254780408

254780408

hypothetical protein CLIBASIA_01465

GeneID in NCBI database:8209393Locus tag:CLIBASIA_01465
Protein GI in NCBI database:254780408Protein Accession:YP_003064821.1
Gene range:+(309692, 309919)Protein Length:75aa
Gene description:hypothetical protein
COG prediction:[S] Uncharacterized conserved small protein
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70-----
MRTVQINIRGLMNNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF
ccEEEEEEEEEccccccccccccccHHHHHHHHHHHHHHHHHHHHccccHHHcccccccccccccHHHccEEccc
ccEEEEEEEccccccccccccccccHHHHHHHHHHHHHHHHHHHHccccHHHcccccccccccccccEccEEEcc
MRTVQINIRGlmnnstiktshdplSSIAKRALEEAKQrksannkdaklpieiggrkgldptrfgdwekngisidf
MRTVQINirglmnnstiktshdpLSSIAKRALEEakqrksannkdaklpieiggrkgldptrfgdwekngisidf
MRTVQINIRGLMNNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF
**********************************************************DPTRFGDWEKNGISIDF
MRTVQINIRGLMNNSTIKTSHDPLSSIAKRAL**********NKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF
*RTVQINIRGLMNN****T**DPLSS***RALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRTVQINIRGLMNNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF
MRTVQINIRGLMNNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF
MRTVQINIRGLMNNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target75 hypothetical protein CLIBASIA_01465 [Candidatus Liberib
31512214964 hypothetical protein CKC_01995 [Candidatus Liberibacter 1 9e-21
8395071364 hypothetical protein ISM_06425 [Roseovarius nubinhibens 1 3e-10
8394568267 hypothetical protein OA2633_10839 [Oceanicaulis alexand 1 1e-09
22208791874 hypothetical protein Arad_4931 [Agrobacterium radiobact 1 1e-09
25526251062 conserved domain protein [Thalassiobium sp. R2A62] Leng 1 3e-09
12672779684 hypothetical protein RB2150_10549 [Rhodobacterales bact 1 1e-08
25446471163 conserved hypothetical protein [Rhodobacterales bacteri 1 1e-08
11063574470 hypothetical protein Meso_3416 [Mesorhizobium sp. BNC1] 1 1e-08
15039838566 hypothetical protein Smed_3193 [Sinorhizobium medicae W 1 2e-08
31940485071 conserved hypothetical protein [Bartonella rochalimae A 1 3e-08
>gi|315122149|ref|YP_004062638.1| hypothetical protein CKC_01995 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 64 Back     alignment and organism information
 Score =  103 bits (256), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 49/64 (76%), Positives = 56/64 (87%)

Query: 12 MNNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGI 71
          MNN+T K S + LSSIAKRALEEA+QR+SA NK+AK P+EIGGR G DPTRFGDWEKNG+
Sbjct: 1  MNNNTTKKSKETLSSIAKRALEEARQRRSAENKNAKHPVEIGGRDGPDPTRFGDWEKNGL 60

