254780409

254780409

ribose-phosphate pyrophosphokinase

GeneID in NCBI database:8209394Locus tag:CLIBASIA_01470
Protein GI in NCBI database:254780409Protein Accession:YP_003064822.1
Gene range:-(310019, 310951)Protein Length:310aa
Gene description:ribose-phosphate pyrophosphokinase
COG prediction:[F] [E] Phosphoribosylpyrophosphate synthetase
KEGG prediction:ribose-phosphate pyrophosphokinase (EC:2.7.6.1); K00948 ribose-phosphate pyrophosphokinase [EC:2.7.6.1]
SEED prediction:Ribose-phosphate pyrophosphokinase (EC 2.7.6.1)
Pathway involved in KEGG:Pentose phosphate pathway [PATH:las00030]
Purine metabolism [PATH:las00230]
Subsystem involved in SEED:De Novo Purine Biosynthesis;
Pentose phosphate pathway
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310
MKIFAGNSNRNLAQEICDYLHTSLGKASVTYFSDREVFVEIGENVRGEDVFIVQSTSCPANDYLMELLIMIDAVRRSSARRITGVIPYFGYCRQDRKPSPRTPISAKLVANLITQAGADRVIMLDLHAGQVQGFFDIPTDNLYALPILERDIKERNDISNLMVVSPDVGGVVRARALAKRLGCLLAIVDKRREHPGKIEVMNIIGKVEGKDCILIDDIVDTGGTLCGAADALYEQGALSVTAYITHGVLSSSSIERIEKSKMKELVITDSIQPTDLVKSSAKIRILTIAQLMGEAINRTFEERSISSLFD
cEEEEccccHHHHHHHHHHHccccEEEEEEEcccccEEEEEcccccccEEEEEcccccccHHHHHHHHHHHHHHHHccccEEEEEcccccccccccccccccccHHHHHHHHHHHccccEEEEEEcccHHHccHHcccHHHcccHHHHHHHHHHHccccccEEEEccccHHHHHHHHHHHHcccEEEEEEEcccccccccccccccccccEEEEEccccccHHHHHHHHHHHHHccccEEEEEEEEccccHHHHHHHHcccccEEEEEccccccHHHHccccEEEEEHHHHHHHHHHHHccccccHHHcc
ccEEcccccHHHHHHHHHHHccccccEEEEEEcccEEEEEEEEccccccEEEEEccccccccHHHHHHHHHHHHHHHcHcccEEEEccccHHHHHcccccccHHHHHHHHHHHHHccccEEEEEEccHHHHcccccccccccccHHHHHHHHHHcccccccEEEcccccHHHHHHHHHHHccccEEEEEcccccccHHHEEEEEccccccEEEEEccccccHHHHHHHHHHHHHccccEEEEEEcccccccHHHHHHHcccccEEEEEccccccHHHHccccEEEEEHHHHHHHHHHHHcccccHHHHcc
mkifagnsnRNLAQEICDYLHTslgkasvtyfSDREVFVEIgenvrgedVFIVQstscpandYLMELLIMIDAVRRSSarritgvipyfgycrqdrkpsprtpiSAKLVANLITQAGADRVIMLDLhagqvqgffdiptdnlyalpilerdikerndisnlmvvspdVGGVVRARALAKRLGCLLAIVDKrrehpgkieVMNIIgkvegkdciliDDIVDTGGTLCGAADALYEQGALSVTAYITHGVLSSSSIERIEKSKMKelvitdsiqptdlvksSAKIRILTIAQLMGEAINRTFEERSISSLFD
mkifagnsnrNLAQEICDYLHTSLGKASVTYFSDREVFVEIGenvrgedvFIVQSTSCPANDYLMELLIMIDAVRRSSARRITGvipyfgycrqdrkpsprtpISAKLVANLITQAGADRVIMLDLHAGQVQGFFDIPTDNLYALPILERDIKERNDISNLMVVSPDVGGVVRARALAKRLGCLLAivdkrrehpgkievmniigkvegkDCILIDDIVDTGGTLCGAADALYEQGALSVTAYITHGVLSSSSIERIEKSKMKelvitdsiqptdlvkssaKIRILTIAQLMGEainrtfeersisslfd
MKIFAGNSNRNLAQEICDYLHTSLGKASVTYFSDREVFVEIGENVRGEDVFIVQSTSCPANDYLMELLIMIDAVRRSSARRITGVIPYFGYCRQDRKPSPRTPISAKLVANLITQAGADRVIMLDLHAGQVQGFFDIPTDNLYALPILERDIKERNDISNLMVVSPDVGGVVRARALAKRLGCLLAIVDKRREHPGKIEVMNIIGKVEGKDCILIDDIVDTGGTLCGAADALYEQGALSVTAYITHGVLssssieriekskmkeLVITDSIQPTDLVKSSAKIRILTIAQLMGEAINRTFEERSISSLFD
MKIFAGNSNRNLAQEICDYLHTSLGKASVTYFSDREVFVEIGENVRGEDVFIVQSTSCPANDYLMELLIMIDAVRRSSARRITGVIPYFGYCRQDRKPSPRTPISAKLVANLITQAGADRVIMLDLHAGQVQGFFDIPTDNLYALPILERDIKERNDISNLMVVSPDVGGVVRARALAKRLGCLLAIVDKRREHPGKIEVMNIIGKVEGKDCILIDDIVDTGGTLCGAADALYEQGALSVTAYITHGVLSSSSIERIEKSKMKELVITDSIQPTDLVKSSAKIRILTIAQLMGEAINRTFEERSISSLFD
MKIFAGNSNRNLAQEICDYLHTSLGKASVTYFSDREVFVEIGENVRGEDVFIVQSTSCPANDYLMELLIMIDAVRRSSARRITGVIPYFGYCRQDRKPSPRTPISAKLVANLITQAGADRVIMLDLHAGQVQGFFDIPTDNLYALPILERDIKERNDISNLMVVSPDVGGVVRARALAKRLGCLLAIVDKRREHPGKIEVMNIIGKVEGKDCILIDDIVDTGGTLCGAADALYEQGALSVTAYITHGVLSSSSIERIEKSKMKELVITDSIQPTDLVKSSAKIRILTIAQLMGEAINRTFEE********
MKIFAGNSNRNLAQEICDYLHTSLGKASVTYFSDREVFVEIGENVRGEDVFIVQSTSCPANDYLMELLIMIDAVRRSSARRITGVIPYFGYCRQDRKPSPRTPISAKLVANLITQAGADRVIMLDLHAGQVQGFFDIPTDNLYALPILERDIKERNDISNLMVVSPDVGGVVRARALAKRLGCLLAIVDKRREHPGKIEVMNIIGKVEGKDCILIDDIVDTGGTLCGAADALYEQGALSVTAYITHGVLSSSSIERIEKSKMKELVITDSIQPTDLVKSSAKIRILTIAQLMGEAINRTFEERSI*S*FD
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKIFAGNSNRNLAQEICDYLHTSLGKASVTYFSDREVFVEIGENVRGEDVFIVQSTSCPANDYLMELLIMIDAVRRSSARRITGVIPYFGYCRQDRKPSPRTPISAKLVANLITQAGADRVIMLDLHAGQVQGFFDIPTDNLYALPILERDIKERNDISNLMVVSPDVGGVVRARALAKRLGCLLAIVDKRREHPGKIEVMNIIGKVEGKDCILIDDIVDTGGTLCGAADALYEQGALSVTAYITHGVLSSSSIERIEKSKMKELVITDSIQPTDLVKSSAKIRILTIAQLMGEAINRTFEERSISSLFD
MKIFAGNSNRNLAQEICDYLHTSLGKASVTYFSDREVFVEIGENVRGEDVFIVQSTSCPANDYLMELLIMIDAVRRSSARRITGVIPYFGYCRQDRKPSPRTPISAKLVANLITQAGADRVIMLDLHAGQVQGFFDIPTDNLYALPILERDIKERNDISNLMVVSPDVGGVVRARALAKRLGCLLAIVDKRREHPGKIEVMNIIGKVEGKDCILIDDIVDTGGTLCGAADALYEQGALSVTAYITHGVLSSSSIERIEKSKMKELVITDSIQPTDLVKSSAKIRILTIAQLMGEAINRTFEERSISSLFD
MKIFAGNSNRNLAQEICDYLHTSLGKASVTYFSDREVFVEIGENVRGEDVFIVQSTSCPANDYLMELLIMIDAVRRSSARRITGVIPYFGYCRQDRKPSPRTPISAKLVANLITQAGADRVIMLDLHAGQVQGFFDIPTDNLYALPILERDIKERNDISNLMVVSPDVGGVVRARALAKRLGCLLAIVDKRREHPGKIEVMNIIGKVEGKDCILIDDIVDTGGTLCGAADALYEQGALSVTAYITHGVLSSSSIERIEKSKMKELVITDSIQPTDLVKSSAKIRILTIAQLMGEAINRTFEERSISSLFD

