254780414

254780414

GMP synthase

GeneID in NCBI database:8209400Locus tag:CLIBASIA_01495
Protein GI in NCBI database:254780414Protein Accession:YP_003064827.1
Gene range:-(317028, 318590)Protein Length:520aa
Gene description:GMP synthase
COG prediction:[F] GMP synthase - Glutamine amidotransferase domain
KEGG prediction:guaA; GMP synthase (EC:6.3.5.2); K01951 GMP synthase (glutamine-hydrolysing) [EC:6.3.5.2]
SEED prediction:GMP synthase [glutamine-hydrolyzing] (EC 6.3.5.2)
Pathway involved in KEGG:Purine metabolism [PATH:las00230]
Subsystem involved in SEED:Purine conversions
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED3 TM-Helix
HMMTOP2 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520
MHKRERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE
ccccccccEEEEEEcccHHHHHHHHHHHHcccEEEEEEccccHHHHHHccccEEEEccccccccccccHHHHHHHHHccccEEEEcHHHHHHHHHHccEEEEccccccccEEEEEEccccHHccccccccEEEEEEEEHHHHHHcccccEEEEEcccccEEEEEEccccEEEEEccccccccHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHccccccEEEEEEccccHHHHHHHHHHHHccccEEEEEEcccccccccHHHHHHHHHHHcccEEEEEcHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHccccEEEEccccHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHcHHHHHHHHHHHcccHHHHccccccccccEEEccccccHHHHHHHHHccHHHHHHHHHccccHHcccccEEEccccEEEEEcccccccEEEEEEEEEcccccccccccccHHHHHHHHHHHHHHHccccEEEEccccccccccccc
ccccccccEEEEEccHHHHHHHHHHHHHHcccccccccccccHHHHHHHccccEEEEcccccccccccccccHHHHHcccccccccHHHHHHHHHHcccEccccccccccEEEEEcccHHHHcccccccccccEEccccccEEEcccccEEEEEcccccHHHHccHHcccEEEEEcccccccccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHcccccEEEEEcccccHHHHHHHHHHHHHcccEEEEEccccccccHHHHHHHHHHHHccccEEEEcHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHcccHHHccccccccEEEcccccccccEEEEEccccccccHHHcccccHHHHHHHHHHHHHHHHHHcccHHHEEcccccccccEEEEcccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHEEcccccEEEEEccccEEEEEEEEEEEEEcccccHcHccccHHHHHHHHHHEHEEccccEEEEEEcccccccEEEEc
mhkrerssKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDyfkeqnpqaiilsgspassldidspqipkeilesnipllgicYGQQIMcqslggktknsqsREFGRAFIEIKKNCSLLKGMWEKGSKQQVWMShgdqvehipegfeviassdstpfafiADEKRKYYAVqfhpevvhtvggsqliDNFVHHVagiqdnwvmSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGINLTCVLVDHGFMRKNEVENIISLFkgypnfplrvVDASERFIRKLKnivdpetkRKVIGQLFIEVFEEEAKKiggaqflgqgtlypdviesisffggpssiikshhnvgglpehmdmkLVEPLKELFKDEVRLLGkelrlpdsfverhpcpgpglairCIGEITEERINILRESDAIYREEIHKAGIYRKIWQAFTVLLPvqtvgvmgderTYEYVCSLRAVtsidgmtadfyhhDMNFLSQVAIRIVNEVKGINRVvyditskppatiewe
mhkrersskvliidfgsqftQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKlknivdpetkrkVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVEPLKELFKDEVRLLGKElrlpdsfverhpcpgpglaircigEITEERINILRESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFLSQVAIRIVNEVKGInrvvyditskppatiewe
MHKRERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDViesisffggpssiiKSHHNVGGLPEHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE
******S***LIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE
********KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE
****ERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEW*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHKRERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE
MHKRERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE
MHKRERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target520 GMP synthase [Candidatus Liberibacter asiaticus str. ps
254780420396 carbamoyl phosphate synthase small subunit [Candid 2e-06
254780195544 CTP synthetase [Candidatus Liberibacter asiaticus 0.007
254780151408 tRNA-specific 2-thiouridylase MnmA [Candidatus Lib 0.029
>gi|254780420|ref|YP_003064833.1| carbamoyl phosphate synthase small subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 396 Back     alignment
 Score = 45.4 bits (106), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 48/177 (27%), Positives = 81/177 (45%), Gaps = 22/177 (12%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILS---GSPASSLDI 66
           V+ ID+G +   L  R +        ++  + +        P  ++LS   G PA +   
Sbjct: 208 VVCIDYGIRSNLL--RVLSSLGCRITIVGAETSYKDIMSLQPDGVLLSNGPGDPAVTSVY 265

Query: 67  DSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMW 126
            SP I K +++S +P+ GIC G Q++  +LG +T        G       KN S      
Sbjct: 266 SSPIICK-LVDSGMPMFGICLGHQLLGLALGAQTVKMYQGHHGVN--HPVKNIS------ 316

Query: 127 EKGSKQQVWMSHGDQVE--HIPEGFEV--IASSDSTPFAF-IADEKRKYYAVQFHPE 178
             G+ + V M+HG  ++   +P G E   I+  DS+   F + D+    ++VQ+HPE
Sbjct: 317 -NGTVEIVSMNHGFAIDASSLPAGLEETHISLFDSSNCGFRLIDQ--PVFSVQYHPE 370

>gi|254780195|ref|YP_003064608.1| CTP synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 544 Back     alignment
 Score = 33.9 bits (76), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 33/68 (48%), Gaps = 9/68 (13%)

Query: 77  ESNIPLLGICYGQQI----MCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKGSKQ 132
           E+ IP LGIC+G Q+      ++L G   N+ S EF  A + +      L   W KG +Q
Sbjct: 373 ENKIPFLGICFGMQMAVIEAARNLAG-IPNACSTEFSEAGVPVIA----LMSEWMKGDQQ 427

Query: 133 QVWMSHGD 140
           +  +   D
Sbjct: 428 EKRLPSDD 435

>gi|254780151|ref|YP_003064564.1| tRNA-specific 2-thiouridylase MnmA [Candidatus Liberibacter asiaticus str. psy62] Length = 408 Back     alignment
 Score = 31.6 bits (70), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 22/31 (70%), Gaps = 4/31 (12%)

Query: 224 RVICAVSGGVDSTVAAFLI----YEAIGINL 250
           RV+ A+SGGVDS+V A L+    Y+ IG+ L
Sbjct: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTL 52

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target520 GMP synthase [Candidatus Liberibacter asiaticus str. ps
315122142520 GMP synthase [Candidatus Liberibacter solanacearum CLso 1 0.0
227824153520 GMP synthase [Sinorhizobium fredii NGR234] Length = 520 1 0.0
150398701520 GMP synthase [Sinorhizobium medicae WSM419] Length = 52 1 0.0
222084579520 GMP synthase - glutamine amidotransferase protein [Agro 1 0.0
15964067520 bifunctional GMP synthase/glutamine amidotransferase pr 1 0.0
86355954520 bifunctional GMP synthase/glutamine amidotransferase pr 1 0.0
190889964520 GMP synthase (glutamine-hydrolyzing) protein [Rhizobium 1 0.0
327191998520 GMP synthase (glutamine-hydrolyzing) protein [Rhizobium 1 0.0
209551875520 GMP synthase [Rhizobium leguminosarum bv. trifolii WSM2 1 0.0
241207252520 GMP synthase [Rhizobium leguminosarum bv. trifolii WSM1 1 0.0
>gi|315122142|ref|YP_004062631.1| GMP synthase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 520 Back     alignment and organism information
 Score =  915 bits (2366), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 438/520 (84%), Positives = 483/520 (92%)

