCNGKNISVSSNQMSDSLAIMASDVSLKGLDSYVRFRRQSSISS 207
           ASA  KEFFVSVGMK  CNGKNISV+S+ + D L +MA D  LKGL+SY+ F+++  +SS
Sbjct: 121 ASAFDKEFFVSVGMKPICNGKNISVASSAIGDCLMVMAGDFLLKGLESYIHFQQKPCVSS 180

Query: 208 LCLRILMIASGEVDVLIVDRNANDWDLAAADLLLECSGGALVDIDRKLLTYNRSQVNHEV 267
           LCLR++M+ASGE+D +IV+RN+NDWDLAAADLLL+C+GG LVD+D KLLTYNRSQV+H+V
Sbjct: 181 LCLRLVMVASGEIDAVIVNRNSNDWDLAAADLLLQCAGGELVDVDGKLLTYNRSQVSHDV 240

Query: 268 LFASAKWHFPSFKQHLSTL 286
           LFAS K HF SFK HLSTL
Sbjct: 241 LFASTKCHFASFKPHLSTL 259


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|218674009|ref|ZP_03523678.1| probable inositol monophosphatase protein [Rhizobium etli GR56] Length = 269 Back     alignment and organism information
>gi|15888037|ref|NP_353718.1| inositol monophosphatase family protein [Agrobacterium tumefaciens str. C58] Length = 268 Back     alignment and organism information
>gi|241203278|ref|YP_002974374.1| inositol monophosphatase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 269 Back     alignment and organism information
>gi|116250674|ref|YP_766512.1| inositol monophosphate family protein [Rhizobium leguminosarum bv. viciae 3841] Length = 269 Back     alignment and organism information
>gi|222085020|ref|YP_002543549.1| inositol monophosphatase protein [Agrobacterium radiobacter K84] Length = 269 Back     alignment and organism information
>gi|209548092|ref|YP_002280009.1| inositol monophosphatase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 269 Back     alignment and organism information
>gi|222147684|ref|YP_002548641.1| inositol monophosphatase family protein [Agrobacterium vitis S4] Length = 270 Back     alignment and organism information
>gi|86356488|ref|YP_468380.1| inositol monophosphatase protein [Rhizobium etli CFN 42] Length = 269 Back     alignment and organism information
>gi|190890551|ref|YP_001977093.1| inositol monophosphatase [Rhizobium etli CIAT 652] Length = 269 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target286 inositol monophosphatase family protein [Candidatus Lib
COG0483260 COG0483, SuhB, Archaeal fructose-1,6-bisphosphatase and 4e-39
COG1218276 COG1218, CysQ, 3'-Phosphoadenosine 5'-phosphosulfate (P 5e-34
cd01637238 cd01637, IMPase_like, Inositol-monophosphatase-like dom 2e-33
pfam00459269 pfam00459, Inositol_P, Inositol monophosphatase family 5e-33
TIGR01331249 TIGR01331, bisphos_cysQ, 3'(2'),5'-bisphosphate nucleot 7e-27
cd01639244 cd01639, IMPase, IMPase, inositol monophosphatase and r 1e-25
cd01641248 cd01641, Bacterial_IMPase_like_1, Predominantly bacteri 4e-22
cd01643242 cd01643, Bacterial_IMPase_like_2, Bacterial family of M 6e-22
cd01517274 cd01517, PAP_phosphatase, PAP-phosphatase_like domains 6e-20
TIGR02067251 TIGR02067, his_9_proposed, histidinol-phosphate phospha 7e-19
KOG2951279 KOG2951, KOG2951, KOG2951, Inositol monophosphatase [Ca 1e-17
PLN02911296 PLN02911, PLN02911, inositol-phosphate phosphatase 5e-15
PLN02737363 PLN02737, PLN02737, inositol monophosphatase family pro 2e-10
cd01636184 cd01636, FIG, FIG, FBPase/IMPase/glpX-like domain 2e-09
PRK10757267 PRK10757, PRK10757, inositol monophosphatase; Provision 1e-07
cd01638242 cd01638, CysQ, CysQ, a 3'-Phosphoadenosine-5'-phosphosu 6e-52
PRK10931246 PRK10931, PRK10931, adenosine-3'(2'),5'-bisphosphate nu 8e-12
cd01515257 cd01515, Arch_FBPase_1, Archaeal fructose-1,6-bisphosph 2e-11
PRK12676263 PRK12676, PRK12676, bifunctional inositol-1 monophospha 3e-11
PLN02553270 PLN02553, PLN02553, inositol-phosphate phosphatase 4e-10
cd01640293 cd01640, IPPase, IPPase; Inositol polyphosphate-1-phosp 9e-10
KOG3099340 KOG3099, KOG3099, KOG3099, Bisphosphate 3'-nucleotidase 3e-07
KOG1528351 KOG1528, KOG1528, KOG1528, Salt-sensitive 3'-phosphoade 2e-05
KOG3853350 KOG3853, KOG3853, KOG3853, Inositol monophosphatase [Si 6e-09
PRK14076 569 PRK14076, pnk, inorganic polyphosphate/ATP-NAD kinase; 2e-04
>gnl|CDD|30831 COG0483, SuhB, Archaeal fructose-1,6-bisphosphatase and related enzymes of inositol monophosphatase family [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|31411 COG1218, CysQ, 3'-Phosphoadenosine 5'-phosphosulfate (PAPS) 3'-phosphatase [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|30135 cd01637, IMPase_like, Inositol-monophosphatase-like domains Back     alignment and domain information
>gnl|CDD|144160 pfam00459, Inositol_P, Inositol monophosphatase family Back     alignment and domain information
>gnl|CDD|130398 TIGR01331, bisphos_cysQ, 3'(2'),5'-bisphosphate nucleotidase, bacterial Back     alignment and domain information
>gnl|CDD|30137 cd01639, IMPase, IMPase, inositol monophosphatase and related domains Back     alignment and domain information
>gnl|CDD|30139 cd01641, Bacterial_IMPase_like_1, Predominantly bacterial family of Mg++ dependend phosphatases, related to inositol monophosphatases Back     alignment and domain information
>gnl|CDD|30141 cd01643, Bacterial_IMPase_like_2, Bacterial family of Mg++ dependent phosphatases, related to inositol monophosphatases Back     alignment and domain information
>gnl|CDD|73273 cd01517, PAP_phosphatase, PAP-phosphatase_like domains Back     alignment and domain information
>gnl|CDD|162680 TIGR02067, his_9_proposed, histidinol-phosphate phosphatase HisN, inositol monophosphatase family Back     alignment and domain information
>gnl|CDD|38162 KOG2951, KOG2951, KOG2951, Inositol monophosphatase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|178499 PLN02911, PLN02911, inositol-phosphate phosphatase Back     alignment and domain information
>gnl|CDD|178338 PLN02737, PLN02737, inositol monophosphatase family protein Back     alignment and domain information
>gnl|CDD|73280 cd01636, FIG, FIG, FBPase/IMPase/glpX-like domain Back     alignment and domain information
>gnl|CDD|182704 PRK10757, PRK10757, inositol monophosphatase; Provisional Back     alignment and domain information
>gnl|CDD|30136 cd01638, CysQ, CysQ, a 3'-Phosphoadenosine-5'-phosphosulfate (PAPS) 3'-phosphatase, is a bacterial member of the inositol monophosphatase family Back     alignment and domain information
>gnl|CDD|182848 PRK10931, PRK10931, adenosine-3'(2'),5'-bisphosphate nucleotidase; Provisional Back     alignment and domain information
>gnl|CDD|30131 cd01515, Arch_FBPase_1, Archaeal fructose-1,6-bisphosphatase and related enzymes of inositol monophosphatase family (FBPase class IV) Back     alignment and domain information
>gnl|CDD|183673 PRK12676, PRK12676, bifunctional inositol-1 monophosphatase/fructose-1,6-bisphosphatase; Reviewed Back     alignment and domain information
>gnl|CDD|178168 PLN02553, PLN02553, inositol-phosphate phosphatase Back     alignment and domain information
>gnl|CDD|30138 cd01640, IPPase, IPPase; Inositol polyphosphate-1-phosphatase, a member of the Mg++ dependent family of inositol monophosphatase-like domains, hydrolyzes the 1' position phosphate from inositol 1,3,4-trisphosphate and inositol 1,4-bisphosphate Back     alignment and domain information
>gnl|CDD|38309 KOG3099, KOG3099, KOG3099, Bisphosphate 3'-nucleotidase BPNT1/Inositol polyphosphate 1-phosphatase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|36741 KOG1528, KOG1528, KOG1528, Salt-sensitive 3'-phosphoadenosine-5'-phosphatase HAL2/SAL1 [Nucleotide transport and metabolism, Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|39057 KOG3853, KOG3853, KOG3853, Inositol monophosphatase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|184490 PRK14076, pnk, inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 286 inositol monophosphatase family protein [Candidatus Lib
PRK12676262 bifunctional inositol-1 monophosphatase/fructose-1,6-bi 100.0
cd01641248 Bacterial_IMPase_like_1 Predominantly bacterial family 100.0