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target310 ribose-phosphate pyrophosphokinase [Candidatus Liberiba
315122148310 ribose-phosphate pyrophosphokinase [Candidatus Liberiba 1 1e-159
15966101310 ribose-phosphate pyrophosphokinase [Sinorhizobium melil 1 1e-137
150397457310 ribose-phosphate pyrophosphokinase [Sinorhizobium medic 1 1e-137
222086591310 ribose-phosphate pyrophosphokinase protein [Agrobacteri 1 1e-136
227822837335 ribose-phosphate pyrophosphokinase [Sinorhizobium fredi 1 1e-135
190892765310 ribose-phosphate pyrophosphokinase [Rhizobium etli CIAT 1 1e-135
222149330310 ribose-phosphate pyrophosphokinase [Agrobacterium vitis 1 1e-135
218663003310 ribose-phosphate pyrophosphokinase [Rhizobium etli IE47 1 1e-135
218463853310 ribose-phosphate pyrophosphokinase [Rhizobium etli Kim 1 1e-135
218675422310 ribose-phosphate pyrophosphokinase [Rhizobium etli GR56 1 1e-134
>gi|315122148|ref|YP_004062637.1| ribose-phosphate pyrophosphokinase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 310 Back     alignment and organism information
 Score =  565 bits (1455), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 274/310 (88%), Positives = 295/310 (95%)

Query: 1   MKIFAGNSNRNLAQEICDYLHTSLGKASVTYFSDREVFVEIGENVRGEDVFIVQSTSCPA 60
           MKIFAGNSN+ LA++ICDYL  SLGKA+VTYFSDREVFVEIGENVRGEDVFIVQSTSCPA
Sbjct: 1   MKIFAGNSNKRLAEDICDYLGISLGKAAVTYFSDREVFVEIGENVRGEDVFIVQSTSCPA 60

Query: 61  NDYLMELLIMIDAVRRSSARRITGVIPYFGYCRQDRKPSPRTPISAKLVANLITQAGADR 120
           ND+LMELLIMIDA RRSSA RITGVIPYFGYCRQDRKPSPRTPISAKLVANLITQAGADR
Sbjct: 61  NDHLMELLIMIDAARRSSAGRITGVIPYFGYCRQDRKPSPRTPISAKLVANLITQAGADR 120

Query: 121 VIMLDLHAGQVQGFFDIPTDNLYALPILERDIKERNDISNLMVVSPDVGGVVRARALAKR 180
           V+MLDLHAGQVQGFFDIPTDNLYAL ILER IKE +DI+NLMVVSPDVGGVVRARALAKR
Sbjct: 121 VMMLDLHAGQVQGFFDIPTDNLYALRILERHIKECHDIANLMVVSPDVGGVVRARALAKR 180

Query: 181 LGCLLAIVDKRREHPGKIEVMNIIGKVEGKDCILIDDIVDTGGTLCGAADALYEQGALSV 240
           LGCLLAIVDKRREHPG+IE MN+IGKV GKDCILIDDIVDTGGTLCGAADALYEQGA SV
Sbjct: 181 LGCLLAIVDKRREHPGQIEAMNVIGKVRGKDCILIDDIVDTGGTLCGAADALYEQGASSV 240

Query: 241 TAYITHGVLSSSSIERIEKSKMKELVITDSIQPTDLVKSSAKIRILTIAQLMGEAINRTF 300
            AYITHGVLS S+I+RIE SK+KEL+ITDSIQPTDLVKSS +IR+LTIAQL+GEAI+RTF
Sbjct: 241 AAYITHGVLSGSAIKRIESSKLKELIITDSIQPTDLVKSSPRIRVLTIAQLLGEAISRTF 300