Query: 1   MHKRERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSP 60
           MH  ++S+KVLIIDFGSQFTQLIAR VRE+KVYCEVIAF+ ALDYF++  PQAIILSGSP
Sbjct: 1   MHAGKKSNKVLIIDFGSQFTQLIARCVRENKVYCEVIAFECALDYFRKTRPQAIILSGSP 60

Query: 61  ASSLDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCS 120
           AS LDIDSPQIP+EILESN PLLGICYGQQIMC SLGG  K SQ+REFGRAFIEIKK+CS
Sbjct: 61  ASPLDIDSPQIPQEILESNTPLLGICYGQQIMCTSLGGTIKKSQNREFGRAFIEIKKDCS 120

Query: 121 LLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVV 180
           LLKG+WEK S QQVWMSHGDQVE +PEGFEVIASSD+TPFAF+ADEKRKYYAVQFHPEVV
Sbjct: 121 LLKGLWEKDSIQQVWMSHGDQVERMPEGFEVIASSDNTPFAFVADEKRKYYAVQFHPEVV 180

Query: 181 HTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAF 240
           HT GGSQLI NFV  VAGIQ +W+MSSY KEIVS IK+QVG+ERVICA+SGGVDS+VAAF
Sbjct: 181 HTEGGSQLIANFVRDVAGIQGDWIMSSYRKEIVSCIKKQVGDERVICALSGGVDSSVAAF 240

Query: 241 LIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPE 300
           LIYEAIG NLTCVLVDHGFMRKNEV+N++ LFK YP+FPL VVDASERFI KLKN++DPE
Sbjct: 241 LIYEAIGKNLTCVLVDHGFMRKNEVDNVVGLFKKYPDFPLIVVDASERFIGKLKNVIDPE 300

Query: 301 TKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLP 360
            KRK+IG+LFIEVFEEEA+KIGGA+FLGQGTLYPDVIES+SFFGGPSS+IKSHHNVGGLP
Sbjct: 301 DKRKIIGKLFIEVFEEEAEKIGGAKFLGQGTLYPDVIESVSFFGGPSSVIKSHHNVGGLP 360

Query: 361 EHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILR 420
           E+M+M LVEPL++LFKDEVRLLGKEL L DSF++RHPCPGPGLAIRCIGE+TEE+INILR
Sbjct: 361 EYMNMDLVEPLRDLFKDEVRLLGKELGLSDSFIDRHPCPGPGLAIRCIGEVTEEKINILR 420

Query: 421 ESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADF 480
           ESDAIY EEI KAGIY +IWQAFTVLLP+QTVGVMGDERTYE VCSLRAVTS DGMTADF
Sbjct: 421 ESDAIYCEEICKAGIYNEIWQAFTVLLPIQTVGVMGDERTYECVCSLRAVTSRDGMTADF 480

Query: 481 YHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           YHHDM+FLSQV+ RIVNEVKGI+RVVYDITSKPPATIEWE
Sbjct: 481 YHHDMDFLSQVSTRIVNEVKGISRVVYDITSKPPATIEWE 520