pfam00459269 Inositol_P Inositol monophosphatase family. 100.0
cd01643242 Bacterial_IMPase_like_2 Bacterial family of Mg++ depend 100.0
PRK10757267 inositol monophosphatase; Provisional 100.0
cd01638242 CysQ CysQ, a 3'-Phosphoadenosine-5'-phosphosulfate (PAP 100.0
cd01515257 Arch_FBPase_1 Archaeal fructose-1,6-bisphosphatase and 100.0
TIGR02067269 his_9_proposed histidinol-phosphate phosphatase, putati 100.0
cd01639244 IMPase IMPase, inositol monophosphatase and related dom 100.0
cd01637238 IMPase_like Inositol-monophosphatase-like domains. This 100.0
COG0483260 SuhB Archaeal fructose-1,6-bisphosphatase and related e 100.0
PRK10931246 PAPS (adenosine 3'-phosphate 5'-phosphosulfate) 3'(2'), 100.0
TIGR01331263 bisphos_cysQ 3'(2'),5'-bisphosphate nucleotidase; Inter 100.0
cd01517274 PAP_phosphatase PAP-phosphatase_like domains. PAP-phosp 100.0
KOG2951279 consensus 100.0
cd01640293 IPPase IPPase; Inositol polyphosphate-1-phosphatase, a 100.0
COG1218276 CysQ 3'-Phosphoadenosine 5'-phosphosulfate (PAPS) 3'-ph 100.0
TIGR01330382 bisphos_HAL2 3'(2'),5'-bisphosphate nucleotidase; Inter 100.0
KOG1528351 consensus 100.0
KOG3853350 consensus 99.95
KOG3099340 consensus 99.93
cd00354315 FBPase Fructose-1,6-bisphosphatase, an enzyme that cata 99.01
PRK09293328 fructose-1,6-bisphosphatase; Provisional 98.97
pfam00316325 FBPase Fructose-1-6-bisphosphatase. 98.91
COG0158326 Fbp Fructose-1,6-bisphosphatase [Carbohydrate transport 98.68
cd01642244 Arch_FBPase_2 Putative fructose-1,6-bisphosphatase or r 100.0
cd01636184 FIG FIG, FBPase/IMPase/glpX-like domain. A superfamily 100.0
KOG1458343 consensus 98.5
PRK12388321 fructose-1,6-bisphosphatase II-like protein; Reviewed 94.37
pfam03320308 FBPase_glpX Bacterial fructose-1,6-bisphosphatase, glpX 92.16
PRK09479320 glpX fructose 1,6-bisphosphatase II; Reviewed 90.69
PRK12415323 fructose 1,6-bisphosphatase II; Reviewed 90.08
>PRK12676 bifunctional inositol-1 monophosphatase/fructose-1,6-bisphosphatase; Reviewed Back     alignment and domain information
>cd01641 Bacterial_IMPase_like_1 Predominantly bacterial family of Mg++ dependend phosphatases, related to inositol monophosphatases Back     alignment and domain information
>pfam00459 Inositol_P Inositol monophosphatase family Back     alignment and domain information
>cd01643 Bacterial_IMPase_like_2 Bacterial family of Mg++ dependent phosphatases, related to inositol monophosphatases Back     alignment and domain information
>PRK10757 inositol monophosphatase; Provisional Back     alignment and domain information
>cd01638 CysQ CysQ, a 3'-Phosphoadenosine-5'-phosphosulfate (PAPS) 3'-phosphatase, is a bacterial member of the inositol monophosphatase family Back     alignment and domain information
>cd01515 Arch_FBPase_1 Archaeal fructose-1,6-bisphosphatase and related enzymes of inositol monophosphatase family (FBPase class IV) Back     alignment and domain information
>TIGR02067 his_9_proposed histidinol-phosphate phosphatase, putative; InterPro: IPR011809 This entry contains proteins that belong to the inositol monophosphatase family Back     alignment and domain information
>cd01639 IMPase IMPase, inositol monophosphatase and related domains Back     alignment and domain information
>cd01637 IMPase_like Inositol-monophosphatase-like domains Back     alignment and domain information
>COG0483 SuhB Archaeal fructose-1,6-bisphosphatase and related enzymes of inositol monophosphatase family [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK10931 PAPS (adenosine 3'-phosphate 5'-phosphosulfate) 3'(2'),5'-bisphosphate nucleotidase; Provisional Back     alignment and domain information
>TIGR01331 bisphos_cysQ 3'(2'),5'-bisphosphate nucleotidase; InterPro: IPR006240 Sulphate is incorporated into 3-phosphoadenylylsulphate, PAPS, for utilization in pathways such as methionine biosynthesis Back     alignment and domain information
>cd01517 PAP_phosphatase PAP-phosphatase_like domains Back     alignment and domain information
>KOG2951 consensus Back     alignment and domain information
>cd01640 IPPase IPPase; Inositol polyphosphate-1-phosphatase, a member of the Mg++ dependent family of inositol monophosphatase-like domains, hydrolyzes the 1' position phosphate from inositol 1,3,4-trisphosphate and inositol 1,4-bisphosphate Back     alignment and domain information
>COG1218 CysQ 3'-Phosphoadenosine 5'-phosphosulfate (PAPS) 3'-phosphatase [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01330 bisphos_HAL2 3'(2'),5'-bisphosphate nucleotidase; InterPro: IPR006239 Sulphate is incorporated into 3-phosphoadenylylsulphate, PAPS, for utilization in pathways such as methionine biosynthesis Back     alignment and domain information
>KOG1528 consensus Back     alignment and domain information
>KOG3853 consensus Back     alignment and domain information
>KOG3099 consensus Back     alignment and domain information
>cd00354 FBPase Fructose-1,6-bisphosphatase, an enzyme that catalyzes the hydrolysis of fructose-1,6-biphosphate into fructose-6-phosphate and is critical in gluconeogenesis pathway Back     alignment and domain information
>PRK09293 fructose-1,6-bisphosphatase; Provisional Back     alignment and domain information
>pfam00316 FBPase Fructose-1-6-bisphosphatase Back     alignment and domain information
>COG0158 Fbp Fructose-1,6-bisphosphatase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd01642 Arch_FBPase_2 Putative fructose-1,6-bisphosphatase or related enzymes of inositol monophosphatase family Back     alignment and domain information
>cd01636 FIG FIG, FBPase/IMPase/glpX-like domain Back     alignment and domain information
>KOG1458 consensus Back     alignment and domain information
>PRK12388 fructose-1,6-bisphosphatase II-like protein; Reviewed Back     alignment and domain information
>pfam03320 FBPase_glpX Bacterial fructose-1,6-bisphosphatase, glpX-encoded Back     alignment and domain information
>PRK09479 glpX fructose 1,6-bisphosphatase II; Reviewed Back     alignment and domain information
>PRK12415 fructose 1,6-bisphosphatase II; Reviewed Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target286 inositol monophosphatase family protein [Candidatus Lib
2qfl_A267 Structure Of Suhb: Inositol Monophosphatase And Ext 2e-31
3luz_A267 Crystal Structure Of Extragenic Suppressor Protein 5e-28
2czh_A299 Crystal Structure Of Human Myo-Inositol Monophospha 6e-28
2p3n_A256 Thermotoga Maritima Impase Tm1415 Length = 256 8e-28
2fvz_A273 Human Inositol Monophosphosphatase 2 Length = 273 2e-27
1ima_A277 Structural Analysis Of Inositol Monophosphatase Com 8e-26
2hhm_A276 Structure Of Inositol Monophosphatase, The Putative 9e-26
2bji_A277 High Resolution Structure Of Myo-Inositol Monophosp 9e-26
2pcr_A264 Crystal Structure Of Myo-Inositol-1(Or 4)-Monophosp 7e-21
1vdw_A254 A Hypothetical Protein Ph1897 From Pyrococcus Horik 2e-14
1dk4_A252 Crystal Structure Of Mj0109 Gene Product Inositol M 7e-14
1lbv_A252 Crystal Structure Of Apo-Form (P21) Of Dual Activit 2e-13
3b8b_A292 Crystal Structure Of Cysq From Bacteroides Thetaiot 5e-13
1xi6_A262 Extragenic Suppressor From Pyrococcus Furiosus Pfu- 3e-11
1jp4_A308 Crystal Structure Of An Enzyme Displaying Both Inos 9e-11
2wef_A311 Human 3'(2'), 5'-Bisphosphate Nucleotidase 1 (Bpnt1 3e-10
1qgx_A357 X-Ray Structure Of Yeast Hal2p Length = 357 6e-07
2q74_A299 Mycobacterium Tuberculosis Suhb Length = 299 0.001
>gi|157835913|pdb|2QFL|A Chain A, Structure Of Suhb: Inositol Monophosphatase And Extragenic Suppressor From E. Coli Length = 267 Back     alignment and structure
 Score =  140 bits (353), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 49/260 (18%), Positives = 96/260 (36%), Gaps = 17/260 (6%)