Query: 301 EERSISSLFD 310
           +E+SISSLF+
Sbjct: 301 QEQSISSLFN 310


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|15966101|ref|NP_386454.1| ribose-phosphate pyrophosphokinase [Sinorhizobium meliloti 1021] Length = 310 Back     alignment and organism information
>gi|150397457|ref|YP_001327924.1| ribose-phosphate pyrophosphokinase [Sinorhizobium medicae WSM419] Length = 310 Back     alignment and organism information
>gi|222086591|ref|YP_002545125.1| ribose-phosphate pyrophosphokinase protein [Agrobacterium radiobacter K84] Length = 310 Back     alignment and organism information
>gi|227822837|ref|YP_002826809.1| ribose-phosphate pyrophosphokinase [Sinorhizobium fredii NGR234] Length = 335 Back     alignment and organism information
>gi|190892765|ref|YP_001979307.1| ribose-phosphate pyrophosphokinase [Rhizobium etli CIAT 652] Length = 310 Back     alignment and organism information
>gi|222149330|ref|YP_002550287.1| ribose-phosphate pyrophosphokinase [Agrobacterium vitis S4] Length = 310 Back     alignment and organism information
>gi|218663003|ref|ZP_03518933.1| ribose-phosphate pyrophosphokinase [Rhizobium etli IE4771] Length = 310 Back     alignment and organism information
>gi|218463853|ref|ZP_03503944.1| ribose-phosphate pyrophosphokinase [Rhizobium etli Kim 5] Length = 310 Back     alignment and organism information
>gi|218675422|ref|ZP_03525091.1| ribose-phosphate pyrophosphokinase [Rhizobium etli GR56] Length = 310 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target310 ribose-phosphate pyrophosphokinase [Candidatus Liberiba
PRK01259309 PRK01259, PRK01259, ribose-phosphate pyrophosphokinase; 1e-160
TIGR01251308 TIGR01251, ribP_PPkin, ribose-phosphate pyrophosphokina 1e-105
PRK04923319 PRK04923, PRK04923, ribose-phosphate pyrophosphokinase; 1e-104
PLN02369302 PLN02369, PLN02369, ribose-phosphate pyrophosphokinase 1e-103
PRK02812330 PRK02812, PRK02812, ribose-phosphate pyrophosphokinase; 7e-96
PRK02269320 PRK02269, PRK02269, ribose-phosphate pyrophosphokinase; 6e-95
PRK03092304 PRK03092, PRK03092, ribose-phosphate pyrophosphokinase; 1e-89
KOG1448316 KOG1448, KOG1448, KOG1448, Ribose-phosphate pyrophospho 8e-88
PTZ00145439 PTZ00145, PTZ00145, phosphoribosylpyrophosphate synthet 5e-86
PRK02458323 PRK02458, PRK02458, ribose-phosphate pyrophosphokinase; 7e-86
PRK00553332 PRK00553, PRK00553, ribose-phosphate pyrophosphokinase; 1e-72
KOG1503354 KOG1503, KOG1503, KOG1503, Phosphoribosylpyrophosphate 4e-54
PRK00934285 PRK00934, PRK00934, ribose-phosphate pyrophosphokinase; 8e-54
PRK06827382 PRK06827, PRK06827, phosphoribosylpyrophosphate synthet 1e-29
COG0462314 COG0462, PrsA, Phosphoribosylpyrophosphate synthetase [ 1e-115
PRK07199301 PRK07199, PRK07199, phosphoribosylpyrophosphate synthet 6e-27
PLN02297326 PLN02297, PLN02297, ribose-phosphate pyrophosphokinase 3e-17
pfam00156123 pfam00156, Pribosyltran, Phosphoribosyl transferase dom 1e-11
COG1040225 COG1040, ComFC, Predicted amidophosphoribosyltransferas 2e-05
COG0503179 COG0503, Apt, Adenine/guanine phosphoribosyltransferase 3e-05
PRK02277200 PRK02277, PRK02277, orotate phosphoribosyltransferase-l 2e-04
COG0461201 COG0461, PyrE, Orotate phosphoribosyltransferase [Nucle 3e-04
COG0856203 COG0856, COG0856, Orotate phosphoribosyltransferase hom 3e-04
PRK07322178 PRK07322, PRK07322, adenine phosphoribosyltransferase; 0.001
COG0634178 COG0634, Hpt, Hypoxanthine-guanine phosphoribosyltransf 0.002
PRK00455202 PRK00455, pyrE, orotate phosphoribosyltransferase; Vali 0.002
PLN02238189 PLN02238, PLN02238, hypoxanthine phosphoribosyltransfer 1e-04
TIGR00201190 TIGR00201, comF, comF family protein 9e-04
>gnl|CDD|179265 PRK01259, PRK01259, ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>gnl|CDD|130318 TIGR01251, ribP_PPkin, ribose-phosphate pyrophosphokinase Back     alignment and domain information
>gnl|CDD|179893 PRK04923, PRK04923, ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>gnl|CDD|177997 PLN02369, PLN02369, ribose-phosphate pyrophosphokinase Back     alignment and domain information
>gnl|CDD|179476 PRK02812, PRK02812, ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>gnl|CDD|167353 PRK02269, PRK02269, ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>gnl|CDD|179535 PRK03092, PRK03092, ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>gnl|CDD|36661 KOG1448, KOG1448, KOG1448, Ribose-phosphate pyrophosphokinase [Nucleotide transport and metabolism, Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|185478 PTZ00145, PTZ00145, phosphoribosylpyrophosphate synthetase; Provisional Back     alignment and domain information
>gnl|CDD|179425 PRK02458, PRK02458, ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>gnl|CDD|179062 PRK00553, PRK00553, ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>gnl|CDD|36716 KOG1503, KOG1503, KOG1503, Phosphoribosylpyrophosphate synthetase-associated protein [Amino acid transport and metabolism, Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|179172 PRK00934, PRK00934, ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>gnl|CDD|180714 PRK06827, PRK06827, phosphoribosylpyrophosphate synthetase; Provisional Back     alignment and domain information
>gnl|CDD|30810 COG0462, PrsA, Phosphoribosylpyrophosphate synthetase [Nucleotide transport and metabolism / Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|180877 PRK07199, PRK07199, phosphoribosylpyrophosphate synthetase; Provisional Back     alignment and domain information
>gnl|CDD|177934 PLN02297, PLN02297, ribose-phosphate pyrophosphokinase Back     alignment and domain information
>gnl|CDD|143924 pfam00156, Pribosyltran, Phosphoribosyl transferase domain Back     alignment and domain information
>gnl|CDD|31242 COG1040, ComFC, Predicted amidophosphoribosyltransferases [General function prediction only] Back     alignment and domain information
>gnl|CDD|30849 COG0503, Apt, Adenine/guanine phosphoribosyltransferases and related PRPP-binding proteins [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|179404 PRK02277, PRK02277, orotate phosphoribosyltransferase-like protein; Provisional Back     alignment and domain information
>gnl|CDD|30809 COG0461, PyrE, Orotate phosphoribosyltransferase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|31197 COG0856, COG0856, Orotate phosphoribosyltransferase homologs [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|180928 PRK07322, PRK07322, adenine phosphoribosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|30979 COG0634, Hpt, Hypoxanthine-guanine phosphoribosyltransferase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|179036 PRK00455, pyrE, orotate phosphoribosyltransferase; Validated Back     alignment and domain information
>gnl|CDD|177882 PLN02238, PLN02238, hypoxanthine phosphoribosyltransferase Back     alignment and domain information
>gnl|CDD|161762 TIGR00201, comF, comF family protein Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 310 ribose-phosphate pyrophosphokinase [Candidatus Liberiba
PTZ00145443 phosphoribosylpyrophosphate synthetase; Provisional 100.0
PRK05259310 consensus 100.0
PRK02812331 ribose-phosphate pyrophosphokinase; Provisional 100.0
PRK01259309 ribose-phosphate pyrophosphokinase; Provisional 100.0
PRK00553340 ribose-phosphate pyrophosphokinase; Provisional 100.0
PRK04554327 consensus 100.0
PRK02039316 consensus 100.0
PRK02270327 consensus 100.0
PRK01506317 consensus 100.0
COG0462314 PrsA Phosphoribosylpyrophosphate synthetase [Nucleotide 100.0
PRK05038315 consensus 100.0
PRK02269321 ribose-phosphate pyrophosphokinase; Provisional 100.0
PRK04923319 ribose-phosphate pyrophosphokinase; Provisional 100.0
PRK04117309 consensus 100.0
PRK01999311 consensus 100.0
PRK02458323 ribose-phosphate pyrophosphokinase; Provisional 100.0
PRK03092304 ribose-phosphate pyrophosphokinase; Provisional 100.0
PRK07199301 phosphoribosylpyrophosphate synthetase; Provisional 100.0
PRK00934286 ribose-phosphate pyrophosphokinase; Provisional 100.0
PRK06827381 phosphoribosylpyrophosphate synthetase; Provisional 100.0
PRK01132286 consensus 100.0
PRK03675279 consensus 100.0
KOG1448316 consensus 100.0
KOG1503354 consensus 100.0
TIGR01251316 ribP_PPkin ribose-phosphate pyrophosphokinase; InterPro 100.0
pfam00156123 Pribosyltran Phosphoribosyl transferase domain. This fa 99.35
PRK02277201 orotate phosphoribosyltransferase-like protein; Provisi 99.26
COG0634178 Hpt Hypoxanthine-guanine phosphoribosyltransferase [Nuc 99.21
PRK09162181 hypoxanthine-guanine phosphoribosyltransferase; Provisi 99.18
COG0856203 Orotate phosphoribosyltransferase homologs [Nucleotide 99.15
PRK05500478 bifunctional orotidine 5'-phosphate decarboxylase/orota 99.07
COG0461201 PyrE Orotate phosphoribosyltransferase [Nucleotide tran 99.02
PTZ00271211 hypoxanthine-guanine phosphoribosyltransferase; Provisi 99.01
PRK07322178 adenine phosphoribosyltransferase; Provisional 99.01
TIGR01090175 apt adenine phosphoribosyltransferase; InterPro: IPR005 98.98
PRK02304174 adenine phosphoribosyltransferase; Provisional 98.98
PRK12560184 adenine phosphoribosyltransferase; Provisional 98.96
COG0503179 Apt Adenine/guanine phosphoribosyltransferases and rela 98.95
TIGR00336187 pyrE orotate phosphoribosyltransferase; InterPro: IPR00 98.93
PTZ00149231 hypoxanthine phosphoribosyltransferase; Provisional 98.88
TIGR01203183 HGPRTase hypoxanthine phosphoribosyltransferase; InterP 98.84
PRK05205176 bifunctional pyrimidine regulatory protein PyrR uracil 98.78
KOG1712183 consensus 98.7
PRK08558238 adenine phosphoribosyltransferase; Provisional 98.65
PRK09219189 xanthine phosphoribosyltransferase; Validated 98.59
PRK06031233 phosphoribosyltransferase; Provisional 98.46
COG2236192 Predicted phosphoribosyltransferases [General function 98.33
COG2065179 PyrR Pyrimidine operon attenuation protein/uracil phosp 98.23
TIGR01091213 upp uracil phosphoribosyltransferase; InterPro: IPR0057 98.22
KOG3367216 consensus 98.2
PRK09177156 xanthine-guanine phosphoribosyltransferase; Validated 97.81
PRK09213274 purine operon repressor; Provisional 97.57
TIGR01743269 purR_Bsub pur operon repressor; InterPro: IPR010078 Thi 97.37
TIGR01744191 XPRTase xanthine phosphoribosyltransferase; InterPro: I 95.98
COG1926220 Predicted phosphoribosyltransferases [General function 99.31
PRK06388474 amidophosphoribosyltransferase; Provisional 98.72
PRK09246503 amidophosphoribosyltransferase; Provisional 98.69
PRK08341442 amidophosphoribosyltransferase; Provisional 98.67
PRK09123480 amidophosphoribosyltransferase; Provisional 98.64
PRK08525445 amidophosphoribosyltransferase; Provisional 98.63
PRK07631475 amidophosphoribosyltransferase; Provisional 98.6
PRK07349495 amidophosphoribosyltransferase; Provisional 98.58
PRK07272484 amidophosphoribosyltransferase; Provisional 98.56
PRK07847489 amidophosphoribosyltransferase; Provisional 98.55
PRK05793472 amidophosphoribosyltransferase; Provisional 98.46
KOG0572474 consensus 98.35
PRK00129208 upp uracil phosphoribosyltransferase; Reviewed 98.29
TIGR01134467 purF amidophosphoribosyltransferase; InterPro: IPR00585 98.02
COG0035210 Upp Uracil phosphoribosyltransferase [Nucleotide transp 97.81
PRK13809206 orotate phosphoribosyltransferase; Provisional 99.2
PRK13811170 orotate phosphoribosyltransferase; Provisional 99.15
PRK13812174 orotate phosphoribosyltransferase; Provisional 99.14
PRK13810187 orotate phosphoribosyltransferase; Provisional 99.12
PRK00455200 pyrE orotate phosphoribosyltransferase; Validated 98.99
TIGR01367205 pyrE_Therm orotate phosphoribosyltransferase; InterPro: 98.69
COG1040225 ComFC Predicted amidophosphoribosyltransferases [Genera 98.44
COG0034470 PurF Glutamine phosphoribosylpyrophosphate amidotransfe 98.81
PRK06781471 amidophosphoribosyltransferase; Provisional 98.62
PRK02269 321 ribose-phosphate pyrophosphokinase; Provisional 98.29
PRK01259 309 ribose-phosphate pyrophosphokinase; Provisional 98.21
PRK01999 311 consensus 98.2
PRK04117 309 consensus 98.17
PRK02270 327 consensus 98.15
PRK02458 323 ribose-phosphate pyrophosphokinase; Provisional 98.15
PRK04923 319 ribose-phosphate pyrophosphokinase; Provisional 98.13