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|227824153|ref|YP_002828126.1| GMP synthase [Sinorhizobium fredii NGR234] Length = 520 Back     alignment and organism information
>gi|150398701|ref|YP_001329168.1| GMP synthase [Sinorhizobium medicae WSM419] Length = 520 Back     alignment and organism information
>gi|222084579|ref|YP_002543108.1| GMP synthase - glutamine amidotransferase protein [Agrobacterium radiobacter K84] Length = 520 Back     alignment and organism information
>gi|15964067|ref|NP_384420.1| bifunctional GMP synthase/glutamine amidotransferase protein [Sinorhizobium meliloti 1021] Length = 520 Back     alignment and organism information
>gi|86355954|ref|YP_467846.1| bifunctional GMP synthase/glutamine amidotransferase protein [Rhizobium etli CFN 42] Length = 520 Back     alignment and organism information
>gi|190889964|ref|YP_001976506.1| GMP synthase (glutamine-hydrolyzing) protein [Rhizobium etli CIAT 652] Length = 520 Back     alignment and organism information
>gi|327191998|gb|EGE58979.1| GMP synthase (glutamine-hydrolyzing) protein [Rhizobium etli CNPAF512] Length = 520 Back     alignment and organism information
>gi|209551875|ref|YP_002283792.1| GMP synthase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 520 Back     alignment and organism information
>gi|241207252|ref|YP_002978348.1| GMP synthase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 520 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target520 GMP synthase [Candidatus Liberibacter asiaticus str. ps
PRK00074511 PRK00074, guaA, GMP synthase; Reviewed 0.0
PLN02347536 PLN02347, PLN02347, GMP synthetase 0.0
KOG1622552 KOG1622, KOG1622, KOG1622, GMP synthase [Nucleotide tra 1e-146
COG0519315 COG0519, GuaA, GMP synthase, PP-ATPase domain/subunit [ 1e-146
TIGR00884311 TIGR00884, guaA_Cterm, GMP synthase (glutamine-hydrolyz 1e-142
cd01997295 cd01997, GMP_synthase_C, The C-terminal domain of GMP s 1e-137
PRK00919307 PRK00919, PRK00919, GMP synthase subunit B; Validated 1e-118
cd01742181 cd01742, GATase1_GMP_Synthase, Type 1 glutamine amidotr 4e-69
TIGR00888188 TIGR00888, guaA_Nterm, GMP synthase (glutamine-hydrolyz 2e-61
COG0518198 COG0518, GuaA, GMP synthase - Glutamine amidotransferas 6e-49
PRK00758184 PRK00758, PRK00758, GMP synthase subunit A; Validated 1e-33
pfam00117187 pfam00117, GATase, Glutamine amidotransferase class-I 7e-33
COG0512191 COG0512, PabA, Anthranilate/para-aminobenzoate synthase 4e-17
cd01743184 cd01743, GATase1_Anthranilate_Synthase, Type 1 glutamin 1e-15
PRK05670189 PRK05670, PRK05670, anthranilate synthase component II; 1e-13
PRK13566720 PRK13566, PRK13566, anthranilate synthase; Provisional 5e-12
CHL00101190 CHL00101, trpG, anthranilate synthase component 2 1e-11
TIGR01815717 TIGR01815, TrpE-clade3, anthranilate synthase, alpha pr 5e-10
cd01744178 cd01744, GATase1_CPSase, Small chain of the glutamine-d 7e-10
COG0505368 COG0505, CarA, Carbamoylphosphate synthase small subuni 2e-09
TIGR01368358 TIGR01368, CPSaseIIsmall, carbamoyl-phosphate synthase, 4e-09
CHL00197382 CHL00197, carA, carbamoyl-phosphate synthase arginine-s 1e-08
TIGR00566188 TIGR00566, trpG_papA, glutamine amidotransferase of ant 2e-08
PRK14607534 PRK14607, PRK14607, bifunctional glutamine amidotransfe 5e-08
KOG0026223 KOG0026, KOG0026, KOG0026, Anthranilate synthase, beta 3e-06
PRK12838354 PRK12838, PRK12838, carbamoyl phosphate synthase small 4e-06
PLN02335222 PLN02335, PLN02335, anthranilate synthase 7e-05
PRK06895190 PRK06895, PRK06895, putative anthranilate synthase comp 8e-05
PRK09522531 PRK09522, PRK09522, bifunctional glutamine amidotransfe 1e-04
pfam0095893 pfam00958, GMP_synt_C, GMP synthase C terminal domain 3e-49
cd01741188 cd01741, GATase1_1, Subgroup of proteins having the Typ 1e-21
KOG3179245 KOG3179, KOG3179, KOG3179, Predicted glutamine syntheta 6e-11
PRK09065237 PRK09065, PRK09065, glutamine amidotransferase; Provisi 3e-10
PRK05665240 PRK05665, PRK05665, amidotransferase; Provisional 4e-10
PRK08007187 PRK08007, PRK08007, para-aminobenzoate synthase compone 4e-08
cd01748198 cd01748, GATase1_IGP_Synthase, Type 1 glutamine amidotr 8e-08
PRK13141205 PRK13141, hisH, imidazole glycerol phosphate synthase s 8e-08
PRK08857193 PRK08857, PRK08857, para-aminobenzoate synthase compone 1e-07
PRK06490239 PRK06490, PRK06490, glutamine amidotransferase; Provisi 4e-07
COG0118204 COG0118, HisH, Glutamine amidotransferase [Amino acid t 5e-07
PRK07053234 PRK07053, PRK07053, glutamine amidotransferase; Provisi 6e-07
COG2071243 COG2071, COG2071, Predicted glutamine amidotransferases 1e-05
KOG1224 767 KOG1224, KOG1224, KOG1224, Para-aminobenzoate (PABA) sy 1e-05
PRK13181199 PRK13181, hisH, imidazole glycerol phosphate synthase s 3e-05
PRK14004210 PRK14004, hisH, imidazole glycerol phosphate synthase s 3e-05
PRK13170196 PRK13170, hisH, imidazole glycerol phosphate synthase s 4e-05
PRK13146209 PRK13146, hisH, imidazole glycerol phosphate synthase s 4e-05
pfam07722219 pfam07722, Peptidase_C26, Peptidase C26 5e-05
PRK07567242 PRK07567, PRK07567, glutamine amidotransferase; Provisi 3e-04
TIGR01855196 TIGR01855, IMP_synth_hisH, imidazole glycerol phosphate 3e-04
PRK13152201 PRK13152, hisH, imidazole glycerol phosphate synthase s 4e-04
PRK07649195 PRK07649, PRK07649, para-aminobenzoate/anthranilate syn 7e-04
PRK06774191 PRK06774, PRK06774, para-aminobenzoate synthase compone 8e-04
cd01745189 cd01745, GATase1_2, Subgroup of proteins having the Typ 0.001
PLN02617538 PLN02617, PLN02617, imidazole glycerol phosphate syntha 0.004
COG0037298 COG0037, MesJ, Predicted ATPase of the PP-loop superfam 4e-08
cd00553248 cd00553, NAD_synthase, NAD+ synthase is a homodimer, wh 2e-05
COG0171268 COG0171, NadE, NAD synthase [Coenzyme metabolism] 4e-05
cd01712177 cd01712, ThiI, ThiI is required for thiazole synthesis 1e-04
cd01993185 cd01993, Alpha_ANH_like_II, This is a subfamily of Aden 0.001
pfam02540243 pfam02540, NAD_synthase, NAD synthase 0.002
PRK12564360 PRK12564, PRK12564, carbamoyl phosphate synthase small 1e-06
KOG0370 1435 KOG0370, KOG0370, KOG0370, Multifunctional pyrimidine s 1e-05
PLN02771415 PLN02771, PLN02771, carbamoyl-phosphate synthase (gluta 2e-04
cd01653115 cd01653, GATase1, Type 1 glutamine amidotransferase (GA 3e-04
cd0312892 cd03128, GAT_1, Type 1 glutamine amidotransferase (GATa 3e-04
cd01990202 cd01990, Alpha_ANH_like_I, This is a subfamily of Adeni 2e-06
COG1606269 COG1606, COG1606, ATP-utilizing enzymes of the PP-loop 9e-05
cd01996154 cd01996, Alpha_ANH_like_III, This is a subfamily of Ade 4e-06
TIGR03573343 TIGR03573, WbuX, N-acetyl sugar amidotransferase 5e-06
PRK13980265 PRK13980, PRK13980, NAD synthetase; Provisional 9e-05
PRK00143346 PRK00143, mnmA, tRNA-specific 2-thiouridylase MnmA; Rev 2e-04
pfam03054354 pfam03054, tRNA_Me_trans, tRNA methyl transferase 6e-04
COG0482356 COG0482, TrmU, Predicted tRNA(5-methylaminomethyl-2-thi 0.001
cd01998349 cd01998, tRNA_Me_trans, tRNA methyl transferase 0.001
cd01992185 cd01992, PP-ATPase, N-terminal domain of predicted ATPa 0.002