Query: 31  WKQDLDIVRSAVQGASTVAMQYFLRSPNVWWKHEG-SSPVCDADIAVNDYLESFLRPLRP 89
               L+I   A + A  +  + +     V    +G +  V + D A    +   +R   P
Sbjct: 1   MHPMLNIAVRAARKAGNLIAKNYETPDAVEASQKGSNDFVTNVDKAAEAVIIDTIRKSYP 60

Query: 90  AYGWLSEETDDDLQRLNYETLFVVDPIDGTRAFIEGRNEWCISVAVVHHGRPVIGVVHAS 149
            +  ++EE+ +          +V+DP+DGT  FI+    + +S+AV   GR  + VV+  
Sbjct: 61  QHTIITEESGELEGTDQDV-QWVIDPLDGTTNFIKRLPHFAVSIAVRIKGRTEVAVVYDP 119

Query: 150 ALGKEFFVSVGMKSTCNGKNISVSSNQMSDSLAIMASDVSLKGL----------DSYVRF 199
              + F  + G  +  NG  +  S+ +  D   +                      +   
Sbjct: 120 MRNELFTATRGQGAQLNGYRLRGSTARDLDGTILATGFPFKAKQYATTYINIVGKLFNEC 179

Query: 200 RRQSSISSLCLRILMIASGEVDVLIVDRNANDWDLAAADLLLECSGGALVDIDRKLLTYN 259
               +  S  L +  +A+G VD    +     WD AA +LL+  +GG + D        +
Sbjct: 180 ADFRATGSAALDLAYVAAGRVDGFF-EIGLRPWDFAAGELLVREAGGIVSDFTGG----H 234

Query: 260 RSQVNHEVLFASAKWHFPSF 279
              +   ++  + +      
Sbjct: 235 NYMLTGNIVAGNPRVVKAML 254


>gi|290560584|pdb|3LUZ|A Chain A, Crystal Structure Of Extragenic Suppressor Protein Suhb From Bartonella Henselae, Via Combined Iodide Sad Molecular Replacement Length = 267 Back     alignment and structure
>gi|112490221|pdb|2CZH|A Chain A, Crystal Structure Of Human Myo-Inositol Monophosphatase 2 (Impa2) With Phosphate Ion (Orthorhombic Form) Length = 299 Back     alignment and structure
gi|146387079|pdb|2P3N|A Chain A, Thermotoga Maritima Impase Tm1415 Length = 256 Back     alignment and structure
>gi|90109699|pdb|2FVZ|A Chain A, Human Inositol Monophosphosphatase 2 Length = 273 Back     alignment and structure
gi|996146|pdb|1IMA|A Chain A, Structural Analysis Of Inositol Monophosphatase Complexes With Substrates Length = 277 Back     alignment and structure
>gi|443382|pdb|2HHM|A Chain A, Structure Of Inositol Monophosphatase, The Putative Target Of Lithium Therapy Length = 276 Back     alignment and structure
gi|61680900|pdb|2BJI|A Chain A, High Resolution Structure Of Myo-Inositol Monophosphatase, The Target Of Lithium Therapy Length = 277 Back     alignment and structure
>gi|158429409|pdb|2PCR|A Chain A, Crystal Structure Of Myo-Inositol-1(Or 4)-Monophosphatase (Aq_1983) From Aquifex Aeolicus Vf5 Length = 264 Back     alignment and structure
gi|47169446|pdb|1VDW|A Chain A, A Hypothetical Protein Ph1897 From Pyrococcus Horikoshii With Similarities For Inositol-1 Monophosphatase Length = 254 Back     alignment and structure
gi|11513829|pdb|1DK4|A Chain A, Crystal Structure Of Mj0109 Gene Product Inositol Monophosphatase Length = 252 Back     alignment and structure
gi|21466040|pdb|1LBV|A Chain A, Crystal Structure Of Apo-Form (P21) Of Dual Activity FbpaseIMPASE (AF2372) FROM ARCHAEOGLOBUS FULGIDUS Length = 252 Back     alignment and structure
>gi|163311033|pdb|3B8B|A Chain A, Crystal Structure Of Cysq From Bacteroides Thetaiotaomicron, A Bacterial Member Of The Inositol Monophosphatase Family Length = 292 Back     alignment and structure
>gi|56967100|pdb|1XI6|A Chain A, Extragenic Suppressor From Pyrococcus Furiosus Pfu-1862794- 001 Length = 262 Back     alignment and structure
gi|15825834|pdb|1JP4|A Chain A, Crystal Structure Of An Enzyme Displaying Both Inositol- Polyphosphate 1-Phosphatase And 3'-Phosphoadenosine-5'- Phosphate Phosphatase Activities Length = 308 Back     alignment and structure
>gi|226887602|pdb|2WEF|A Chain A, Human 3'(2'), 5'-Bisphosphate Nucleotidase 1 (Bpnt1) In Complex With Amp, Po4 And Magnesium Length = 311 Back     alignment and structure
gi|7245969|pdb|1QGX|A Chain A, X-Ray Structure Of Yeast Hal2p Length = 357 Back     alignment and structure
>gi|159795170|pdb|2Q74|A Chain A, Mycobacterium Tuberculosis Suhb Length = 299 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target286 inositol monophosphatase family protein [Candidatus Lib
3lv0_A267 Extragenic suppressor protein SUHB; niaid, seattle stru 1e-29
1jp4_A308 3'(2'),5'-bisphosphate nucleotidase; protein-product co 8e-27
1g0h_A252 Inositol monophosphatase; homodimer, complexed with Ca2 7e-25
1lbv_A252 Fbpase/impase, fructose 1,6-bisphosphatase/inositol mon 3e-24
3b8b_A292 CYSQ, sulfite synthesis pathway protein; 3'-phosphoaden 3e-18
2bji_A277 Inositol-1(OR 4)-monophosphatase; hydrolase, aspartic p 3e-18
1ka1_A357 Halotolerance protein HAL2; nucleotidase, salt toleranc 5e-18
2fvz_A273 Inositol monophosphatase 2; inositol metabolism, struct 3e-16
2p3n_A256 Inositol-1-monophosphatase; tetramer, hydrolase; 2.20A 6e-16
2qfl_A267 Inositol-1-monophosphatase; impase extragenic suppresso 3e-15
2pcr_A264 Inositol-1-monophosphatase; bipolar disorder, structura 1e-14
2q74_A299 Inositol-1-monophosphatase; alpha-beta-alpha-beta-alpha 3e-12
1vdw_A254 Hypothetical protein PH1897; homodimer, riken structura 1e-09
1xi6_A262 Extragenic suppressor; structural genomics, southeast c 2e-07
1inp_A400 Inositol polyphosphate 1-phosphatase; hydrolase(phospho 2e-18
>3lv0_A Extragenic suppressor protein SUHB; niaid, seattle structural genomics center for infectious disease, ssgcid, CAT scratch disease; 1.85A {Bartonella henselae} PDB: 3luz_A Length = 267 Back     alignment and structure
 Score =  125 bits (315), Expect = 1e-29
 Identities = 49/252 (19%), Positives = 101/252 (40%), Gaps = 17/252 (6%)