PRK00934 286 ribose-phosphate pyrophosphokinase; Provisional 98.1
PRK01506 317 consensus 98.1
PRK04554 327 consensus 98.09
PRK02812 331 ribose-phosphate pyrophosphokinase; Provisional 98.07
PRK02039 316 consensus 98.04
PRK07199 301 phosphoribosylpyrophosphate synthetase; Provisional 98.02
PRK05038 315 consensus 98.0
PRK00553 340 ribose-phosphate pyrophosphokinase; Provisional 97.98
COG0462 314 PrsA Phosphoribosylpyrophosphate synthetase [Nucleotide 97.85
PRK01132 286 consensus 97.8
PRK11595227 gluconate periplasmic binding protein; Provisional 98.76
PRK03092304 ribose-phosphate pyrophosphokinase; Provisional 98.05
PRK05259310 consensus 98.03
PRK06827381 phosphoribosylpyrophosphate synthetase; Provisional 96.63
TIGR00201207 comF comF family protein; InterPro: IPR005222 Proteins 98.04
PTZ00145 443 phosphoribosylpyrophosphate synthetase; Provisional 97.52
KOG1017267 consensus 94.18
PRK11595227 gluconate periplasmic binding protein; Provisional 90.31
>PTZ00145 phosphoribosylpyrophosphate synthetase; Provisional Back     alignment and domain information
>PRK05259 consensus Back     alignment and domain information
>PRK02812 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>PRK01259 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>PRK00553 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>PRK04554 consensus Back     alignment and domain information
>PRK02039 consensus Back     alignment and domain information
>PRK02270 consensus Back     alignment and domain information
>PRK01506 consensus Back     alignment and domain information
>COG0462 PrsA Phosphoribosylpyrophosphate synthetase [Nucleotide transport and metabolism / Amino acid transport and metabolism] Back     alignment and domain information
>PRK05038 consensus Back     alignment and domain information
>PRK02269 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>PRK04923 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>PRK04117 consensus Back     alignment and domain information
>PRK01999 consensus Back     alignment and domain information
>PRK02458 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>PRK03092 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>PRK07199 phosphoribosylpyrophosphate synthetase; Provisional Back     alignment and domain information
>PRK00934 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>PRK06827 phosphoribosylpyrophosphate synthetase; Provisional Back     alignment and domain information
>PRK01132 consensus Back     alignment and domain information
>PRK03675 consensus Back     alignment and domain information
>KOG1448 consensus Back     alignment and domain information
>KOG1503 consensus Back     alignment and domain information
>TIGR01251 ribP_PPkin ribose-phosphate pyrophosphokinase; InterPro: IPR005946 Synonyms: phosphoribosylpyrophosphate synthetase Phosphoribosyldiphosphate synthetase (PRPPsase, 2 Back     alignment and domain information
>pfam00156 Pribosyltran Phosphoribosyl transferase domain Back     alignment and domain information
>PRK02277 orotate phosphoribosyltransferase-like protein; Provisional Back     alignment and domain information
>COG0634 Hpt Hypoxanthine-guanine phosphoribosyltransferase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK09162 hypoxanthine-guanine phosphoribosyltransferase; Provisional Back     alignment and domain information
>COG0856 Orotate phosphoribosyltransferase homologs [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK05500 bifunctional orotidine 5'-phosphate decarboxylase/orotate phosphoribosyltransferase protein; Validated Back     alignment and domain information
>COG0461 PyrE Orotate phosphoribosyltransferase [Nucleotide transport and metabolism] Back     alignment and domain information
>PTZ00271 hypoxanthine-guanine phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK07322 adenine phosphoribosyltransferase; Provisional Back     alignment and domain information
>TIGR01090 apt adenine phosphoribosyltransferase; InterPro: IPR005764 Adenine phosphoribosyltransferase (APRTase, 2 Back     alignment and domain information
>PRK02304 adenine phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK12560 adenine phosphoribosyltransferase; Provisional Back     alignment and domain information
>COG0503 Apt Adenine/guanine phosphoribosyltransferases and related PRPP-binding proteins [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR00336 pyrE orotate phosphoribosyltransferase; InterPro: IPR004467 Orotate phosphoribosyl transferase (OPRTase) is involved in the biosynthesis of pyrimidine nucleotides Back     alignment and domain information
>PTZ00149 hypoxanthine phosphoribosyltransferase; Provisional Back     alignment and domain information
>TIGR01203 HGPRTase hypoxanthine phosphoribosyltransferase; InterPro: IPR005904 Phosphoribosyltransferases (PRT) are enzymes that catalyze the synthesis of beta-n-5'-monophosphates from phosphoribosylpyrophosphate (PRPP) and an enzyme specific amine Back     alignment and domain information
>PRK05205 bifunctional pyrimidine regulatory protein PyrR uracil phosphoribosyltransferase; Provisional Back     alignment and domain information
>KOG1712 consensus Back     alignment and domain information
>PRK08558 adenine phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK09219 xanthine phosphoribosyltransferase; Validated Back     alignment and domain information
>PRK06031 phosphoribosyltransferase; Provisional Back     alignment and domain information
>COG2236 Predicted phosphoribosyltransferases [General function prediction only] Back     alignment and domain information
>COG2065 PyrR Pyrimidine operon attenuation protein/uracil phosphoribosyltransferase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR01091 upp uracil phosphoribosyltransferase; InterPro: IPR005765 The enzyme uracil phosphoribosyltransferase (UPRT, 2 Back     alignment and domain information
>KOG3367 consensus Back     alignment and domain information
>PRK09177 xanthine-guanine phosphoribosyltransferase; Validated Back     alignment and domain information
>PRK09213 purine operon repressor; Provisional Back     alignment and domain information
>TIGR01743 purR_Bsub pur operon repressor; InterPro: IPR010078 This entry represents the pur operon repressor PurR of low-GC Gram-positive bacteria Back     alignment and domain information
>TIGR01744 XPRTase xanthine phosphoribosyltransferase; InterPro: IPR010079 This entry represent a xanthine-specific phosphoribosyltransferase of Bacillus subtilis and closely related proteins from other species, mostly from other Gram-positive bacteria Back     alignment and domain information
>COG1926 Predicted phosphoribosyltransferases [General function prediction only] Back     alignment and domain information
>PRK06388 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK09246 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK08341 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK09123 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK08525 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK07631 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK07349 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK07272 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK07847 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK05793 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>KOG0572 consensus Back     alignment and domain information
>PRK00129 upp uracil phosphoribosyltransferase; Reviewed Back     alignment and domain information
>TIGR01134 purF amidophosphoribosyltransferase; InterPro: IPR005854 Purine nucleotides are synthesised both via the de novo pathway and via the salvage pathway and are vital for cell functions and cell proliferation through DNA and RNA syntheses and ATP energy supply Back     alignment and domain information
>COG0035 Upp Uracil phosphoribosyltransferase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK13809 orotate phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK13811 orotate phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK13812 orotate phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK13810 orotate phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK00455 pyrE orotate phosphoribosyltransferase; Validated Back     alignment and domain information
>TIGR01367 pyrE_Therm orotate phosphoribosyltransferase; InterPro: IPR006273 This group of sequences are a distinct clade of orotate phosphoribosyltransferases Back     alignment and domain information
>COG1040 ComFC Predicted amidophosphoribosyltransferases [General function prediction only] Back     alignment and domain information
>COG0034 PurF Glutamine phosphoribosylpyrophosphate amidotransferase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK06781 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK02269 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>PRK01259 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>PRK01999 consensus Back     alignment and domain information
>PRK04117 consensus Back     alignment and domain information
>PRK02270 consensus Back     alignment and domain information
>PRK02458 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>PRK04923 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>PRK00934 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>PRK01506 consensus Back     alignment and domain information
>PRK04554 consensus Back     alignment and domain information
>PRK02812 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>PRK02039 consensus Back     alignment and domain information
>PRK07199 phosphoribosylpyrophosphate synthetase; Provisional Back     alignment and domain information
>PRK05038 consensus Back     alignment and domain information
>PRK00553 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>COG0462 PrsA Phosphoribosylpyrophosphate synthetase [Nucleotide transport and metabolism / Amino acid transport and metabolism] Back     alignment and domain information
>PRK01132 consensus Back     alignment and domain information
>PRK11595 gluconate periplasmic binding protein; Provisional Back     alignment and domain information
>PRK03092 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>PRK05259 consensus Back     alignment and domain information
>PRK06827 phosphoribosylpyrophosphate synthetase; Provisional Back     alignment and domain information
>TIGR00201 comF comF family protein; InterPro: IPR005222 Proteins in this family are found in bacterial species which posses systems for natural transformation with exogenous DNA (eg Bacillus subtilis, Haemophilus influenzae), and also species without these systems (eg Escherichia coli) Back     alignment and domain information
>PTZ00145 phosphoribosylpyrophosphate synthetase; Provisional Back     alignment and domain information
>KOG1017 consensus Back     alignment and domain information
>PRK11595 gluconate periplasmic binding protein; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target310 ribose-phosphate pyrophosphokinase [Candidatus Liberiba
2h07_A326 Crystal Structure Of Human Phosphoribosyl Pyrophosp 4e-85
1dkr_A317 Crystal Structures Of Bacillus Subtilis Phosphoribo 4e-85
2h06_A326 Crystal Structure Of Human Phosphoribosyl Pyrophosp 4e-85
2h08_A326 Crystal Structure Of Human Phosphoribosyl Pyrophosp 2e-84
3dah_A319 2.3 A Crystal Structure Of Ribose-Phosphate Pyropho 9e-84
2ji4_A379 Human Phosphoribosylpyrophosphate Synthetase- Assoc 5e-62
2c4k_A370 Crystal Structure Of Human Phosphoribosylpyrophosph 2e-57
1u9y_A284 Crystal Structure Of Phosphoribosyl Diphosphate Syn 2e-42
3mbi_A287 Crystal Structure Of The Phosphoribosylpyrophosphat 3e-33
3lpn_A286 Crystal Structure Of The Phosphoribosylpyrophosphat 3e-33
>gi|118137849|pdb|2H07|A Chain A, Crystal Structure Of Human Phosphoribosyl Pyrophosphate Synthetase 1 Mutant S132a Length = 326 Back     alignment and structure
 Score =  319 bits (817), Expect = 4e-85,   Method: Composition-based stats.
 Identities = 148/310 (47%), Positives = 209/310 (67%), Gaps = 1/310 (0%)