>gnl|CDD|178842 PRK00074, guaA, GMP synthase; Reviewed Back     alignment and domain information
>gnl|CDD|177981 PLN02347, PLN02347, GMP synthetase Back     alignment and domain information
>gnl|CDD|36835 KOG1622, KOG1622, KOG1622, GMP synthase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|30865 COG0519, GuaA, GMP synthase, PP-ATPase domain/subunit [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|162088 TIGR00884, guaA_Cterm, GMP synthase (glutamine-hydrolyzing), C-terminal domain or B subunit Back     alignment and domain information
>gnl|CDD|30184 cd01997, GMP_synthase_C, The C-terminal domain of GMP synthetase Back     alignment and domain information
>gnl|CDD|179167 PRK00919, PRK00919, GMP synthase subunit B; Validated Back     alignment and domain information
>gnl|CDD|153213 cd01742, GATase1_GMP_Synthase, Type 1 glutamine amidotransferase (GATase1) domain found in GMP synthetase Back     alignment and domain information
>gnl|CDD|129966 TIGR00888, guaA_Nterm, GMP synthase (glutamine-hydrolyzing), N-terminal domain or A subunit Back     alignment and domain information
>gnl|CDD|30864 COG0518, GuaA, GMP synthase - Glutamine amidotransferase domain [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|179112 PRK00758, PRK00758, GMP synthase subunit A; Validated Back     alignment and domain information
>gnl|CDD|143892 pfam00117, GATase, Glutamine amidotransferase class-I Back     alignment and domain information
>gnl|CDD|30858 COG0512, PabA, Anthranilate/para-aminobenzoate synthases component II [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|153214 cd01743, GATase1_Anthranilate_Synthase, Type 1 glutamine amidotransferase (GATase1) domain found in Anthranilate synthase Back     alignment and domain information
>gnl|CDD|180190 PRK05670, PRK05670, anthranilate synthase component II; Provisional Back     alignment and domain information
>gnl|CDD|184147 PRK13566, PRK13566, anthranilate synthase; Provisional Back     alignment and domain information
>gnl|CDD|164502 CHL00101, trpG, anthranilate synthase component 2 Back     alignment and domain information
>gnl|CDD|130874 TIGR01815, TrpE-clade3, anthranilate synthase, alpha proteobacterial clade Back     alignment and domain information
>gnl|CDD|153215 cd01744, GATase1_CPSase, Small chain of the glutamine-dependent form of carbamoyl phosphate synthase, CPSase II Back     alignment and domain information
>gnl|CDD|30851 COG0505, CarA, Carbamoylphosphate synthase small subunit [Amino acid transport and metabolism / Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|162320 TIGR01368, CPSaseIIsmall, carbamoyl-phosphate synthase, small subunit Back     alignment and domain information
>gnl|CDD|164573 CHL00197, carA, carbamoyl-phosphate synthase arginine-specific small subunit; Provisional Back     alignment and domain information
>gnl|CDD|161933 TIGR00566, trpG_papA, glutamine amidotransferase of anthranilate synthase or aminodeoxychorismate synthase Back     alignment and domain information
>gnl|CDD|184763 PRK14607, PRK14607, bifunctional glutamine amidotransferase/anthranilate phosphoribosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|35249 KOG0026, KOG0026, KOG0026, Anthranilate synthase, beta chain [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|183784 PRK12838, PRK12838, carbamoyl phosphate synthase small subunit; Reviewed Back     alignment and domain information
>gnl|CDD|177969 PLN02335, PLN02335, anthranilate synthase Back     alignment and domain information
>gnl|CDD|168720 PRK06895, PRK06895, putative anthranilate synthase component II; Provisional Back     alignment and domain information
>gnl|CDD|181927 PRK09522, PRK09522, bifunctional glutamine amidotransferase/anthranilate phosphoribosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|144525 pfam00958, GMP_synt_C, GMP synthase C terminal domain Back     alignment and domain information
>gnl|CDD|153212 cd01741, GATase1_1, Subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain Back     alignment and domain information
>gnl|CDD|38389 KOG3179, KOG3179, KOG3179, Predicted glutamine synthetase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|181635 PRK09065, PRK09065, glutamine amidotransferase; Provisional Back     alignment and domain information
>gnl|CDD|168162 PRK05665, PRK05665, amidotransferase; Provisional Back     alignment and domain information
>gnl|CDD|181194 PRK08007, PRK08007, para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>gnl|CDD|153219 cd01748, GATase1_IGP_Synthase, Type 1 glutamine amidotransferase (GATase1) domain found in imidazole glycerol phosphate synthase (IGPS) Back     alignment and domain information
>gnl|CDD|183868 PRK13141, hisH, imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>gnl|CDD|181566 PRK08857, PRK08857, para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>gnl|CDD|180590 PRK06490, PRK06490, glutamine amidotransferase; Provisional Back     alignment and domain information
>gnl|CDD|30467 COG0118, HisH, Glutamine amidotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|180812 PRK07053, PRK07053, glutamine amidotransferase; Provisional Back     alignment and domain information
>gnl|CDD|32254 COG2071, COG2071, Predicted glutamine amidotransferases [General function prediction only] Back     alignment and domain information
>gnl|CDD|36438 KOG1224, KOG1224, KOG1224, Para-aminobenzoate (PABA) synthase ABZ1 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|183878 PRK13181, hisH, imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>gnl|CDD|172505 PRK14004, hisH, imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>gnl|CDD|183877 PRK13170, hisH, imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>gnl|CDD|183871 PRK13146, hisH, imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>gnl|CDD|116336 pfam07722, Peptidase_C26, Peptidase C26 Back     alignment and domain information
>gnl|CDD|181035 PRK07567, PRK07567, glutamine amidotransferase; Provisional Back     alignment and domain information
>gnl|CDD|162563 TIGR01855, IMP_synth_hisH, imidazole glycerol phosphate synthase, glutamine amidotransferase subunit Back     alignment and domain information
>gnl|CDD|171876 PRK13152, hisH, imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>gnl|CDD|181066 PRK07649, PRK07649, para-aminobenzoate/anthranilate synthase glutamine amidotransferase component II; Validated Back     alignment and domain information
>gnl|CDD|180689 PRK06774, PRK06774, para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>gnl|CDD|153216 cd01745, GATase1_2, Subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain Back     alignment and domain information
>gnl|CDD|178226 PLN02617, PLN02617, imidazole glycerol phosphate synthase hisHF Back     alignment and domain information
>gnl|CDD|30386 COG0037, MesJ, Predicted ATPase of the PP-loop superfamily implicated in cell cycle control [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|30166 cd00553, NAD_synthase, NAD+ synthase is a homodimer, which catalyzes the final step in de novo nicotinamide adenine dinucleotide (NAD+) biosynthesis, an amide transfer from either ammonia or glutamine to nicotinic acid adenine dinucleotide (NaAD) Back     alignment and domain information