Query: 72 SIDF 75
          SIDF
Sbjct: 61 SIDF 64


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|83950713|ref|ZP_00959446.1| hypothetical protein ISM_06425 [Roseovarius nubinhibens ISM] Length = 64 Back     alignment and organism information
>gi|83945682|ref|ZP_00958027.1| hypothetical protein OA2633_10839 [Oceanicaulis alexandrii HTCC2633] Length = 67 Back     alignment and organism information
>gi|222087918|ref|YP_002546456.1| hypothetical protein Arad_4931 [Agrobacterium radiobacter K84] Length = 74 Back     alignment and organism information
>gi|255262510|ref|ZP_05341852.1| conserved domain protein [Thalassiobium sp. R2A62] Length = 62 Back     alignment and organism information
>gi|126727796|ref|ZP_01743626.1| hypothetical protein RB2150_10549 [Rhodobacterales bacterium HTCC2150] Length = 84 Back     alignment and organism information
>gi|254464711|ref|ZP_05078122.1| conserved hypothetical protein [Rhodobacterales bacterium Y4I] Length = 63 Back     alignment and organism information
>gi|110635744|ref|YP_675952.1| hypothetical protein Meso_3416 [Mesorhizobium sp. BNC1] Length = 70 Back     alignment and organism information
>gi|150398385|ref|YP_001328852.1| hypothetical protein Smed_3193 [Sinorhizobium medicae WSM419] Length = 66 Back     alignment and organism information
>gi|319404850|emb|CBI78451.1| conserved hypothetical protein [Bartonella rochalimae ATCC BAA-1498] Length = 71 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target75 hypothetical protein CLIBASIA_01465 [Candidatus Liberib
pfam0789641 pfam07896, DUF1674, Protein of unknown function (DUF167 2e-12
KOG3245106 KOG3245, KOG3245, KOG3245, Uncharacterized conserved pr 2e-04
COG550884 COG5508, COG5508, Uncharacterized conserved small prote 3e-11
>gnl|CDD|149136 pfam07896, DUF1674, Protein of unknown function (DUF1674) Back     alignment and domain information
>gnl|CDD|38455 KOG3245, KOG3245, KOG3245, Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>gnl|CDD|35067 COG5508, COG5508, Uncharacterized conserved small protein [Function unknown] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 75 hypothetical protein CLIBASIA_01465 [Candidatus Liberib
COG550884 Uncharacterized conserved small protein [Function unkno 99.88
pfam0789641 DUF1674 Protein of unknown function (DUF1674). The memb 99.74
KOG3245106 consensus 99.59
>COG5508 Uncharacterized conserved small protein [Function unknown] Back     alignment and domain information
>pfam07896 DUF1674 Protein of unknown function (DUF1674) Back     alignment and domain information
>KOG3245 consensus Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target75 hypothetical protein CLIBASIA_01465 [Candidatus Liberib
2k5k_A70 Solution Structure Of Rhr2 From Rhodobacter Sphaero 4e-05
>gi|197304917|pdb|2K5K|A Chain A, Solution Structure Of Rhr2 From Rhodobacter Sphaeroides. Northeast Structural Genomics Consortium Length = 70 Back     alignment and structure
 Score = 51.2 bits (121), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 22/32 (68%), Positives = 24/32 (75%)

Query: 44 KDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF 75
          K   LP EIGGR G +P RFGDWEK GI+IDF
Sbjct: 31 KALDLPKEIGGRNGPEPVRFGDWEKKGIAIDF 62


Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target75 hypothetical protein CLIBASIA_01465 [Candidatus Liberib
2k5k_A70 Uncharacterized protein RHR2; structural genomics, PSI- 2e-16
>2k5k_A Uncharacterized protein RHR2; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Rhodobacter sphaeroides 2} Length = 70 Back     alignment and structure
 Score = 79.6 bits (196), Expect = 2e-16
 Identities = 32/64 (50%), Positives = 40/64 (62%), Gaps = 2/64 (3%)

Query: 12 MNNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGI 71
          M + T + +   L   A RAL EA++R+    K   LP EIGGR G +P RFGDWEK GI
Sbjct: 1  MRDMT-EETRKDLPPEALRALAEAEERRRRA-KALDLPKEIGGRNGPEPVRFGDWEKKGI 58

Query: 72 SIDF 75
          +IDF
Sbjct: 59 AIDF 62


Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target75 hypothetical protein CLIBASIA_01465 [Candidatus Liberib
2k5k_A70 Uncharacterized protein RHR2; structural genomics, PSI- 99.93
>2k5k_A Uncharacterized protein RHR2; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Rhodobacter sphaeroides 2} Back     alignment and structure
Probab=99.93  E-value=1e-27  Score=164.54  Aligned_cols=62  Identities=52%  Similarity=0.883  Sum_probs=53.8