Query: 1   MKIFAGNSNRNLAQEICDYLHTSLGKASVTYFSDREVFVEIGENVRGEDVFIVQSTSCPA 60
           +KIF+G+S+++L+Q+I D L   LGK     FS++E  VEIGE+VRGEDV+IVQS     
Sbjct: 4   IKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEI 63

Query: 61  NDYLMELLIMIDAVRRSSARRITGVIPYFGYCRQDRKPSPRTPISAKLVANLITQAGADR 120
           ND LMELLIMI+A + +SA R+T VIP F Y RQD+K   R PISAKLVAN+++ AGAD 
Sbjct: 64  NDNLMELLIMINACKIASASRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSVAGADH 123

Query: 121 VIMLDLHAGQVQGFFDIPTDNLYALPILERDIKERN-DISNLMVVSPDVGGVVRARALAK 179
           +I +DLHA Q+QGFFDIP DNLYA P + + I+E   +  N  +VSPD GG  R  ++A 
Sbjct: 124 IITMDLHAAQIQGFFDIPVDNLYAEPAVLKWIRENISEWRNCTIVSPDAGGAKRVTSIAD 183

Query: 180 RLGCLLAIVDKRREHPGKIEVMNIIGKVEGKDCILIDDIVDTGGTLCGAADALYEQGALS 239
           RL    A++ K R+   +++ M ++G V+ +  IL+DD+ DT GT+C AAD L   GA  
Sbjct: 184 RLNVDFALIHKERKKANEVDRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATR 243

Query: 240 VTAYITHGVLSSSSIERIEKSKMKELVITDSIQPTDLVKSSAKIRILTIAQLMGEAINRT 299
           V A +THG+ S  +I RI  +  + +V+T++I   D +K  +KI+++ I+ ++ EAI RT
Sbjct: 244 VYAILTHGIFSGPAISRINNACFEAVVVTNTIPQEDKMKHCSKIQVIDISMILAEAIRRT 303

Query: 300 FEERSISSLF 309
               S+S LF
Sbjct: 304 HNGESVSYLF 313


gi|7546199|pdb|1DKR|A Chain A, Crystal Structures Of Bacillus Subtilis Phosphoribosylpyrophosphate Synthetase: Molecular Basis Of Allosteric Inhibition And Activation. Length = 317 Back     alignment and structure
>gi|118137847|pdb|2H06|A Chain A, Crystal Structure Of Human Phosphoribosyl Pyrophosphate Synthetase 1 Length = 326 Back     alignment and structure
>gi|118137851|pdb|2H08|A Chain A, Crystal Structure Of Human Phosphoribosyl Pyrophosphate Synthetase 1 Mutant Y146m Length = 326 Back     alignment and structure
>gi|190016457|pdb|3DAH|A Chain A, 2.3 A Crystal Structure Of Ribose-Phosphate Pyrophosphokinase From Burkholderia Pseudomallei Length = 319 Back     alignment and structure
>gi|134104929|pdb|2JI4|A Chain A, Human Phosphoribosylpyrophosphate Synthetase- Associated Protein 41 (Pap41) Length = 379 Back     alignment and structure
>gi|82408252|pdb|2C4K|A Chain A, Crystal Structure Of Human Phosphoribosylpyrophosphate Synthetase-Associated Protein 39 (Pap39) Length = 370 Back     alignment and structure
gi|75765288|pdb|1U9Y|A Chain A, Crystal Structure Of Phosphoribosyl Diphosphate Synthase From Methanocaldococcus Jannaschii Length = 284 Back     alignment and structure
>gi|329666092|pdb|3MBI|A Chain A, Crystal Structure Of The Phosphoribosylpyrophosphate (Prpp) Synthetase From Thermoplasma Volcanium In Complex With Adp-Mg2+ And Ribose 5- Phosphate Length = 287 Back     alignment and structure
gi|322812383|pdb|3LPN|A Chain A, Crystal Structure Of The Phosphoribosylpyrophosphate (Prpp) Synthetase From Thermoplasma Volcanium In Complex With An Atp Analog (Ampcpp). Length = 286 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target310 ribose-phosphate pyrophosphokinase [Candidatus Liberiba
3dah_A319 Ribose-phosphate pyrophosphokinase; seattle structural 1e-113
1dku_A317 Protein (phosphoribosyl pyrophosphate synthetase); open 5e-94
2h06_A326 Ribose-phosphate pyrophosphokinase I; PRS1, PRPP synthe 3e-89
2ji4_A379 Phosphoribosyl pyrophosphate synthetase-associated prot 3e-86
1u9y_A284 RPPK;, ribose-phosphate pyrophosphokinase; PRPP synthas 3e-65
1wd5_A208 Hypothetical protein TT1426; structural genomics, riken 5e-12
1l1q_A186 Adenine phosphoribosyltransferase; aprtase, giardia lam 7e-07
1vch_A175 Phosphoribosyltransferase-related protein; structural g 1e-05
3dmp_A217 Uracil phosphoribosyltransferase; structural genomics, 6e-12
2wns_A205 Orotate phosphoribosyltransferase; alternative splicing 1e-10
1g2q_A187 Adenine phosphoribosyltransferase 1; dimer, single doma 1e-05
3hvu_A204 Hypoxanthine phosphoribosyltransferase; hypoxantine-gua 4e-05
1nul_A152 XPRT, xanthine-guanine phosphoribosyltransferase; purin 5e-05
3o7m_A186 Hypoxanthine phosphoribosyltransferase; hypoxanthine-gu 7e-05
1hgx_A183 HGXPRTASE, hypoxanthine-guanine-xanthine phosphoribosyl 1e-04
3m3h_A234 OPRT, oprtase, orotate phosphoribosyltransferase; pyrim 3e-04
1fsg_A233 HGPRTASE, hypoxanthine-guanine phosphoribosyltransferas 4e-04
3ohp_A177 Hypoxanthine phosphoribosyltransferase; structural geno 4e-04
1vdm_A153 Purine phosphoribosyltransferase; structural genomics, 9e-04
1j7j_A178 HPRT, hypoxanthine phosphoribosyltransferase; glycosylt 0.001
1lh0_A213 OMP synthase; loop closure, monomer closure, orotate ph 0.002
1yfz_A205 Hypoxanthine-guanine phosphoribosyltransferase; protein 0.003
2geb_A185 Hypoxanthine-guanine phosphoribosyltransferase; HGPRT, 0.003
1o57_A291 PUR operon repressor; purine operon repressor, helix-tu 6e-09
1qb7_A236 APRT, adenine phosphoribosyltransferase; dinucleotide b 1e-05
2jky_A213 Hypoxanthine-guanine phosphoribosyltransferase; nucleus 0.001
>3dah_A Ribose-phosphate pyrophosphokinase; seattle structural genomics center for infectious disease, ssgcid, cytoplasm, magnesium; HET: AMP; 2.30A {Burkholderia pseudomallei 1710B} Length = 319 Back     alignment and structure
 Score =  403 bits (1037), Expect = e-113
 Identities = 175/311 (56%), Positives = 224/311 (72%), Gaps = 2/311 (0%)

Query: 1   MKIFAGNSNRNLAQEICDYLHTSLGKASVTYFSDREVFVEIGENVRGEDVFIVQSTSCPA 60
           + +F GN+N  LAQE+   L   LGKA V+ FSD E+ VEI ENVRG+DVF++QST  P 
Sbjct: 8   LMVFTGNANPALAQEVVKILGIPLGKAMVSRFSDGEIQVEIQENVRGKDVFVLQSTCAPT 67

Query: 61  NDYLMELLIMIDAVRRSSARRITGVIPYFGYCRQDRKP-SPRTPISAKLVANLITQAGAD 119
           ND LMEL+IM+DA++R+SA RIT  IPYFGY RQDR+P S R  ISAK+VAN++  AG +
Sbjct: 68  NDNLMELMIMVDALKRASAGRITAAIPYFGYARQDRRPRSARVAISAKVVANMLEIAGVE 127

Query: 120 RVIMLDLHAGQVQGFFDIPTDNLYALPILERDIKERNDISNLMVVSPDVGGVVRARALAK 179
           R+I +DLHA Q+QGFFDIP DN+YA PIL  D+++  +  +L+VVSPDVGGVVRARALAK
Sbjct: 128 RIITMDLHADQIQGFFDIPVDNIYATPILLGDLRK-QNYPDLLVVSPDVGGVVRARALAK 186

Query: 180 RLGCLLAIVDKRREHPGKIEVMNIIGKVEGKDCILIDDIVDTGGTLCGAADALYEQGALS 239
           +L C LAI+DKRR      EVMNIIG+VEG+ C+++DD+VDT GTLC AA  L E+GA  
Sbjct: 187 QLNCDLAIIDKRRPKANVAEVMNIIGEVEGRTCVIMDDMVDTAGTLCKAAQVLKERGAKQ 246