>gnl|CDD|30520 COG0171, NadE, NAD synthase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|30167 cd01712, ThiI, ThiI is required for thiazole synthesis in the thiamine biosynthesis pathway Back     alignment and domain information
>gnl|CDD|30180 cd01993, Alpha_ANH_like_II, This is a subfamily of Adenine nucleotide alpha hydrolases superfamily Back     alignment and domain information
>gnl|CDD|145596 pfam02540, NAD_synthase, NAD synthase Back     alignment and domain information
>gnl|CDD|183597 PRK12564, PRK12564, carbamoyl phosphate synthase small subunit; Reviewed Back     alignment and domain information
>gnl|CDD|35591 KOG0370, KOG0370, KOG0370, Multifunctional pyrimidine synthesis protein CAD (includes carbamoyl-phophate synthetase, aspartate transcarbamylase, and glutamine amidotransferase) [General function prediction only] Back     alignment and domain information
>gnl|CDD|178370 PLN02771, PLN02771, carbamoyl-phosphate synthase (glutamine-hydrolyzing) Back     alignment and domain information
>gnl|CDD|153210 cd01653, GATase1, Type 1 glutamine amidotransferase (GATase1)-like domain Back     alignment and domain information
>gnl|CDD|153222 cd03128, GAT_1, Type 1 glutamine amidotransferase (GATase1)-like domain Back     alignment and domain information
>gnl|CDD|30177 cd01990, Alpha_ANH_like_I, This is a subfamily of Adenine nucleotide alpha hydrolases superfamily Back     alignment and domain information
>gnl|CDD|31794 COG1606, COG1606, ATP-utilizing enzymes of the PP-loop superfamily [General function prediction only] Back     alignment and domain information
>gnl|CDD|30183 cd01996, Alpha_ANH_like_III, This is a subfamily of Adenine nucleotide alpha hydrolases superfamily Back     alignment and domain information
>gnl|CDD|163334 TIGR03573, WbuX, N-acetyl sugar amidotransferase Back     alignment and domain information
>gnl|CDD|184435 PRK13980, PRK13980, NAD synthetase; Provisional Back     alignment and domain information
>gnl|CDD|178898 PRK00143, mnmA, tRNA-specific 2-thiouridylase MnmA; Reviewed Back     alignment and domain information
>gnl|CDD|145938 pfam03054, tRNA_Me_trans, tRNA methyl transferase Back     alignment and domain information
>gnl|CDD|30830 COG0482, TrmU, Predicted tRNA(5-methylaminomethyl-2-thiouridylate) methyltransferase, contains the PP-loop ATPase domain [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|30185 cd01998, tRNA_Me_trans, tRNA methyl transferase Back     alignment and domain information
>gnl|CDD|30179 cd01992, PP-ATPase, N-terminal domain of predicted ATPase of the PP-loop faimly implicated in cell cycle control [Cell division and chromosome partitioning] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 520 GMP synthase [Candidatus Liberibacter asiaticus str. ps
PRK00074513 guaA GMP synthase; Reviewed 100.0
KOG1622552 consensus 100.0
TIGR00884319 guaA_Cterm GMP synthase, C-terminal domain; InterPro: I 100.0
COG0519315 GuaA GMP synthase, PP-ATPase domain/subunit [Nucleotide 100.0
PRK00919306 GMP synthase subunit B; Validated 100.0
cd01997295 GMP_synthase_C The C-terminal domain of GMP synthetase. 100.0
TIGR02039295 CysD sulfate adenylyltransferase, small subunit; InterP 94.59
TIGR00888195 guaA_Nterm GMP synthase, N-terminal domain; InterPro: I 100.0
PRK07765221 para-aminobenzoate synthase component II; Provisional 100.0
COG0518198 GuaA GMP synthase - Glutamine amidotransferase domain [ 100.0
CHL00101190 trpG anthranilate synthase component 2 100.0
PRK05670192 anthranilate synthase component II; Provisional 100.0
PRK08857192 para-aminobenzoate synthase component II; Provisional 100.0
PRK06895191 para-aminobenzoate synthase component II; Provisional 100.0
cd01743184 GATase1_Anthranilate_Synthase Type 1 glutamine amidotra 100.0
PRK07649195 para-aminobenzoate/anthranilate synthase glutamine amid 100.0
PRK00758184 GMP synthase subunit A; Validated 100.0
PRK08007187 para-aminobenzoate synthase component II; Provisional 100.0
cd01742181 GATase1_GMP_Synthase Type 1 glutamine amidotransferase 100.0
PRK06774191 para-aminobenzoate synthase component II; Provisional 100.0
cd01744178 GATase1_CPSase Small chain of the glutamine-dependent f 100.0
pfam00117187 GATase Glutamine amidotransferase class-I. 100.0
PRK05637208 anthranilate synthase component II; Provisional 100.0
PRK13143201 hisH imidazole glycerol phosphate synthase subunit HisH 100.0
PRK13181199 hisH imidazole glycerol phosphate synthase subunit HisH 100.0
COG0512191 PabA Anthranilate/para-aminobenzoate synthases componen 100.0
PRK13566724 anthranilate synthase; Provisional 100.0
cd01748198 GATase1_IGP_Synthase Type 1 glutamine amidotransferase 100.0
TIGR01368383 CPSaseIIsmall carbamoyl-phosphate synthase, small subun 100.0
PRK13175206 consensus 100.0
PRK09065238 glutamine amidotransferase; Provisional 100.0
PRK12564355 carbamoyl phosphate synthase small subunit; Reviewed 99.97
cd01741188 GATase1_1 Subgroup of proteins having the Type 1 glutam 99.97
PRK13141204 hisH imidazole glycerol phosphate synthase subunit HisH 99.97
CHL00197383 carA carbamoyl-phosphate synthase arginine-specific sma 99.97
PRK07053235 glutamine amidotransferase; Provisional 99.97
PRK12838356 carbamoyl phosphate synthase small subunit; Reviewed 99.97
PRK06490243 glutamine amidotransferase; Provisional 99.96
PRK08250235 glutamine amidotransferase; Provisional 99.96
COG0505368 CarA Carbamoylphosphate synthase small subunit [Amino a 99.96
TIGR00566212 trpG_papA glutamine amidotransferase of anthranilate sy 99.96
TIGR01815726 TrpE-clade3 anthranilate synthase; InterPro: IPR010112 99.95
PRK13180209 consensus 99.95
PRK13146208 hisH imidazole glycerol phosphate synthase subunit HisH 99.94
PRK13152201 hisH imidazole glycerol phosphate synthase subunit HisH 99.94
PRK13153203 consensus 99.94
PRK13176216 consensus 99.93
PRK13178213 consensus 99.93
PRK13174212 consensus 99.93
KOG0026223 consensus 99.93
PRK13177207 consensus 99.92
PRK13171200 consensus 99.92
PRK13170196 hisH imidazole glycerol phosphate synthase subunit HisH 99.91
PRK11366254 puuD gamma-glutamyl-gamma-aminobutyrate hydrolase; Prov 99.91
pfam07722219 Peptidase_C26 Peptidase C26. These peptidases have gamm 99.9
PRK13148225 consensus 99.89
COG0118204 HisH Glutamine amidotransferase [Amino acid transport a 99.89
COG2071243 Predicted glutamine amidotransferases [General function 99.88
cd01745189 GATase1_2 Subgroup of proteins having the Type 1 glutam 99.88
PRK13179207 consensus 99.87
PRK13173211 consensus 99.87
KOG1224 767 consensus 99.87
CHL00188210 hisH imidazole glycerol phosphate synthase subunit hisH 99.87
TIGR01855211 IMP_synth_hisH imidazole glycerol phosphate synthase, g 99.87
PRK13147211 consensus 99.87
TIGR01823 851 PabB-fungal para-aminobenzoate synthase; InterPro: IPR0 99.86
PRK13172213 consensus 99.86
PRK13151195 consensus 99.85
PRK13144190 consensus 99.85
PRK13527196 glutamine amidotransferase subunit PdxT; Provisional 99.8