Query: 35  LDIVRSAVQGASTVAMQYFLRSPNVWWKHEG-SSPVCDADIAVNDYLESFLRPLRPAYGW 93
           ++++  A   A    ++ +    N+    +G +  V  AD      + + L   RP +G+
Sbjct: 11  MNVMVQAAMKAGRSLVRDYGEVQNLQVSLKGPADYVSQADRKAEKIIFNELSKARPKFGF 70

Query: 94  LSEETDDDLQRLNYETLFVVDPIDGTRAFIEGRNEWCISVAVVHHGRPVIGVVHASALGK 153
           L EE+++ +   + +  F+VDP+DGT  F+ G   + +S+A+   G+ V GV++     +
Sbjct: 71  LMEESEEIIGE-DSQHRFIVDPLDGTTNFLHGIPFFAVSIALESQGKIVAGVIYNPINDE 129

Query: 154 EFFVSVGMKSTCNGKNISVSSNQMSDSLAIMASDVSL----------KGLDSYVRFRRQS 203
            F    G  +  N +   VS+ +  +   I      L          +  +         
Sbjct: 130 LFTAERGSGAFFNDRRCRVSARRRLEDCVIATGMPHLGRPGHGTYLIELRNVMAEVSGIR 189

Query: 204 SISSLCLRILMIASGEVDVLIVDRNANDWDLAAADLLLECSGGALVDIDRKLLTYNRSQV 263
              +  L +  +A+G  D    D     WD+AA  L++  +GG + D +     +     
Sbjct: 190 RFGTAALDLAYVAAGRTDGFWEDNL-QIWDMAAGILMVREAGGFVTDKEGGNDIFR---- 244

Query: 264 NHEVLFASAKWH 275
              ++  +    
Sbjct: 245 KKNIIAGNEHIR 256


>1jp4_A 3'(2'),5'-bisphosphate nucleotidase; protein-product complex, sugar nucleotidase fold, hydrolase; HET: AMP; 1.69A {Rattus norvegicus} SCOP: e.7.1.1 PDB: 2wef_A* Length = 308 Back     alignment and structure
>1g0h_A Inositol monophosphatase; homodimer, complexed with Ca2+ and I-1-P, hydrolase; HET: IPD; 2.30A {Methanocaldococcus jannaschii} SCOP: e.7.1.1 PDB: 1dk4_A* 1g0i_A* Length = 252 Back     alignment and structure
>1lbv_A Fbpase/impase, fructose 1,6-bisphosphatase/inositol monophosphatase; dual activity, archaeal phosphatase, APO- form, hydrolase; 1.80A {Archaeoglobus fulgidus} SCOP: e.7.1.1 PDB: 1lbw_A 1lbx_A* 1lby_A* 1lbz_A* Length = 252 Back     alignment and structure
>3b8b_A CYSQ, sulfite synthesis pathway protein; 3'-phosphoadenosine-5'-phosphosulfate (PAPS) 3'-phosphatase, structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Length = 292 Back     alignment and structure
>2bji_A Inositol-1(OR 4)-monophosphatase; hydrolase, aspartic proteinase mechanism, aspartyl protease, succinimide, zymogen; 1.30A {Bos taurus} PDB: 1imb_A* 1ima_A* 1imc_A 1imd_A 1ime_A 1imf_A 2hhm_A 1awb_A Length = 277 Back     alignment and structure
>1ka1_A Halotolerance protein HAL2; nucleotidase, salt tolerance, inositol, hydrolase; HET: A3P; 1.30A {Saccharomyces cerevisiae} SCOP: e.7.1.1 PDB: 1k9y_A 1ka0_A* 1k9z_A* 1qgx_A* Length = 357 Back     alignment and structure
>2fvz_A Inositol monophosphatase 2; inositol metabolism, structural genomics, structural genomics consortium, SGC, hydrolase; 2.40A {Homo sapiens} PDB: 2czh_A 2czi_A 2czk_A 2ddk_A Length = 273 Back     alignment and structure
>2p3n_A Inositol-1-monophosphatase; tetramer, hydrolase; 2.20A {Thermotoga maritima MSB8} PDB: 2p3v_A* Length = 256 Back     alignment and structure
>2qfl_A Inositol-1-monophosphatase; impase extragenic suppressor, dimerization, hydrolase; 1.90A {Escherichia coli} Length = 267 Back     alignment and structure
>2pcr_A Inositol-1-monophosphatase; bipolar disorder, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.60A {Aquifex aeolicus VF5} Length = 264 Back     alignment and structure
>2q74_A Inositol-1-monophosphatase; alpha-beta-alpha-beta-alpha sandwich, hydrolase; 2.60A {Mycobacterium tuberculosis H37RV} Length = 299 Back     alignment and structure
>1vdw_A Hypothetical protein PH1897; homodimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; 1.30A {Pyrococcus horikoshii} SCOP: e.7.1.1 Length = 254 Back     alignment and structure
>1xi6_A Extragenic suppressor; structural genomics, southeast collaboratory for structural genomics hyperthermophIle, PSI; 2.80A {Pyrococcus furiosus} SCOP: e.7.1.1 Length = 262 Back     alignment and structure
>1inp_A Inositol polyphosphate 1-phosphatase; hydrolase(phosphoric monoester); 2.30A {Bos taurus} SCOP: e.7.1.1 Length = 400 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target286 inositol monophosphatase family protein [Candidatus Lib
2bji_A277 Inositol-1(OR 4)-monophosphatase; hydrolase, aspartic p 100.0
2fvz_A273 Inositol monophosphatase 2; inositol metabolism, struct 100.0
2p3n_A256 Inositol-1-monophosphatase; tetramer, hydrolase; 2.20A 100.0
3lv0_A267 Extragenic suppressor protein SUHB; niaid, seattle stru 100.0
2qfl_A267 Inositol-1-monophosphatase; impase extragenic suppresso 100.0
2pcr_A264 Inositol-1-monophosphatase; bipolar disorder, structura 100.0
1ka1_A357 Halotolerance protein HAL2; nucleotidase, salt toleranc 100.0
1g0h_A252 Inositol monophosphatase; homodimer, complexed with Ca2 100.0
2q74_A299 Inositol-1-monophosphatase; alpha-beta-alpha-beta-alpha 100.0
3b8b_A292 CYSQ, sulfite synthesis pathway protein; 3'-phosphoaden 100.0
1vdw_A254 Hypothetical protein PH1897; homodimer, riken structura 100.0
1xi6_A262 Extragenic suppressor; structural genomics, southeast c 100.0
1jp4_A308 3'(2'),5'-bisphosphate nucleotidase; protein-product co 100.0
1lbv_A252 Fbpase/impase, fructose 1,6-bisphosphatase/inositol mon 100.0
1inp_A400 Inositol polyphosphate 1-phosphatase; hydrolase(phospho 100.0
1dcu_A357 Fructose-1,6-bisphosphatase; chloroplast, photosynthesi 98.98
1nuw_A337 Fructose-1,6-bisphosphatase; allosteric enzymes, glucon 98.89
2gq1_A332 Fructose-1,6-bisphosphatase; allosteric activator site, 98.97
2fhy_A374 Fructose-1,6-bisphosphatase 1; allosteric inhibitors hu 98.9
3big_A338 Fructose-1,6-bisphosphatase class II GLPX; carbohydrate 91.53
>2bji_A Inositol-1(OR 4)-monophosphatase; hydrolase, aspartic proteinase mechanism, aspartyl protease, succinimide, zymogen; 1.30A {Bos taurus} PDB: 1imb_A* 1ima_A* 1imc_A 1imd_A 1ime_A 1imf_A 2hhm_A 1awb_A Back     alignment and structure
Probab=100.00  E-value=0  Score=393.69  Aligned_cols=254  Identities=20%  Similarity=0.315  Sum_probs=217.8