Query: 240 VTAYITHGVLSSSSIERIEKSKMKELVITDSIQPTDLVKSSAKIRILTIAQLMGEAINRT 299
           V AY TH VLS  + +RI  S + ELV+TD+I  +    +  KIR L+ A L+ E  +R 
Sbjct: 247 VFAYATHPVLSGGAADRIAASALDELVVTDTIPLSAESLACPKIRALSSAGLLAETFSRI 306

Query: 300 FEERSISSLFD 310
               S+ SLF 
Sbjct: 307 RRGDSVMSLFA 317


>1dku_A Protein (phosphoribosyl pyrophosphate synthetase); open alpha-beta structure, domain duplication, phosphoribosyltransferase type I fold; HET: AP2 ABM; 2.20A {Bacillus subtilis} SCOP: c.61.1.2 c.61.1.2 PDB: 1dkr_A* 1ibs_A* Length = 317 Back     alignment and structure
>2h06_A Ribose-phosphate pyrophosphokinase I; PRS1, PRPP synthetase 1, phosphoribosyl pyrophosphate synthetase 1, transferase; 2.20A {Homo sapiens} PDB: 2hcr_A* 3efh_A 2h07_A 2h08_A Length = 326 Back     alignment and structure
>2ji4_A Phosphoribosyl pyrophosphate synthetase-associated protein 2; phosphorylation, nucleotide biosynthesis, transferase; 2.55A {Homo sapiens} PDB: 2c4k_A* Length = 379 Back     alignment and structure
>1u9y_A RPPK;, ribose-phosphate pyrophosphokinase; PRPP synthase, transferase; 2.65A {Methanocaldococcus jannaschii} SCOP: c.61.1.2 c.61.1.2 PDB: 1u9z_A* Length = 284 Back     alignment and structure
>1wd5_A Hypothetical protein TT1426; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; HET: MES; 2.00A {Thermus thermophilus} SCOP: c.61.1.1 Length = 208 Back     alignment and structure
>1l1q_A Adenine phosphoribosyltransferase; aprtase, giardia lamblia, purine metabolism, catalytic loop; HET: 9DA; 1.85A {Giardia intestinalis} SCOP: c.61.1.1 PDB: 1l1r_A* Length = 186 Back     alignment and structure
>1vch_A Phosphoribosyltransferase-related protein; structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.94A {Thermus thermophilus} SCOP: c.61.1.1 Length = 175 Back     alignment and structure
>3dmp_A Uracil phosphoribosyltransferase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.60A {Burkholderia pseudomallei} Length = 217 Back     alignment and structure
>2wns_A Orotate phosphoribosyltransferase; alternative splicing, multifunctional enzyme, lyase, polymorphism, decarboxylase, phosphoprotein; HET: OMP; 1.90A {Homo sapiens} Length = 205 Back     alignment and structure
>1g2q_A Adenine phosphoribosyltransferase 1; dimer, single domain, catalytic loop; 1.50A {Saccharomyces cerevisiae} SCOP: c.61.1.1 PDB: 1g2p_A Length = 187 Back     alignment and structure
>3hvu_A Hypoxanthine phosphoribosyltransferase; hypoxantine-guanine phosphoribosyltransferase, 2-(N- morpholino)ethanesulfonic acid (MES); HET: MES; 1.95A {Bacillus anthracis str} PDB: 3h83_A* 3kb8_A* Length = 204 Back     alignment and structure
>1nul_A XPRT, xanthine-guanine phosphoribosyltransferase; purine salvage enzyme; 1.80A {Escherichia coli} SCOP: c.61.1.1 PDB: 1a96_A* 1a95_A 1a98_A 1a97_A* Length = 152 Back     alignment and structure
>3o7m_A Hypoxanthine phosphoribosyltransferase; hypoxanthine-guanine phosphoribosyltransferase, salvage of nucleosides and nucleotides; HET: GOL; 1.98A {Bacillus anthracis} Length = 186 Back     alignment and structure
>1hgx_A HGXPRTASE, hypoxanthine-guanine-xanthine phosphoribosyltransferase; glycosyltransferase, purine salvage, transferase (glycosyltransferase); HET: 5GP; 1.90A {Tritrichomonas foetus} SCOP: c.61.1.1 Length = 183 Back     alignment and structure
>3m3h_A OPRT, oprtase, orotate phosphoribosyltransferase; pyrimidine ribonucleotide biosynthesis, structural genomics, infectious diseases; 1.75A {Bacillus anthracis} PDB: 3osc_A* Length = 234 Back     alignment and structure
>1fsg_A HGPRTASE, hypoxanthine-guanine phosphoribosyltransferase; glycosyltransferase, purine salvage; HET: PRP 9DG; 1.05A {Toxoplasma gondii RH} SCOP: c.61.1.1 PDB: 1qk3_A* 1qk4_A* 1qk5_A* 1dbr_A Length = 233 Back     alignment and structure
>3ohp_A Hypoxanthine phosphoribosyltransferase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.04A {Vibrio cholerae} PDB: 1g9s_A* 1g9t_A* 1grv_A 1j7j_A Length = 177 Back     alignment and structure
>1vdm_A Purine phosphoribosyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Pyrococcus horikoshii} SCOP: c.61.1.1 Length = 153 Back     alignment and structure
>1j7j_A HPRT, hypoxanthine phosphoribosyltransferase; glycosyltransferase, nucleotide metabolism, purine salvage; 2.30A {Salmonella typhimurium} SCOP: c.61.1.1 PDB: 1g9s_A* 1g9t_A* 1grv_A Length = 178 Back     alignment and structure
>1lh0_A OMP synthase; loop closure, monomer closure, orotate phosphoribosyltransferase; HET: ORO PRP; 2.00A {Salmonella typhimurium} SCOP: c.61.1.1 PDB: 1opr_A* 1sto_A* 1oro_A Length = 213 Back     alignment and structure
>1yfz_A Hypoxanthine-guanine phosphoribosyltransferase; protein-nucleotide complex; HET: IMP; 2.20A {Thermoanaerobacter tengcongensis MB4} SCOP: c.61.1.1 PDB: 1r3u_A* Length = 205 Back     alignment and structure
>2geb_A Hypoxanthine-guanine phosphoribosyltransferase; HGPRT, mutant, inhibitor design, selectivity; 1.70A {Thermoanaerobacter tengcongensis} Length = 185 Back     alignment and structure
>1o57_A PUR operon repressor; purine operon repressor, helix-turn-helix domain, phosphoribosyltranseferases, domain recombination, DNA binding; HET: EPE P6G 2PE PG4 1PE; 2.20A {Bacillus subtilis} SCOP: a.4.5.40 c.61.1.1 PDB: 1p4a_A* Length = 291 Back     alignment and structure
>1qb7_A APRT, adenine phosphoribosyltransferase; dinucleotide binding fold; HET: ADE CIT; 1.50A {Leishmania donovani} SCOP: c.61.1.1 PDB: 1qb8_A* 1qcc_A* 1qcd_A 1mzv_A* Length = 236 Back     alignment and structure
>2jky_A Hypoxanthine-guanine phosphoribosyltransferase; nucleus, cytoplasm, magnesium, GMP complex, FLIP peptide-plane, glycosyltransferase; HET: 5GP; 2.3A {Saccharomyces cerevisiae} PDB: 2jkz_A* Length = 213 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target310 ribose-phosphate pyrophosphokinase [Candidatus Liberiba
2h06_A326 Ribose-phosphate pyrophosphokinase I; PRS1, PRPP synthe 100.0
3dah_A319 Ribose-phosphate pyrophosphokinase; seattle structural 100.0
1dku_A317 Protein (phosphoribosyl pyrophosphate synthetase); open 100.0
2ji4_A379 Phosphoribosyl pyrophosphate synthetase-associated prot 100.0
1u9y_A284 RPPK;, ribose-phosphate pyrophosphokinase; PRPP synthas 100.0
1wd5_A208 Hypothetical protein TT1426; structural genomics, riken 99.66
1qb7_A236 APRT, adenine phosphoribosyltransferase; dinucleotide b 99.44
2wns_A205 Orotate phosphoribosyltransferase; alternative splicing 99.38
2yzk_A178 OPRT, oprtase, orotate phosphoribosyltransferase; rossm 99.37
1l1q_A186 Adenine phosphoribosyltransferase; aprtase, giardia lam 99.35
1vch_A175 Phosphoribosyltransferase-related protein; structural g 99.3
1vdm_A153 Purine phosphoribosyltransferase; structural genomics, 99.29
1y0b_A197 Xanthine phosphoribosyltransferase; purine metabolism, 99.29
1zn8_A180 APRT, adenine phosphoribosyltransferase; glycosyltransf 99.28
1g2q_A187 Adenine phosphoribosyltransferase 1; dimer, single doma 99.25
3m3h_A234 OPRT, oprtase, orotate phosphoribosyltransferase; pyrim 99.15
2dy0_A190 APRT, adenine phosphoribosyltransferase; structural gen 99.14
1yfz_A205 Hypoxanthine-guanine phosphoribosyltransferase; protein 99.13
3o7m_A186 Hypoxanthine phosphoribosyltransferase; hypoxanthine-gu 99.12
2aee_A211 OPRT, oprtase, orotate phosphoribosyltransferase; struc 99.11
1z7g_A217 HGPRT, HGPRTASE, hypoxanthine-guanine phosphoribosyltra 99.09
3dez_A243 OPRT, oprtase, orotate phosphoribosyltransferase; glyco 99.09
3hvu_A204 Hypoxanthine phosphoribosyltransferase; hypoxantine-gua 99.08
2geb_A185 Hypoxanthine-guanine phosphoribosyltransferase; HGPRT, 99.08
2p1z_A180 Phosphoribosyltransferase; structural genomics, PSI-2, 99.07
1cjb_A231 Protein (hypoxanthine-guanine phosphoribosyltransferase 99.05
1hgx_A183 HGXPRTASE, hypoxanthine-guanine-xanthine phosphoribosyl 99.05
2ywu_A181 Hypoxanthine-guanine phosphoribosyltransferase; rossman 99.02
1fsg_A233 HGPRTASE, hypoxanthine-guanine phosphoribosyltransferas 99.01
3ohp_A177 Hypoxanthine phosphoribosyltransferase; structural geno 98.99
1pzm_A211 HGPRT, hypoxanthine-guanine phosphoribosyltransferase; 98.96
1tc1_A220 Protein (hypoxanthine phosphoribosyltransferase); trans 98.94
1a3c_A181 PYRR, pyrimidine operon regulatory protein PYRR; transc 98.89
1dqn_A230 Guanine phosphoribosyltransferase; protein-inhibitor co 98.88
1ufr_A181 TT1027, PYR mRNA-binding attenuation protein; pyrimidin 98.84
2jky_A213 Hypoxanthine-guanine phosphoribosyltransferase; nucleus 98.79
1i5e_A209 Uracil phosphoribosyltransferase; salvage pathway; HET: 98.31
1v9s_A208 Uracil phosphoribosyltransferase; pyrimidine salvage, o 98.29
2ehj_A208 Uracil phosphoribosyltransferase; structural genomics, 98.26
1bd3_D243 Uprtase, uracil phosphoribosyltransferase; glycosyltran 98.18
1o5o_A221 Uracil phosphoribosyltransferase; TM0721, structural ge 98.18
3dmp_A217 Uracil phosphoribosyltransferase; structural genomics, 98.15
2e55_A208 Uracil phosphoribosyltransferase; structural genomics, 98.01
1xtt_A216 Probable uracil phosphoribosyltransferase; tetramer, ty 97.91
2xed_A273 Putative maleate isomerase; nicotinic acid catabolism, 91.09
1o57_A291 PUR operon repressor; purine operon repressor, helix-tu 99.39
2ji4_A 379 Phosphoribosyl pyrophosphate synthetase-associated prot 98.59
1ecf_A504 Glutamine phosphoribosylpyrophosphate amidotransferase; 98.49
1ao0_A459 Glutamine phosphoribosylpyrophosphate amidotransferase; 98.36
1dku_A 317 Protein (phosphoribosyl pyrophosphate synthetase); open 98.32
1u9y_A 284 RPPK;, ribose-phosphate pyrophosphokinase; PRPP synthas 98.18
3dah_A 319 Ribose-phosphate pyrophosphokinase; seattle structural 98.01
2h06_A 326 Ribose-phosphate pyrophosphokinase I; PRS1, PRPP synthe 97.96
2jbh_A225 HHGP; glycosyltransferase, PRTFDC1, transferase, purine 99.04
3n2l_A238 OPRT, oprtase, orotate phosphoribosyltransferase; pyrim 98.98
2ps1_A226 Orotate phosphoribosyltransferase 1; alpha beta, oprtas 98.95
3mjd_A232 Orotate phosphoribosyltransferase; IDP02311, csgid, str 98.92
1lh0_A213 OMP synthase; loop closure, monomer closure, orotate ph 98.89
1w30_A201 PYRR bifunctional protein; transferase, glycosyltransfe 98.77
1nul_A152 XPRT, xanthine-guanine phosphoribosyltransferase; purin 98.46
2dgd_A223 223AA long hypothetical arylmalonate decarboxylase; oct 93.28
1ecf_A504 Glutamine phosphoribosylpyrophosphate amidotransferase; 90.42
3ixl_A240 Amdase, arylmalonate decarboxylase; enantioselective de 90.46
>2h06_A Ribose-phosphate pyrophosphokinase I; PRS1, PRPP synthetase 1, phosphoribosyl pyrophosphate synthetase 1, transferase; 2.20A {Homo sapiens} PDB: 2hcr_A* 3efh_A 2h07_A 2h08_A Back     alignment and structure
Probab=100.00  E-value=0  Score=729.19  Aligned_cols=310  Identities=48%  Similarity=0.767  Sum_probs=304.4