PRK13525191 glutamine amidotransferase subunit PdxT; Provisional 99.8
PRK13142192 hisH imidazole glycerol phosphate synthase subunit HisH 99.77
KOG3179245 consensus 99.76
pfam01174188 SNO SNO glutamine amidotransferase family. This family 99.73
cd01749183 GATase1_PB Glutamine Amidotransferase (GATase_I) involv 99.69
cd01747273 GATase1_Glutamyl_Hydrolase Type 1 glutamine amidotransf 99.53
KOG0623541 consensus 99.33
PRK01175255 phosphoribosylformylglycinamidine synthase subunit I; P 99.15
PRK03619223 phosphoribosylformylglycinamidine synthase subunit I; P 99.13
cd01740238 GATase1_FGAR_AT Type 1 glutamine amidotransferase (GATa 99.05
COG0047231 PurL Phosphoribosylformylglycinamidine (FGAM) synthase, 98.98
TIGR01737264 FGAM_synth_I phosphoribosylformylglycinamidine synthase 98.84
PRK13526179 glutamine amidotransferase subunit PdxT; Provisional 98.57
COG0311194 PDX2 Predicted glutamine amidotransferase involved in p 98.28
KOG1559340 consensus 98.2
cd03130198 GATase1_CobB Type 1 glutamine amidotransferase (GATase1 97.59
COG1492486 CobQ Cobyric acid synthase [Coenzyme metabolism] 97.19
COG1897307 MetA Homoserine trans-succinylase [Amino acid transport 96.81
TIGR017351401 FGAM_synt phosphoribosylformylglycinamidine synthase; I 96.52
TIGR018571279 FGAM-synthase phosphoribosylformylglycinamidine synthas 96.41
COG3442250 Predicted glutamine amidotransferase [General function 95.64
PRK09522531 bifunctional anthranilate synthase/anthranilate phospho 100.0
pfam0095893 GMP_synt_C GMP synthase C terminal domain. GMP syntheta 100.0
cd01990202 Alpha_ANH_like_I This is a subfamily of Adenine nucleot 100.0
cd00553248 NAD_synthase NAD+ synthase is a homodimer, which cataly 99.7
COG1606269 ATP-utilizing enzymes of the PP-loop superfamily [Gener 99.48
PRK08349198 hypothetical protein; Validated 98.89
COG0301383 ThiI Thiamine biosynthesis ATP pyrophosphatase [Coenzym 98.5
COG0603222 Predicted PP-loop superfamily ATPase [General function 98.03
PRK12563312 sulfate adenylyltransferase subunit 2; Provisional 96.45
PRK05665240 amidotransferase; Provisional 99.97
KOG0370 1435 consensus 99.92
PRK06278482 cobyrinic acid a,c-diamide synthase; Validated 97.45
PRK07567242 glutamine amidotransferase; Provisional 99.96
PRK06186229 hypothetical protein; Validated 99.38
cd01746235 GATase1_CTP_Synthase Type 1 glutamine amidotransferase 99.37
TIGR00337571 PyrG CTP synthase; InterPro: IPR004468 CTP synthase is 99.33
PRK05380534 pyrG CTP synthetase; Validated 99.29
COG0504533 PyrG CTP synthase (UTP-ammonia lyase) [Nucleotide trans 99.26
pfam04204298 HTS Homoserine O-succinyltransferase. 98.48
PRK05368302 homoserine O-succinyltransferase; Provisional 98.4
TIGR01001305 metA homoserine O-succinyltransferase; InterPro: IPR005 97.43
pfam02540243 NAD_synthase NAD synthase. NAD synthase (EC:6.3.5.1) is 99.85
PRK00143355 trmU tRNA (5-methylaminomethyl-2-thiouridylate)-methylt 99.66
PRK00876325 nadE NAD synthetase; Reviewed 99.65
cd01998349 tRNA_Me_trans tRNA methyl transferase. This family repr 99.63
PRK13980264 NAD synthetase; Provisional 99.62
pfam03054354 tRNA_Me_trans tRNA methyl transferase. This family repr 99.61
PRK00768274 nadE NAD synthetase; Reviewed 99.6
COG0482356 TrmU Predicted tRNA(5-methylaminomethyl-2-thiouridylate 99.52
TIGR00420394 trmU tRNA (5-methylaminomethyl-2-thiouridylate)-methylt 99.47
PTZ00323294 NAD+ synthase; Provisional 99.44
COG0171268 NadE NAD synthase [Coenzyme metabolism] 99.38
KOG2805377 consensus 99.32
cd01712177 ThiI ThiI is required for thiazole synthesis in the thi 99.27
pfam02568197 ThiI Thiamine biosynthesis protein (ThiI). ThiI is requ 99.25
COG0037298 MesJ tRNA(Ile)-lysidine synthase MesJ [Cell cycle contr 99.24
pfam01171182 ATP_bind_3 PP-loop family. This family of proteins belo 99.21
cd01993185 Alpha_ANH_like_II This is a subfamily of Adenine nucleo 99.16
cd01992185 PP-ATPase N-terminal domain of predicted ATPase of the 99.08
PRK13981543 NAD synthetase; Provisional 98.95
TIGR00552286 nadE NAD+ synthetase; InterPro: IPR003694 NAD+ synthase 98.95
PRK10660 433 tilS tRNA(Ile)-lysidine synthetase; Provisional 98.86
PRK13794473 hypothetical protein; Provisional 98.82
PRK01565399 thiamine biosynthesis protein ThiI; Provisional 98.62
PRK08557420 hypothetical protein; Provisional 98.6
TIGR02432204 lysidine_TilS_N tRNA(Ile)-lysidine synthetase; InterPro 98.55
PRK01269483 thiamine biosynthesis protein ThiI; Provisional 98.54
cd01995169 ExsB ExsB is a transcription regulator related protein. 98.53
PRK08576439 hypothetical protein; Provisional 98.38
PRK11106231 queuosine biosynthesis protein QueC; Provisional 98.3
cd01713173 PAPS_reductase This domain is found in phosphoadenosine 98.29
pfam01507174 PAPS_reduct Phosphoadenosine phosphosulfate reductase f 98.29
PRK10696311 C32 tRNA thiolase; Provisional 98.21
PRK04527 397 argininosuccinate synthase; Provisional 98.13
PRK13820 395 argininosuccinate synthase; Provisional 98.12
TIGR00342391 TIGR00342 thiamine biosynthesis/tRNA modification prote 98.03
PRK05370 447 argininosuccinate synthase; Validated 97.9
COG0175261 CysH 3'-phosphoadenosine 5'-phosphosulfate sulfotransfe 97.82
PRK02628678 nadE NAD synthetase; Reviewed 97.71
PRK08384310 thiamine biosynthesis protein ThiI; Provisional 97.66
COG0137 403 ArgG Argininosuccinate synthase [Amino acid transport a 97.44
TIGR00032 420 argG argininosuccinate synthase; InterPro: IPR001518 Ar 97.29
COG1365255 Predicted ATPase (PP-loop superfamily) [General functio 97.27
PRK02090243 phosphoadenosine phosphosulfate reductase; Provisional 97.07
TIGR00364227 TIGR00364 exsB protein; InterPro: IPR004479 This protei 96.28
COG2117198 Predicted subunit of tRNA(5-methylaminomethyl-2-thiouri 91.94
TIGR00268263 TIGR00268 conserved hypothetical protein TIGR00268; Int 99.25
PRK06850 488 hypothetical protein; Provisional 94.23
TIGR03183 447 DNA_S_dndC putative sulfurtransferase DndC. Members of 90.74
PRK13795630 hypothetical protein; Provisional 98.79
pfam00733195 Asn_synthase Asparagine synthase. This family is always 98.01
cd01991269 Asn_Synthase_B_C The C-terminal domain of Asparagine Sy 97.75
TIGR03104589 trio_amidotrans asparagine synthase family amidotransfe 97.47
PRK09431555 asnB asparagine synthetase B; Provisional 97.08
TIGR01536646 asn_synth_AEB asparagine synthase (glutamine-hydrolyzin 96.89
cd01994194 Alpha_ANH_like_IV This is a subfamily of Adenine nucleo 94.01
KOG2840347 consensus 93.82
KOG1706412 consensus 91.23
KOG2387585 consensus 98.75
TIGR03573343 WbuX N-acetyl sugar amidotransferase. This enzyme has b 98.61
pfam06508137 ExsB ExsB. This family includes putative transcriptiona 98.47
PRK00509398 argininosuccinate synthase; Provisional 98.26
cd01996154 Alpha_ANH_like_III This is a subfamily of Adenine nucle 98.2
cd01999385 Argininosuccinate_Synthase Argininosuccinate synthase. 97.63
COG0367542 AsnB Asparagine synthase (glutamine-hydrolyzing) [Amino 97.13
cd01986103 Alpha_ANH_like Adenine nucleotide alpha hydrolases supe 98.55
cd0198486 AANH_like Adenine nucleotide alpha hydrolases superfami 97.62