Q ss_pred             HCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCHHCCCCCCCCCCCCCCHHCCCEECCC
Q ss_conf             0046555754458999999999999974122122106510188889986433610007865149
Q gi|254780408|r   12 MNNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF   75 (75)
Q Consensus        12 m~~~~~~~~~~~ls~aA~rAL~Ea~~rr~~~~~~~~~pkE~gG~~G~ePtRyGDWE~kG~~~DF   75 (75)
                      |+|.+ +...++||++|+|||+||++||+. .....+|+|+|||+|||||||||||+|||||||
T Consensus         1 m~d~t-~~~~k~l~paA~rAL~EA~~rr~~-~~~~~~p~E~gG~~GpEPTRyGDWE~kG~~~DF   62 (70)
T 2k5k_A            1 MRDMT-EETRKDLPPEALRALAEAEERRRR-AKALDLPKEIGGRNGPEPVRFGDWEKKGIAIDF   62 (70)
T ss_dssp             CCSCC-CSCCCSCCTHHHHHHHHHHTCCTT-TTTCCCCCCSCCCCCCCCCSCCCCCCCSTTCCC
T ss_pred             CCCCC-CCCCCCCCHHHHHHHHHHHHHHHH-HHCCCCCCCCCCCCCCCCCCCCCHHHCCEEEEH
T ss_conf             97655-465677999999999999999873-201337723389999998655630107776304




Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 75 hypothetical protein CLIBASIA_01465 [Candidatus Li
2k5k_A_70 (A:) Uncharacterized protein RHR2; structural geno 8e-17
>2k5k_A (A:) Uncharacterized protein RHR2; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Rhodobacter sphaeroides 2}Length = 70 Back     alignment and structure
 Score = 80.3 bits (198), Expect = 8e-17
 Identities = 30/64 (46%), Positives = 38/64 (59%), Gaps = 2/64 (3%)

Query: 12 MNNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGI 71
          M + T + +   L   A RAL EA++R+         P EIGGR G +P RFGDWEK GI
Sbjct: 1  MRDMT-EETRKDLPPEALRALAEAEERRRRAKALDL-PKEIGGRNGPEPVRFGDWEKKGI 58

Query: 72 SIDF 75
          +IDF
Sbjct: 59 AIDF 62


Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target75 hypothetical protein CLIBASIA_01465 [Candidatus Liberib
2k5k_A_70 Uncharacterized protein RHR2; structural genomics, 99.91
>2k5k_A (A:) Uncharacterized protein RHR2; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Rhodobacter sphaeroides 2} Back     alignment and structure
Probab=99.91  E-value=1.6e-25  Score=153.95  Aligned_cols=62  Identities=48%  Similarity=0.854  Sum_probs=54.8

Q ss_pred             HCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCHHCCCCCCCCCCCCCCHHCCCEECCC
Q ss_conf             0046555754458999999999999974122122106510188889986433610007865149
Q gi|254780408|r   12 MNNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGISIDF   75 (75)
Q Consensus        12 m~~~~~~~~~~~ls~aA~rAL~Ea~~rr~~~~~~~~~pkE~gG~~G~ePtRyGDWE~kG~~~DF   75 (75)
                      |+++ .+++.++|+++|+|||+||++|+.+.. ...+|+|+|||+|||||||||||+|||||||
T Consensus         1 m~~~-~~~~~~~l~~aA~ral~Ea~~rr~~~~-~~~~~~E~GG~~G~EPtRyGDWE~kGr~~DF   62 (70)
T 2k5k_A            1 MRDM-TEETRKDLPPEALRALAEAEERRRRAK-ALDLPKEIGGRNGPEPVRFGDWEKKGIAIDF   62 (70)
T ss_dssp             CCSC-CCSCCCSCCTHHHHHHHHHHTCCTTTT-TCCCCCCSCCCCCCCCCSCCCCCCCSTTCCC
T ss_pred             CCCC-CCCCCCCCCHHHHHHHHHHHHHHHHHH-HCCCCCCCCCCCCCCCCCCCCHHHCCEEEEH
T ss_conf             9876-656667799999999999999886122-0237722389999998655631117876404