Q ss_pred             HHC-CHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCCCEEEECCCCC--CCCC
Q ss_conf             411-0088999999999999999997188420477258888204899999999999998415631454224556--3324
Q gi|254780404|r   28 MYE-WKQDLDIVRSAVQGASTVAMQYFLRSPNVWWKHEGSSPVCDADIAVNDYLESFLRPLRPAYGWLSEETDD--DLQR  104 (286)
Q Consensus        28 m~~-~~~~l~~a~~aa~~Ag~~~~~~f~~~~~~~~k~~~~~~VT~aD~~~e~~i~~~L~~~~P~~~iigEE~~~--~~~~  104 (286)
                      |.+ ++++|++|+++|++||++++++|++...+++|+++.|+||++|+++|++|.+.|++.||+++|+|||+..  ....
T Consensus         1 m~~~~~e~l~~a~~~a~~Ag~~~~~~~~~~~~~~~k~~~~d~VT~aD~~~e~~i~~~L~~~~p~~~i~~EE~~~~~~~~~   80 (277)
T 2bji_A            1 MADPWQECMDYAVTLAGQAGEVVREALKNEMNIMVKSSPADLVTATDQKVEKMLITSIKEKYPSHSFIGEESVAAGEKSI   80 (277)
T ss_dssp             --CHHHHHHHHHHHHHHHHHHHHHHHHHSCCCEEECSSTTCEEEHHHHHHHHHHHHHHHHHSTTSEEEEHHHHHTTCCCC
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEECCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCC
T ss_conf             99769999999999999999999998556773687289988764999999999999999878999165555225676335


Q ss_pred             CCCEEEEEEEECCCCHHHHHCCCCHHHHHHHHHCCCCHHHHHCCCCCCCCCCCCCCCCEECCCCCCCCCCCCCCCCEEEE
Q ss_conf             66303567632134022210022102355543012210211000223332212223310017886333457876507999
Q gi|254780404|r  105 LNYETLFVVDPIDGTRAFIEGRNEWCISVAVVHHGRPVIGVVHASALGKEFFVSVGMKSTCNGKNISVSSNQMSDSLAIM  184 (286)
Q Consensus       105 ~~~~~~WiIDPIDGT~nF~~g~p~f~vsIal~~~g~pv~gvi~~P~~~~~~~a~~g~ga~~n~~~i~~~~~~~~~~~~~~  184 (286)
                      ...+++|+|||||||.||++|.|.||++|||+++|+|++|+||+|.++++|+|.+|+|+|+|+.+++++.........+.
T Consensus        81 ~~~~~~WiiDPIDGT~nF~~g~~~~~i~ial~~~g~p~~gvi~~P~~~~~~~a~~g~Ga~~n~~~~~~~~~~~~~~~~~~  160 (277)
T 2bji_A           81 LTDNPTWIIDPIDGTTNFVHGFPFVAVSIGFVVNKKMEFGIVYSCLEDKMYTGRKGKGAFCNGQKLQVSHQEDITKSLLV  160 (277)
T ss_dssp             CCSSCEEEEEEEECHHHHHHTCSCCEEEEEEEETTEEEEEEEEETTTTEEEEEETTTEEEETTEECCCCCCCCGGGCEEE
T ss_pred             CCCCCEEEECCCCCHHHHHCCCCCEEEEEECCCCCCCCCCEECCCCCCCCCEECCCCCEEECCCCCCCCCCCCHHHCEEE
T ss_conf             79987899867669799975998633221012377886763517768810020368632673732322455661223055


Q ss_pred             EECCCCCCHH-------H-----HHHHCCEEEECHHHHHHHHHHCCCCCEEEECCCCCHHHHHHHHHHHHHCCEEEECCC
Q ss_conf             8446643101-------2-----365437013052557889862122369985279998782167999986890999589
Q gi|254780404|r  185 ASDVSLKGLD-------S-----YVRFRRQSSISSLCLRILMIASGEVDVLIVDRNANDWDLAAADLLLECSGGALVDID  252 (286)
Q Consensus       185 ~~~~~~~~~~-------~-----~~~~~~~~~~gs~~~~~~~vA~G~~d~~~~~~~~~~WD~aAg~~i~~eAGG~vtdl~  252 (286)
                      ..........       .     ......+|.+||+++++|+||+|++|+|+.. +.++||+|||.+|++||||.++|++
T Consensus       161 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ir~~Gs~~~~~~~va~G~~d~~~~~-~~~~WD~aAg~li~~eaGg~vtd~~  239 (277)
T 2bji_A          161 TELGSSRTPETVRIILSNIERLLCLPIHGIRGVGTAALNMCLVAAGAADAYYEM-GIHCWDVAGAGIIVTEAGGVLLDVT  239 (277)
T ss_dssp             CCCCSCCCHHHHHHHHHHHHHHHTTTCSEEECCSCHHHHHHHHHTTSSSEEEEE-SCCHHHHHHHHHHHHHTTCEEECTT
T ss_pred             EEECCCCCHHHHHHHHHHHHHHHHCCCCCEEEECHHHHHHHHHHCCCEEEEEEC-CCCHHHHHHHHHHHHHCCCEEECCC
T ss_conf             421135773777888887788751243516751636988877515965799968-9998999999999997799599999


Q ss_pred             CCCCCCCCCCCCCCEEEECCHHHHHHHHHHHHCC
Q ss_conf             9841167755558889987489799999975129
Q gi|254780404|r  253 RKLLTYNRSQVNHEVLFASAKWHFPSFKQHLSTL  286 (286)
Q Consensus       253 G~~~~~~~~~~~~~~l~a~~~~~~~~l~~~~~~~  286 (286)
                      |+|+.|+.    .++++|+++..+..|.+.|..+
T Consensus       240 G~~~~~~~----~~~i~a~~~~l~~~ll~~l~~~  269 (277)
T 2bji_A          240 GGPFDLMS----RRVIASSNKTLAERIAKEIQII  269 (277)
T ss_dssp             SSBCCTTS----SEEEEESSHHHHHHHHHHCCCC
T ss_pred             CCCCCCCC----CCEEEECCHHHHHHHHHHHHHC
T ss_conf             99576889----9999983999999999998637