PRK05253300 sulfate adenylyltransferase subunit 2; Provisional 96.31
COG2102223 Predicted ATPases of PP-loop superfamily [General funct 94.71
pfam01902219 ATP_bind_4 ATP-binding region. This family of proteins 91.3
PRK01077451 cobyrinic acid a,c-diamide synthase; Validated 98.13
pfam00764389 Arginosuc_synth Arginosuccinate synthase. This family c 97.93
PRK05297 1294 phosphoribosylformylglycinamidine synthase; Provisional 97.92
TIGR03108628 eps_aminotran_1 exosortase 1 system-associated amidotra 97.83
cd01750194 GATase1_CobQ Type 1 glutamine amidotransferase (GATase1 97.76
cd01653115 GATase1 Type 1 glutamine amidotransferase (GATase1)-lik 97.24
PRK00784492 cobyric acid synthase; Provisional 97.06
TIGR00313502 cobQ cobyric acid synthase CobQ; InterPro: IPR004459 Co 97.03
cd0312892 GAT_1 Type 1 glutamine amidotransferase (GATase1)-like 97.0
TIGR01382189 PfpI intracellular protease, PfpI family; InterPro: IPR 96.96
KOG3210226 consensus 96.54
TIGR00649593 MG423 conserved hypothetical protein; InterPro: IPR0046 92.57
cd03132142 GATase1_catalase Type 1 glutamine amidotransferase (GAT 92.2
pfam07685158 GATase_3 CobB/CobQ-like glutamine amidotransferase doma 97.63
cd03135163 GATase1_DJ-1 Type 1 glutamine amidotransferase (GATase1 95.37
cd03169180 GATase1_PfpI_1 Type 1 glutamine amidotransferase (GATas 93.51
pfam01965141 DJ-1_PfpI DJ-1/PfpI family. The family includes the pro 93.39
cd03140170 GATase1_PfpI_3 Type 1 glutamine amidotransferase (GATas 93.35
cd03134165 GATase1_PfpI_like A type 1 glutamine amidotransferase ( 92.27
COG0693188 ThiJ Putative intracellular protease/amidase [General f 90.53
cd03141221 GATase1_Hsp31_like Type 1 glutamine amidotransferase (G 90.41
cd03131175 GATase1_HTS Type 1 glutamine amidotransferase (GATase1) 97.43
PTZ00077610 asparagine synthetase; Provisional 96.78
KOG0573520 consensus 96.12
KOG1907 1320 consensus 95.68
PRK13896432 cobyrinic acid a,c-diamide synthase; Provisional 93.91
>PRK00074 guaA GMP synthase; Reviewed Back     alignment and domain information
>KOG1622 consensus Back     alignment and domain information
>TIGR00884 guaA_Cterm GMP synthase, C-terminal domain; InterPro: IPR001674 The amidotransferase family of enzymes utilises the ammonia derived from the hydrolysis of glutamine for a subsequent chemical reaction catalyzed by the same enzyme Back     alignment and domain information
>COG0519 GuaA GMP synthase, PP-ATPase domain/subunit [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK00919 GMP synthase subunit B; Validated Back     alignment and domain information
>cd01997 GMP_synthase_C The C-terminal domain of GMP synthetase Back     alignment and domain information
>TIGR02039 CysD sulfate adenylyltransferase, small subunit; InterPro: IPR011784 Metabolic assimilation of sulphur from inorganic sulphate, requires sulphate activation by coupling to a nucleoside, for the production of high-energy nucleoside phosphosulphates Back     alignment and domain information
>TIGR00888 guaA_Nterm GMP synthase, N-terminal domain; InterPro: IPR004739 The N-terminal region of GMP synthase 6 Back     alignment and domain information
>PRK07765 para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>COG0518 GuaA GMP synthase - Glutamine amidotransferase domain [Nucleotide transport and metabolism] Back     alignment and domain information
>CHL00101 trpG anthranilate synthase component 2 Back     alignment and domain information
>PRK05670 anthranilate synthase component II; Provisional Back     alignment and domain information
>PRK08857 para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>PRK06895 para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>cd01743 GATase1_Anthranilate_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in Anthranilate synthase Back     alignment and domain information
>PRK07649 para-aminobenzoate/anthranilate synthase glutamine amidotransferase component II; Validated Back     alignment and domain information
>PRK00758 GMP synthase subunit A; Validated Back     alignment and domain information
>PRK08007 para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>cd01742 GATase1_GMP_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in GMP synthetase Back     alignment and domain information
>PRK06774 para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>cd01744 GATase1_CPSase Small chain of the glutamine-dependent form of carbamoyl phosphate synthase, CPSase II Back     alignment and domain information
>pfam00117 GATase Glutamine amidotransferase class-I Back     alignment and domain information
>PRK05637 anthranilate synthase component II; Provisional Back     alignment and domain information
>PRK13143 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>PRK13181 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>COG0512 PabA Anthranilate/para-aminobenzoate synthases component II [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PRK13566 anthranilate synthase; Provisional Back     alignment and domain information
>cd01748 GATase1_IGP_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in imidazole glycerol phosphate synthase (IGPS) Back     alignment and domain information
>TIGR01368 CPSaseIIsmall carbamoyl-phosphate synthase, small subunit; InterPro: IPR006274 Carbamoyl phosphate synthase (CPSase) is a heterodimeric enzyme composed of a small and a large subunit (with the exception of CPSase III, see below) Back     alignment and domain information
>PRK13175 consensus Back     alignment and domain information
>PRK09065 glutamine amidotransferase; Provisional Back     alignment and domain information
>PRK12564 carbamoyl phosphate synthase small subunit; Reviewed Back     alignment and domain information
>cd01741 GATase1_1 Subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain Back     alignment and domain information
>PRK13141 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>CHL00197 carA carbamoyl-phosphate synthase arginine-specific small subunit; Provisional Back     alignment and domain information
>PRK07053 glutamine amidotransferase; Provisional Back     alignment and domain information
>PRK12838 carbamoyl phosphate synthase small subunit; Reviewed Back     alignment and domain information
>PRK06490 glutamine amidotransferase; Provisional Back     alignment and domain information
>PRK08250 glutamine amidotransferase; Provisional Back     alignment and domain information
>COG0505 CarA Carbamoylphosphate synthase small subunit [Amino acid transport and metabolism / Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR00566 trpG_papA glutamine amidotransferase of anthranilate synthase or para-aminobenzoate synthase; InterPro: IPR006221 This entry presents the glutamine amidotransferase domain or peptide of the tryptophan-biosynthetic pathway enzyme anthranilate synthase or of the folate biosynthetic pathway enzyme para-aminobenzoate synthase Back     alignment and domain information
>TIGR01815 TrpE-clade3 anthranilate synthase; InterPro: IPR010112 This entry represents a small clade of anthranilate synthases from alpha proteobacteria and Nostoc (a cyanobacterium) Back     alignment and domain information