Q ss_pred             CEEEECCCCHHHHHHHHHHHCCCEEEEEEEECCCCEEEEEECCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCC
Q ss_conf             98997689999999999995891044489986997078885678689708998597888046799999999999861720
Q gi|254780409|r    1 MKIFAGNSNRNLAQEICDYLHTSLGKASVTYFSDREVFVEIGENVRGEDVFIVQSTSCPANDYLMELLIMIDAVRRSSAR   80 (310)
Q Consensus         1 m~i~~g~~~~~La~~ia~~lg~~l~~~~~~~F~dGE~~v~i~~~vrg~dV~ivqs~~~~~nd~lmeLl~~~~a~k~~~A~   80 (310)
                      |+||+|++|++||++||+.||++++++++++|||||.++|++++|||+|||||||+++|+||++||||++++|+|++||+
T Consensus         4 m~ifsgs~~~~LA~~Ia~~Lg~~l~~~~~~~F~dGE~~v~i~e~vrg~dV~iiqs~~~~~nd~lmelll~i~alr~~~A~   83 (326)
T 2h06_A            4 IKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDNLMELLIMINACKIASAS   83 (326)
T ss_dssp             EEEEECSSCCHHHHHHHHHHTCCCCCEEEEECSSSCEEEEECSCCBTCEEEEECCCCSCHHHHHHHHHHHHHHHHTTTBS
T ss_pred             CEEEECCCCHHHHHHHHHHHCCCCEEEEEEECCCCCEEEEECCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCC
T ss_conf             19997999889999999986996220288988999778887998789858999589999466899999988888756887


Q ss_pred             HHHHHCCCCCHHHCCCCCCCCCCHHHHHHHHHHEECCCCEEEEECCCCHHHHHHCCCCCEECCHHHHHHHHHHHH-CCCC
Q ss_conf             011310233011034311256521477765200002677269951583577652588620001037777876530-5855
Q gi|254780409|r   81 RITGVIPYFGYCRQDRKPSPRTPISAKLVANLITQAGADRVIMLDLHAGQVQGFFDIPTDNLYALPILERDIKER-NDIS  159 (310)
Q Consensus        81 ~it~ViPY~~YaRqDr~~~~~e~isak~~a~ll~~~G~d~vit~DlH~~~~~~~F~ip~~nl~~~~~l~~~l~~~-~~~~  159 (310)
                      +||+|+|||||+||||++++|||+|+|++|+||+++|+|+|+|+|+|++|+||||++|++|+++.+.++.|+... .+++
T Consensus        84 ~It~ViPYl~YaRQDr~~~~ge~isak~va~lL~~~G~d~vit~DlH~~~i~~~f~~~~~~~~~~~~~~~~~~~~~~~~~  163 (326)
T 2h06_A           84 RVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLKWIRENISEWR  163 (326)
T ss_dssp             EEEEEESSCTTTTCCSCSSSSCCCHHHHHHHHHHHHTCCEEEEESCSSGGGGGGCSSCEEEECSHHHHHHHHHTTCTTGG
T ss_pred             EEEEEEEECCCCCCCCCCCCCCCEEHHHHHHHHHHCCCCEEEEECCCHHHHHHCCCCCCCCCCCCCHHHHHHHHHCCCCC
T ss_conf             28999873134313313379886539999999987089979996488799842158986532154034567887425766


Q ss_pred             CEEEEECCCCHHHHHHHHHHHCCCCEEEEECCCCCCCCCEEECCCCCCCCCEEEEECHHHCCHHHHHHHHHHHHHCCCCC
Q ss_conf             51885166563578999999709979998326767632100002454557428995213203366888989875268752
Q gi|254780409|r  160 NLMVVSPDVGGVVRARALAKRLGCLLAIVDKRREHPGKIEVMNIIGKVEGKDCILIDDIVDTGGTLCGAADALYEQGALS  239 (310)
Q Consensus       160 ~~vVVaPD~G~~~ra~~~a~~L~~~~~~~~K~R~~~~~v~~~~~~gdV~gr~vIIVDDii~TGgTi~~aa~~Lk~~GA~~  239 (310)
                      |++|||||.|+++||+.+|+.||+++++++|+|..+++++...++|||+||+||||||||||||||+++++.|+++||++
T Consensus       164 ~~vvvsPD~Ga~kra~~~a~~l~~~~~~~~K~R~~~~~v~~~~~~gdV~gk~vIIVDDii~TGgTl~~aa~~Lk~~GA~~  243 (326)
T 2h06_A          164 NCTIVSPDAGGAKRVTSIADRLNVDFALIHKERKKANEVDRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATR  243 (326)
T ss_dssp             GCEEEESSGGGHHHHHHHHHHHTCEEEEEEECC------CCEEEESCCTTEEEEEEEEEESSCHHHHHHHHHHHHTTEEE
T ss_pred             CCEEECCCCCHHHHHHHHHHHHCCCEEEEEEEECCCCCEEEEEEECCCCCCEEEEECCHHHCHHHHHHHHHHHHHCCCCC
T ss_conf             77698679557999999999828974346555248981424676213324405886415533267999999998579986