>2fvz_A Inositol monophosphatase 2; inositol metabolism, structural genomics, structural genomics consortium, SGC, hydrolase; 2.40A {Homo sapiens} PDB: 2czh_A 2czi_A 2czk_A 2ddk_A Back     alignment and structure
>2p3n_A Inositol-1-monophosphatase; tetramer, hydrolase; 2.20A {Thermotoga maritima MSB8} PDB: 2p3v_A* Back     alignment and structure
>3lv0_A Extragenic suppressor protein SUHB; niaid, seattle structural genomics center for infectious disease, ssgcid, CAT scratch disease; 1.85A {Bartonella henselae} PDB: 3luz_A Back     alignment and structure
>2qfl_A Inositol-1-monophosphatase; impase extragenic suppressor, dimerization, hydrolase; 1.90A {Escherichia coli} Back     alignment and structure
>2pcr_A Inositol-1-monophosphatase; bipolar disorder, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.60A {Aquifex aeolicus VF5} Back     alignment and structure
>1ka1_A Halotolerance protein HAL2; nucleotidase, salt tolerance, inositol, hydrolase; HET: A3P; 1.30A {Saccharomyces cerevisiae} SCOP: e.7.1.1 PDB: 1k9y_A 1ka0_A* 1k9z_A* 1qgx_A* Back     alignment and structure
>1g0h_A Inositol monophosphatase; homodimer, complexed with Ca2+ and I-1-P, hydrolase; HET: IPD; 2.30A {Methanocaldococcus jannaschii} SCOP: e.7.1.1 PDB: 1dk4_A* 1g0i_A* Back     alignment and structure
>2q74_A Inositol-1-monophosphatase; alpha-beta-alpha-beta-alpha sandwich, hydrolase; 2.60A {Mycobacterium tuberculosis H37RV} Back     alignment and structure
>3b8b_A CYSQ, sulfite synthesis pathway protein; 3'-phosphoadenosine-5'-phosphosulfate (PAPS) 3'-phosphatase, structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>1vdw_A Hypothetical protein PH1897; homodimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; 1.30A {Pyrococcus horikoshii} SCOP: e.7.1.1 Back     alignment and structure
>1xi6_A Extragenic suppressor; structural genomics, southeast collaboratory for structural genomics hyperthermophIle, PSI; 2.80A {Pyrococcus furiosus} SCOP: e.7.1.1 Back     alignment and structure
>1jp4_A 3'(2'),5'-bisphosphate nucleotidase; protein-product complex, sugar nucleotidase fold, hydrolase; HET: AMP; 1.69A {Rattus norvegicus} SCOP: e.7.1.1 PDB: 2wef_A* Back     alignment and structure
>1lbv_A Fbpase/impase, fructose 1,6-bisphosphatase/inositol monophosphatase; dual activity, archaeal phosphatase, APO- form, hydrolase; 1.80A {Archaeoglobus fulgidus} SCOP: e.7.1.1 PDB: 1lbw_A 1lbx_A* 1lby_A* 1lbz_A* Back     alignment and structure
>1inp_A Inositol polyphosphate 1-phosphatase; hydrolase(phosphoric monoester); 2.30A {Bos taurus} SCOP: e.7.1.1 Back     alignment and structure
>1dcu_A Fructose-1,6-bisphosphatase; chloroplast, photosynthesis, redox regulation, thioredoxin, allostery, hydrolase; 2.20A {Pisum sativum} SCOP: e.7.1.1 PDB: 1d9q_A 1dbz_A 1spi_A Back     alignment and structure
>1nuw_A Fructose-1,6-bisphosphatase; allosteric enzymes, gluconeogenesis, hydrolase; HET: F6P; 1.30A {Sus scrofa} SCOP: e.7.1.1 PDB: 1eyi_A* 1eyj_A* 1cnq_A* 1eyk_A* 1nux_A* 1nuy_A* 1nuz_A* 1nv0_A* 1nv1_A* 1nv2_A* 1nv3_A* 1nv4_A* 1nv5_A* 1nv6_A* 1nv7_A* 1q9d_A* 2qvu_A* 2qvv_A* 1fj6_A* 1fj9_A* ... Back     alignment and structure
>2gq1_A Fructose-1,6-bisphosphatase; allosteric activator site, quaternary conformation, hydrolase; 1.45A {Escherichia coli} PDB: 2owz_A* 2ox3_A* 2q8m_A* 2qvr_A* Back     alignment and structure
>2fhy_A Fructose-1,6-bisphosphatase 1; allosteric inhibitors human fbpase, benzoxazole, intersubunit allosteric inhibition of human fpbase, hydrolase; HET: A37; 2.95A {Homo sapiens} Back     alignment and structure
>3big_A Fructose-1,6-bisphosphatase class II GLPX; carbohydrate metabolism, cytoplasm, hydrolase, manganese; 1.85A {Escherichia coli K12} PDB: 2r8t_A 3bih_A 1ni9_A 3d1r_A* Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 286 inositol monophosphatase family protein [Candidatus Lib
d2hhma_272 e.7.1.1 (A:) Inositol monophosphatase {Human (Homo sapi 1e-19
d1jp4a_304 e.7.1.1 (A:) PIPase {Rat (Rattus norvegicus) [TaxId: 10 2e-18
d1ka1a_354 e.7.1.1 (A:) 3';5'-adenosine bisphosphatase, PAP phosph 4e-16
d1lbva_252 e.7.1.1 (A:) Archaeal inositol monophosphatase/fructose 5e-11
d1g0ha_252 e.7.1.1 (A:) Archaeal inositol monophosphatase/fructose 6e-10
d1vdwa_253 e.7.1.1 (A:) Archaeal inositol monophosphatase/fructose 3e-09
d1xi6a_249 e.7.1.1 (A:) Archaeal inositol monophosphatase/fructose 1e-08
d1inpa_400 e.7.1.1 (A:) Inositol polyphosphate 1-phosphatase {Cow 2e-18
>d2hhma_ e.7.1.1 (A:) Inositol monophosphatase {Human (Homo sapiens) [TaxId: 9606]} Length = 272 Back     information, alignment and structure

class: Multi-domain proteins (alpha and beta)
fold: Carbohydrate phosphatase
superfamily: Carbohydrate phosphatase
family: Inositol monophosphatase/fructose-1,6-bisphosphatase-like
domain: Inositol monophosphatase
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 90.9 bits (224), Expect = 1e-19
 Identities = 51/267 (19%), Positives = 106/267 (39%), Gaps = 19/267 (7%)

Query: 31  WKQDLDIVRSAVQGASTVAMQYFLRSPNVWWKHEGSSPVCDADIAVNDYLESFLRPLRPA 90
           W++ +D   +  + A  V  +      NV  K      V   D  V   L S ++   P+
Sbjct: 1   WQECMDYAVTLARQAGEVVCEAIKNEMNVMLKSSPVDLVTATDQKVEKMLISSIKEKYPS 60

Query: 91  YGWLSEETDDDLQR--LNYETLFVVDPIDGTRAFIEGRNEWCISVAVVHHGRPVIGVVHA 148
           + ++ EE+    ++  L     +++DPIDGT  F+       +S+    + +   GVV++
Sbjct: 61  HSFIGEESVAAGEKSILTDNPTWIIDPIDGTTNFVHRFPFVAVSIGFAVNKKIEFGVVYS 120

Query: 149 SALGKEFFVSVGMKSTCNGKNISVSSN------------QMSDSLAIMASDVSLKGLDSY 196
              GK +    G  + CNG+ + VS                S +   +   +S       
Sbjct: 121 CVEGKMYTARKGKGAFCNGQKLQVSQQEDITKSLLVTELGSSRTPETVRMVLSNMEKLFC 180

Query: 197 VRFRRQSSISSLCLRILMIASGEVDVLIVDRNANDWDLAAADLLLECSGGALVDIDRKLL 256
           +      S+ +  + + ++A+G  D    +   + WD+A A +++  +GG L+D+     
Sbjct: 181 IPVHGIRSVGTAAVNMCLVATGGADA-YYEMGIHCWDVAGAGIIVTEAGGVLMDVTGGPF 239

Query: 257 TYNRSQVNHEVLFASAKWHFPSFKQHL 283
                  +  V+ A+ +       + +
Sbjct: 240 DLM----SRRVIAANNRILAERIAKEI 262


>d1jp4a_ e.7.1.1 (A:) PIPase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 304 Back     information, alignment and structure
>d1ka1a_ e.7.1.1 (A:) 3';5'-adenosine bisphosphatase, PAP phosphatase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 354 Back     information, alignment and structure
>d1lbva_ e.7.1.1 (A:) Archaeal inositol monophosphatase/fructose-1,6-bisphosphatase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 252 Back     information, alignment and structure
>d1g0ha_ e.7.1.1 (A:) Archaeal inositol monophosphatase/fructose-1,6-bisphosphatase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 252 Back     information, alignment and structure
>d1vdwa_ e.7.1.1 (A:) Archaeal inositol monophosphatase/fructose-1,6-bisphosphatase {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 253 Back     information, alignment and structure
>d1xi6a_ e.7.1.1 (A:) Archaeal inositol monophosphatase/fructose-1,6-bisphosphatase {Pyrococcus furiosus [TaxId: 2261]} Length = 249 Back     information, alignment and structure
>d1inpa_ e.7.1.1 (A:) Inositol polyphosphate 1-phosphatase {Cow (Bos taurus), brain [TaxId: 9913]} Length = 400 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target286 inositol monophosphatase family protein [Candidatus Lib
d2hhma_272 Inositol monophosphatase {Human (Homo sapiens) [TaxId: 100.0
d1ka1a_354 3';5'-adenosine bisphosphatase, PAP phosphatase {Baker' 100.0
d1g0ha_252 Archaeal inositol monophosphatase/fructose-1,6-bisphosp 100.0
d1vdwa_253 Archaeal inositol monophosphatase/fructose-1,6-bisphosp 100.0
d1xi6a_249 Archaeal inositol monophosphatase/fructose-1,6-bisphosp 100.0
d1jp4a_304 PIPase {Rat (Rattus norvegicus) [TaxId: 10116]} 100.0
d1lbva_252 Archaeal inositol monophosphatase/fructose-1,6-bisphosp 100.0
d1inpa_400 Inositol polyphosphate 1-phosphatase {Cow (Bos taurus), 100.0
d1nuwa_328 Fructose-1,6-bisphosphatase {Pig (Sus scrofa) [TaxId: 9 98.92
d1d9qa_340 Fructose-1,6-bisphosphatase {Garden pea (Pisum sativum) 98.91
>d2hhma_ e.7.1.1 (A:) Inositol monophosphatase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Multi-domain proteins (alpha and beta)
fold: Carbohydrate phosphatase
superfamily: Carbohydrate phosphatase
family: Inositol monophosphatase/fructose-1,6-bisphosphatase-like
domain: Inositol monophosphatase
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=0  Score=393.15  Aligned_cols=251  Identities=20%  Similarity=0.312  Sum_probs=218.2

Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCCCEEEECCCCCC--CCCCCCE
Q ss_conf             00889999999999999999971884204772588882048999999999999984156314542245563--3246630
Q gi|254780404|r   31 WKQDLDIVRSAVQGASTVAMQYFLRSPNVWWKHEGSSPVCDADIAVNDYLESFLRPLRPAYGWLSEETDDD--LQRLNYE  108 (286)
Q Consensus        31 ~~~~l~~a~~aa~~Ag~~~~~~f~~~~~~~~k~~~~~~VT~aD~~~e~~i~~~L~~~~P~~~iigEE~~~~--~~~~~~~  108 (286)
                      +++++++++++|++||+++++.|++...++.|+++.|+||++|+++|++|++.|++.||+++|+|||.+..  ....+.+
T Consensus         1 ~qe~l~~a~~~a~~ag~~i~~~~~~~~~~~~k~~~~d~VT~aD~~~e~~i~~~L~~~~p~~~ii~EE~~~~~~~~~~~~~   80 (272)
T d2hhma_           1 WQECMDYAVTLARQAGEVVCEAIKNEMNVMLKSSPVDLVTATDQKVEKMLISSIKEKYPSHSFIGEESVAAGEKSILTDN   80 (272)
T ss_dssp             CHHHHHHHHHHHHHHHHHHHHHTTSCCCEEESSSTTCEEEHHHHHHHHHHHHHHHHHCTTCEEEEHHHHHTTCCCCCCSS
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHCCCCCEEECCCCCCHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHCCCCCCC
T ss_conf             98999999999999999999984567737971899773429999999999999975222210123331222201246788


Q ss_pred             EEEEEEECCCCHHHHHCCCCHHHHHHHHHCCCCHHHHHCCCCCCCCCCCCCCCCEECCCCCCCCCCCCCCCCEEEEEECC
Q ss_conf             35676321340222100221023555430122102110002233322122233100178863334578765079998446
Q gi|254780404|r  109 TLFVVDPIDGTRAFIEGRNEWCISVAVVHHGRPVIGVVHASALGKEFFVSVGMKSTCNGKNISVSSNQMSDSLAIMASDV  188 (286)
Q Consensus       109 ~~WiIDPIDGT~nF~~g~p~f~vsIal~~~g~pv~gvi~~P~~~~~~~a~~g~ga~~n~~~i~~~~~~~~~~~~~~~~~~  188 (286)
                      ++|+|||||||.||++|.|.|||+|+|+++++|++|+||+|.++++|+|.+|+|+|+|+++++++.........+.....
T Consensus        81 ~~WiiDPIDGT~nf~~g~p~~~isial~~~~~~~~gvi~~P~~~~~~~a~~G~Ga~~n~~~~~~~~~~~~~~~~~~~~~~  160 (272)
T d2hhma_          81 PTWIIDPIDGTTNFVHRFPFVAVSIGFAVNKKIEFGVVYSCVEGKMYTARKGKGAFCNGQKLQVSQQEDITKSLLVTELG  160 (272)
T ss_dssp             CEEEEEEEETHHHHHHTCSCCEEEEEEEETTEEEEEEEEETTTTEEEEEETTSCEEETTEECCCCCCCCGGGCEEECCCC
T ss_pred             CEEEECCCCCCHHHHHHHHHHEEECCCCCCCCCCCCCEECCCCCCEEEECCCCCCCCCCCCCCCCCCCCHHHHHEEEEEC
T ss_conf             87995665433899976010101002112576322321002568449972896653578434334556632300343111


Q ss_pred             CCCCH-------HH-----HHHHCCEEEECHHHHHHHHHHCCCCCEEEECCCCCHHHHHHHHHHHHHCCEEEECCCCCCC
Q ss_conf             64310-------12-----3654370130525578898621223699852799987821679999868909995899841
Q gi|254780404|r  189 SLKGL-------DS-----YVRFRRQSSISSLCLRILMIASGEVDVLIVDRNANDWDLAAADLLLECSGGALVDIDRKLL  256 (286)
Q Consensus       189 ~~~~~-------~~-----~~~~~~~~~~gs~~~~~~~vA~G~~d~~~~~~~~~~WD~aAg~~i~~eAGG~vtdl~G~~~  256 (286)
                      .....       ..     ..+..++|.+||+++++|+||+|++|+|+.. +.++||+|||.+|++||||.++|++|+|+
T Consensus       161 ~~~~~~~~~~~~~~~~~~~~~~~~~ir~~Gs~~l~~~~va~G~~d~~v~~-~~~~wD~aAg~li~~eaGg~vtd~~G~~~  239 (272)
T d2hhma_         161 SSRTPETVRMVLSNMEKLFCIPVHGIRSVGTAAVNMCLVATGGADAYYEM-GIHCWDVAGAGIIVTEAGGVLMDVTGGPF  239 (272)
T ss_dssp             SCCCHHHHHHHHHHHHHHHTTTCSEEEBCSCHHHHHHHHHHTSSSEEEEE-SCCHHHHHHHHHHHHHTTCEEECTTSSCC
T ss_pred             CCCCCHHHHHHHHHHHCCCCCCCCCEEEECHHHHHHHHHCCCCEEEEEEC-CCCHHHHHHHHHHHHHCCCEEECCCCCCC
T ss_conf             35662245556543100022454646564259998788606872599636-98866668999999978993988999926


Q ss_pred             CCCCCCCCCCEEEECCHHHHHHHHHHHHCC
Q ss_conf             167755558889987489799999975129
Q gi|254780404|r  257 TYNRSQVNHEVLFASAKWHFPSFKQHLSTL  286 (286)
Q Consensus       257 ~~~~~~~~~~~l~a~~~~~~~~l~~~~~~~  286 (286)
                      .|++    .++++|+++.+++.|.+.|..+
T Consensus       240 ~~~~----~~ii~a~~~~~~~~l~~~l~~~  265 (272)
T d2hhma_         240 DLMS----RRVIAANNRILAERIAKEIQVI  265 (272)
T ss_dssp             CTTS----SEEEEESSHHHHHHHHHHCCCC
T ss_pred             CCCC----CCEEEECCHHHHHHHHHHHHHC
T ss_conf             7899----9099999999999999973405



>d1ka1a_ e.7.1.1 (A:) 3';5'-adenosine bisphosphatase, PAP phosphatase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g0ha_ e.7.1.1 (A:) Archaeal inositol monophosphatase/fructose-1,6-bisphosphatase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1vdwa_ e.7.1.1 (A:) Archaeal inositol monophosphatase/fructose-1,6-bisphosphatase {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1xi6a_ e.7.1.1 (A:) Archaeal inositol monophosphatase/fructose-1,6-bisphosphatase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1jp4a_ e.7.1.1 (A:) PIPase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1lbva_ e.7.1.1 (A:) Archaeal inositol monophosphatase/fructose-1,6-bisphosphatase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1inpa_ e.7.1.1 (A:) Inositol polyphosphate 1-phosphatase {Cow (Bos taurus), brain [TaxId: 9913]} Back     information, alignment and structure
>d1nuwa_ e.7.1.1 (A:) Fructose-1,6-bisphosphatase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1d9qa_ e.7.1.1 (A:) Fructose-1,6-bisphosphatase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 286 inositol monophosphatase family protein [Candidatu
2fvz_A_273 (A:) Inositol monophosphatase 2; inositol metaboli 3e-30
2bji_A_277 (A:) Inositol-1(OR 4)-monophosphatase; hydrolase, 6e-29
2qfl_A_267 (A:) Inositol-1-monophosphatase; impase extragenic 6e-28
1g0h_A_252 (A:) Inositol monophosphatase; homodimer, complexe 9e-28
2p3n_A_256 (A:) Inositol-1-monophosphatase; tetramer, hydrola 2e-27
1xi6_A_262 (A:) Extragenic suppressor; structural genomics, s 2e-26
3b8b_A_292 (A:) CYSQ, sulfite synthesis pathway protein; 3'-p 2e-26
1lbv_A_252 (A:) Fbpase/impase, fructose 1,6-bisphosphatase/in 3e-26
1vdw_A_254 (A:) Hypothetical protein PH1897; homodimer, riken 7e-26
2q74_A_299 (A:) Inositol-1-monophosphatase; alpha-beta-alpha- 6e-25
2pcr_A_264 (A:) Inositol-1-monophosphatase; bipolar disorder, 3e-23
1jp4_A_308 (A:) 3'(2'),5'-bisphosphate nucleotidase; protein- 4e-23
1ka1_A_357 (A:) Halotolerance protein HAL2; nucleotidase, sal 5e-23
1inp_A_400 (A:) Inositol polyphosphate 1-phosphatase; hydrola 2e-20
1nuw_A_337 (A:) Fructose-1,6-bisphosphatase; allosteric enzym 7e-19
2fhy_A_374 (A:) Fructose-1,6-bisphosphatase 1; allosteric inh 3e-18
1dcu_A_1-228228 (A:1-228) Fructose-1,6-bisphosphatase; chloroplast 3e-17
2gq1_A_1-197197 (A:1-197) Fructose-1,6-bisphosphatase; allosteric 4e-14
>2fvz_A (A:) Inositol monophosphatase 2; inositol metabolism, structural genomics, structural genomics consortium, SGC, hydrolase; 2.40A {Homo sapiens} PDB: 2czh_A 2czi_A 2czk_A 2ddk_ALength = 273 Back     alignment and structure
 Score =  126 bits (318), Expect = 3e-30
 Identities = 54/267 (20%), Positives = 95/267 (35%), Gaps = 19/267 (7%)