>PRK13180 consensus Back     alignment and domain information
>PRK13146 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>PRK13152 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>PRK13153 consensus Back     alignment and domain information
>PRK13176 consensus Back     alignment and domain information
>PRK13178 consensus Back     alignment and domain information
>PRK13174 consensus Back     alignment and domain information
>KOG0026 consensus Back     alignment and domain information
>PRK13177 consensus Back     alignment and domain information
>PRK13171 consensus Back     alignment and domain information
>PRK13170 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>PRK11366 puuD gamma-glutamyl-gamma-aminobutyrate hydrolase; Provisional Back     alignment and domain information
>pfam07722 Peptidase_C26 Peptidase C26 Back     alignment and domain information
>PRK13148 consensus Back     alignment and domain information
>COG0118 HisH Glutamine amidotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>COG2071 Predicted glutamine amidotransferases [General function prediction only] Back     alignment and domain information
>cd01745 GATase1_2 Subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain Back     alignment and domain information
>PRK13179 consensus Back     alignment and domain information
>PRK13173 consensus Back     alignment and domain information
>KOG1224 consensus Back     alignment and domain information
>CHL00188 hisH imidazole glycerol phosphate synthase subunit hisH; Provisional Back     alignment and domain information
>TIGR01855 IMP_synth_hisH imidazole glycerol phosphate synthase, glutamine amidotransferase subunit; InterPro: IPR010139 Imidazole glycerol phosphate synthetase (IGPS) is a key metabolic enzyme, which links amino acid and nucleotide biosynthesis: it catalyses the closure of the imidazole ring within histidine biosynthesis (fifth step), and provides the substrate for de novo purine biosynthesis Back     alignment and domain information
>PRK13147 consensus Back     alignment and domain information
>TIGR01823 PabB-fungal para-aminobenzoate synthase; InterPro: IPR010117 This entry represents the fungal clade of para-aminobenzoate synthase, which acts on chorismate to form para-aminobenzoic acid (PABA), a precursor of folate Back     alignment and domain information
>PRK13172 consensus Back     alignment and domain information
>PRK13151 consensus Back     alignment and domain information
>PRK13144 consensus Back     alignment and domain information
>PRK13527 glutamine amidotransferase subunit PdxT; Provisional Back     alignment and domain information
>PRK13525 glutamine amidotransferase subunit PdxT; Provisional Back     alignment and domain information
>PRK13142 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>KOG3179 consensus Back     alignment and domain information
>pfam01174 SNO SNO glutamine amidotransferase family Back     alignment and domain information
>cd01749 GATase1_PB Glutamine Amidotransferase (GATase_I) involved in pyridoxine biosynthesis Back     alignment and domain information
>cd01747 GATase1_Glutamyl_Hydrolase Type 1 glutamine amidotransferase (GATase1) domain found in gamma-Glutamyl Hydrolase Back     alignment and domain information
>KOG0623 consensus Back     alignment and domain information
>PRK01175 phosphoribosylformylglycinamidine synthase subunit I; Provisional Back     alignment and domain information
>PRK03619 phosphoribosylformylglycinamidine synthase subunit I; Provisional Back     alignment and domain information
>cd01740 GATase1_FGAR_AT Type 1 glutamine amidotransferase (GATase1)-like domain found in Formylglycinamide ribonucleotide amidotransferase Back     alignment and domain information
>COG0047 PurL Phosphoribosylformylglycinamidine (FGAM) synthase, glutamine amidotransferase domain [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR01737 FGAM_synth_I phosphoribosylformylglycinamidine synthase I; InterPro: IPR010075 In some species, phosphoribosylformylglycinamidine synthase is composed of a single polypeptide chain Back     alignment and domain information
>PRK13526 glutamine amidotransferase subunit PdxT; Provisional Back     alignment and domain information
>COG0311 PDX2 Predicted glutamine amidotransferase involved in pyridoxine biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG1559 consensus Back     alignment and domain information
>cd03130 GATase1_CobB Type 1 glutamine amidotransferase (GATase1) domain found in Cobyrinic Acid a,c-Diamide Synthase Back     alignment and domain information
>COG1492 CobQ Cobyric acid synthase [Coenzyme metabolism] Back     alignment and domain information
>COG1897 MetA Homoserine trans-succinylase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01735 FGAM_synt phosphoribosylformylglycinamidine synthase; InterPro: IPR010073 This entry represents a single-molecule form of phosphoribosylformylglycinamidine synthase, also called FGAM synthase, an enzyme of purine de novo biosynthesis Back     alignment and domain information
>TIGR01857 FGAM-synthase phosphoribosylformylglycinamidine synthase; InterPro: IPR010141 This entry represents a single-molecule form of phosphoribosylformylglycinamidine synthase, also called FGAM synthase, an enzyme of purine de novo biosynthesis, which represent a second clade of the enzymes found in Clostridia, Bifidobacteria and Streptococcus species Back     alignment and domain information
>COG3442 Predicted glutamine amidotransferase [General function prediction only] Back     alignment and domain information
>PRK09522 bifunctional anthranilate synthase/anthranilate phosphoribosyltransferase; Provisional Back     alignment and domain information
>pfam00958 GMP_synt_C GMP synthase C terminal domain Back     alignment and domain information
>cd01990 Alpha_ANH_like_I This is a subfamily of Adenine nucleotide alpha hydrolases superfamily Back     alignment and domain information
>cd00553 NAD_synthase NAD+ synthase is a homodimer, which catalyzes the final step in de novo nicotinamide adenine dinucleotide (NAD+) biosynthesis, an amide transfer from either ammonia or glutamine to nicotinic acid adenine dinucleotide (NaAD) Back     alignment and domain information
>COG1606 ATP-utilizing enzymes of the PP-loop superfamily [General function prediction only] Back     alignment and domain information
>PRK08349 hypothetical protein; Validated Back     alignment and domain information
>COG0301 ThiI Thiamine biosynthesis ATP pyrophosphatase [Coenzyme metabolism] Back     alignment and domain information
>COG0603 Predicted PP-loop superfamily ATPase [General function prediction only] Back     alignment and domain information
>PRK12563 sulfate adenylyltransferase subunit 2; Provisional Back     alignment and domain information
>PRK05665 amidotransferase; Provisional Back     alignment and domain information
>KOG0370 consensus Back     alignment and domain information