Q ss_pred             EEEEEECCCCCHHHHHHHHHCCCCEEEECCCCCCCHHHHCCCCEEEEECHHHHHHHHHHHHCCCCCCHHCC
Q ss_conf             17872055557168988863699899981788784347407985998117999999998718887313009
Q gi|254780409|r  240 VTAYITHGVLSSSSIERIEKSKMKELVITDSIQPTDLVKSSAKIRILTIAQLMGEAINRTFEERSISSLFD  310 (310)
Q Consensus       240 V~~~~THgifs~~a~e~l~~s~i~~iv~TnTi~~~~~~~~~~ki~visva~llA~aI~~i~~~~Svs~l~~  310 (310)
                      |+++||||+|+++|+|+|+++++++|++|||||+++..+.++|++++|+||+||++|+|+|+|+|||+||+
T Consensus       244 V~~~aTHglfs~~a~e~l~~s~i~~ivvTnTIp~~~~~~~~~ki~vlsva~llAeaI~ri~~~~Svs~Lf~  314 (326)
T 2h06_A          244 VYAILTHGIFSGPAISRINNACFEAVVVTNTIPQEDKMKHCSKIQVIDISMILAEAIRRTHNGESVSYLFS  314 (326)
T ss_dssp             EEEEEEEECCCTTHHHHHHHSCEEEEEEETTSCCHHHHHHCTTEEEECCHHHHHHHHHHHHHTCCSGGGC-
T ss_pred             CEEEEECCCCCCHHHHHHHCCCCCEEEECCCCCCCHHHCCCCCCEEEEHHHHHHHHHHHHHCCCCHHHHCC
T ss_conf             56886434458179999864799889986885684243458982998849999999999866997899818



>3dah_A Ribose-phosphate pyrophosphokinase; seattle structural genomics center for infectious disease, ssgcid, cytoplasm, magnesium; HET: AMP; 2.30A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>1dku_A Protein (phosphoribosyl pyrophosphate synthetase); open alpha-beta structure, domain duplication, phosphoribosyltransferase type I fold; HET: AP2 ABM; 2.20A {Bacillus subtilis} SCOP: c.61.1.2 c.61.1.2 PDB: 1dkr_A* 1ibs_A* Back     alignment and structure
>2ji4_A Phosphoribosyl pyrophosphate synthetase-associated protein 2; phosphorylation, nucleotide biosynthesis, transferase; 2.55A {Homo sapiens} PDB: 2c4k_A* Back     alignment and structure
>1u9y_A RPPK;, ribose-phosphate pyrophosphokinase; PRPP synthase, transferase; 2.65A {Methanocaldococcus jannaschii} SCOP: c.61.1.2 c.61.1.2 PDB: 1u9z_A* Back     alignment and structure
>1wd5_A Hypothetical protein TT1426; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; HET: MES; 2.00A {Thermus thermophilus} SCOP: c.61.1.1 Back     alignment and structure
>1qb7_A APRT, adenine phosphoribosyltransferase; dinucleotide binding fold; HET: ADE CIT; 1.50A {Leishmania donovani} SCOP: c.61.1.1 PDB: 1qb8_A* 1qcc_A* 1qcd_A 1mzv_A* Back     alignment and structure
>2wns_A Orotate phosphoribosyltransferase; alternative splicing, multifunctional enzyme, lyase, polymorphism, decarboxylase, phosphoprotein; HET: OMP; 1.90A {Homo sapiens} Back     alignment and structure
>2yzk_A OPRT, oprtase, orotate phosphoribosyltransferase; rossmann fold, glycosyltransferase, magnesium, pyrimidine biosynthesis, structural genomics; 1.80A {Aeropyrum pernix} Back     alignment and structure
>1l1q_A Adenine phosphoribosyltransferase; aprtase, giardia lamblia, purine metabolism, catalytic loop; HET: 9DA; 1.85A {Giardia intestinalis} SCOP: c.61.1.1 PDB: 1l1r_A* Back     alignment and structure
>1vch_A Phosphoribosyltransferase-related protein; structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.94A {Thermus thermophilus} SCOP: c.61.1.1 Back     alignment and structure
>1vdm_A Purine phosphoribosyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Pyrococcus horikoshii} SCOP: c.61.1.1 Back     alignment and structure
>1y0b_A Xanthine phosphoribosyltransferase; purine metabolism, structural genomics, PSI, protein structure initative; HET: G4P; 1.80A {Bacillus subtilis} SCOP: c.61.1.1 PDB: 2fxv_A* Back     alignment and structure
>1zn8_A APRT, adenine phosphoribosyltransferase; glycosyltransferase, polymorphism, purine salvage; HET: AMP; 1.76A {Homo sapiens} SCOP: c.61.1.1 PDB: 1ore_A* 1zn7_A* 1zn9_A* Back     alignment and structure
>1g2q_A Adenine phosphoribosyltransferase 1; dimer, single domain, catalytic loop; 1.50A {Saccharomyces cerevisiae} SCOP: c.61.1.1 PDB: 1g2p_A Back     alignment and structure
>3m3h_A OPRT, oprtase, orotate phosphoribosyltransferase; pyrimidine ribonucleotide biosynthesis, structural genomics, infectious diseases; 1.75A {Bacillus anthracis} PDB: 3osc_A* Back     alignment and structure
>2dy0_A APRT, adenine phosphoribosyltransferase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.25A {Escherichia coli K12} Back     alignment and structure
>1yfz_A Hypoxanthine-guanine phosphoribosyltransferase; protein-nucleotide complex; HET: IMP; 2.20A {Thermoanaerobacter tengcongensis MB4} SCOP: c.61.1.1 PDB: 1r3u_A* Back     alignment and structure
>3o7m_A Hypoxanthine phosphoribosyltransferase; hypoxanthine-guanine phosphoribosyltransferase, salvage of nucleosides and nucleotides; HET: GOL; 1.98A {Bacillus anthracis} Back     alignment and structure
>2aee_A OPRT, oprtase, orotate phosphoribosyltransferase; structural genomics, PSI, protein structure initiative; 1.95A {Streptococcus pyogenes} SCOP: c.61.1.1 Back     alignment and structure
>1z7g_A HGPRT, HGPRTASE, hypoxanthine-guanine phosphoribosyltransferase; flexibility, trans CIS peptide bond isomerization, nucleotide binding; 1.90A {Homo sapiens} SCOP: c.61.1.1 PDB: 1hmp_A* 1bzy_A 3gep_A* 3ggc_A* 3ggj_A* 1d6n_A* 2vfa_A* Back     alignment and structure
>3dez_A OPRT, oprtase, orotate phosphoribosyltransferase; glycosyltransferase, MAGN pyrimidine biosynthesis; 2.40A {Streptococcus mutans} Back     alignment and structure
>3hvu_A Hypoxanthine phosphoribosyltransferase; hypoxantine-guanine phosphoribosyltransferase, 2-(N- morpholino)ethanesulfonic acid (MES); HET: MES; 1.95A {Bacillus anthracis str} PDB: 3h83_A* 3kb8_A* Back     alignment and structure
>2geb_A Hypoxanthine-guanine phosphoribosyltransferase; HGPRT, mutant, inhibitor design, selectivity; 1.70A {Thermoanaerobacter tengcongensis} Back     alignment and structure
>2p1z_A Phosphoribosyltransferase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics; 2.44A {Corynebacterium diphtheriae NCTC13129} Back     alignment and structure
>1cjb_A Protein (hypoxanthine-guanine phosphoribosyltransferase); malaria, purine salvage, transition state inhibitor; HET: IRP; 2.00A {Plasmodium falciparum} SCOP: c.61.1.1 Back     alignment and structure
>1hgx_A HGXPRTASE, hypoxanthine-guanine-xanthine phosphoribosyltransferase; glycosyltransferase, purine salvage, transferase (glycosyltransferase); HET: 5GP; 1.90A {Tritrichomonas foetus} SCOP: c.61.1.1 Back     alignment and structure
>1fsg_A HGPRTASE, hypoxanthine-guanine phosphoribosyltransferase; glycosyltransferase, purine salvage; HET: PRP 9DG; 1.05A {Toxoplasma gondii RH} SCOP: c.61.1.1 PDB: 1qk3_A* 1qk4_A* 1qk5_A* 1dbr_A Back     alignment and structure
>3ohp_A Hypoxanthine phosphoribosyltransferase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.04A {Vibrio cholerae} PDB: 1g9s_A* 1g9t_A* 1grv_A 1j7j_A Back     alignment and structure