Query: 31  WKQDLDIVRSAVQGASTVAMQYFLRSPNVWWKHEGSSPVCDADIAVNDYLESFLRPLRPA 90
           W++           A  +  +       V  K   +  V + D  V D + S LR   P+
Sbjct: 1   WEECFQAAVQLALRAGQIIRKALTEEKRVSTKTSAADLVTETDHLVEDLIISELRERFPS 60

Query: 91  YGWLSEET--DDDLQRLNYETLFVVDPIDGTRAFIEGRNEWCISVAVVHHGRPVIGVVHA 148
           + +++EE         L +   +++DPIDGT  F+       +S+          GV++ 
Sbjct: 61  HRFIAEEAAASGAKCVLTHSPTWIIDPIDGTCNFVHRFPTVAVSIGFAVRQELEFGVIYH 120

Query: 149 SALGKEFFVSVGMKSTCNGKNISVSSNQMSDSLAIMASDVSLKGLDSYVRF--------- 199
               + +    G  + CNG+ + VS         ++      +   +   F         
Sbjct: 121 CTEERLYTGRRGRGAFCNGQRLRVSGETDLSKALVLTEIGPKRDPATLKLFLSNMERLLH 180

Query: 200 ---RRQSSISSLCLRILMIASGEVDVLIVDRNANDWDLAAADLLLECSGGALVDIDRKLL 256
                   I S  L +  +ASG  D        + WDLAAA +++  +GG ++D     L
Sbjct: 181 AKAHGVRVIGSSTLALCHLASGAADA-YYQFGLHCWDLAAATVIIREAGGIVIDTSGGPL 239

Query: 257 TYNRSQVNHEVLFASAKWHFPSFKQHL 283
                     V+ AS +       Q L
Sbjct: 240 DLMA----CRVVAASTREMAMLIAQAL 262


>2bji_A (A:) Inositol-1(OR 4)-monophosphatase; hydrolase, aspartic proteinase mechanism, aspartyl protease, succinimide, zymogen; 1.30A {Bos taurus} PDB: 1imb_A* 1ima_A* 1imc_A 1imd_A 1ime_A 1imf_A 2hhm_A 1awb_ALength = 277 Back     alignment and structure
>2qfl_A (A:) Inositol-1-monophosphatase; impase extragenic suppressor, dimerization, hydrolase; 1.90A {Escherichia coli}Length = 267 Back     alignment and structure
>1g0h_A (A:) Inositol monophosphatase; homodimer, complexed with Ca2+ and I-1-P, hydrolase; HET: IPD; 2.30A {Methanocaldococcus jannaschii}Length = 252 Back     alignment and structure
>2p3n_A (A:) Inositol-1-monophosphatase; tetramer, hydrolase; 2.20A {Thermotoga maritima MSB8} PDB: 2p3v_A*Length = 256 Back     alignment and structure
>1xi6_A (A:) Extragenic suppressor; structural genomics, southeast collaboratory for structural genomics hyperthermophIle, PSI; 2.80A {Pyrococcus furiosus}Length = 262 Back     alignment and structure
>3b8b_A (A:) CYSQ, sulfite synthesis pathway protein; 3'-phosphoadenosine-5'-phosphosulfate (PAPS) 3'-phosphatase, structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482}Length = 292 Back     alignment and structure
>1lbv_A (A:) Fbpase/impase, fructose 1,6-bisphosphatase/inositol monophosphatase; dual activity, archaeal phosphatase, APO- form, hydrolase; 1.80A {Archaeoglobus fulgidus}Length = 252 Back     alignment and structure
>1vdw_A (A:) Hypothetical protein PH1897; homodimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; 1.30A {Pyrococcus horikoshii}Length = 254 Back     alignment and structure
>2q74_A (A:) Inositol-1-monophosphatase; alpha-beta-alpha-beta-alpha sandwich, hydrolase; 2.60A {Mycobacterium tuberculosis H37RV}Length = 299 Back     alignment and structure
>2pcr_A (A:) Inositol-1-monophosphatase; bipolar disorder, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.60A {Aquifex aeolicus VF5}Length = 264 Back     alignment and structure
>1jp4_A (A:) 3'(2'),5'-bisphosphate nucleotidase; protein-product complex, sugar nucleotidase fold, hydrolase; HET: AMP; 1.69A {Rattus norvegicus}Length = 308 Back     alignment and structure
>1ka1_A (A:) Halotolerance protein HAL2; nucleotidase, salt tolerance, inositol, hydrolase; HET: A3P; 1.30A {Saccharomyces cerevisiae}Length = 357 Back     alignment and structure
>1inp_A (A:) Inositol polyphosphate 1-phosphatase; hydrolase(phosphoric monoester); 2.30A {Bos taurus}Length = 400 Back     alignment and structure
>1nuw_A (A:) Fructose-1,6-bisphosphatase; allosteric enzymes, gluconeogenesis, hydrolase; HET: F6P; 1.30A {Sus scrofa}Length = 337 Back     alignment and structure
>2fhy_A (A:) Fructose-1,6-bisphosphatase 1; allosteric inhibitors human fbpase, benzoxazole, intersubunit allosteric inhibition of human fpbase, hydrolase; HET: A37; 2.95A {Homo sapiens}Length = 374 Back     alignment and structure
>1dcu_A (A:1-228) Fructose-1,6-bisphosphatase; chloroplast, photosynthesis, redox regulation, thioredoxin, allostery; 2.20A {Pisum sativum}Length = 228 Back     alignment and structure
>2gq1_A (A:1-197) Fructose-1,6-bisphosphatase; allosteric activator site, quaternary conformation, hydrolase; 1.45A {Escherichia coli} PDB: 2owz_A* 2ox3_A* 2q8m_A* 2qvr_A*Length = 197 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target286 inositol monophosphatase family protein [Candidatus Lib
1g0h_A_252 Inositol monophosphatase; homodimer, complexed wit 100.0
2fvz_A_273 Inositol monophosphatase 2; inositol metabolism, s 100.0
2bji_A_277 Inositol-1(OR 4)-monophosphatase; hydrolase, aspar 100.0
2p3n_A_256 Inositol-1-monophosphatase; tetramer, hydrolase; 2 100.0
2qfl_A_267 Inositol-1-monophosphatase; impase extragenic supp 100.0
2q74_A_299 Inositol-1-monophosphatase; alpha-beta-alpha-beta- 100.0
2pcr_A_264 Inositol-1-monophosphatase; bipolar disorder, stru 100.0
1vdw_A_254 Hypothetical protein PH1897; homodimer, riken stru 100.0
3b8b_A_292 CYSQ, sulfite synthesis pathway protein; 3'-phosph 100.0