254780413

254780413

PAS/PAC sensor signal transduction histidine kinase

GeneID in NCBI database:8209399Locus tag:CLIBASIA_01490
Protein GI in NCBI database:254780413Protein Accession:YP_003064826.1
Gene range:+(314434, 316896)Protein Length:820aa
Gene description:PAS/PAC sensor signal transduction histidine kinase
COG prediction:[T] Signal transduction histidine kinase
KEGG prediction:PAS/PAC sensor signal transduction histidine kinase
SEED prediction:Sensory box histidine kinase
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVM1 TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820
MSTDSIISNPEDILTSNCKGNTQDLSKKKIDNGFETEKSKKENPCHDSFEQSNFTDQNQESVSNTNYLDSENTFVFDPIPRTVRFTWNIDAHGYLKEISEELPKTIGNYAFKMIGMRLCDVSDILHIDPNNHIGDLLKRQNTWYGKTTLWPIEGTNLYVPIDLAALPIYSRNREFSGFRGFGIVHVNRVDNDPRALGKRLDKKFSHLHEIKKGHSSVEKEKYDIFSQQSPPPHLRMKNKVSSLTEYYAHKDDVLKTEKYPLLTSEESSLPEQEDFHTINLNQYTKKQYFGTLQNNSKESFEYLSHRNHPSLSAYFDEGENLTPETVDKCPIPFFVYSHGNLFYANPSFLLLTKYKSVDDIEIAGGLSTLLDAPKLSDNNAIKPVMLYRSDRTCIAASARLHTIQWNRENSLAMTFIPFEKANQFPENMPQNGIEPEDVDTRINKRKMEIEVMQLCSILEATSDGIAIINREGIILSTNRAVSKLFGYPVEDILRKPFTVFLEQNTPSVMNHYLTEILSLDLRQTLEKITLGSTKEEKLLSLRIIIKKLPFSSCYSLTMHDISEWKQEKNKLSHAKKIAEKESSHKSDFLARVSHEIRTPLTAIIGFSEVIKNQRFGPLGNPRYIEYANYIDRSGNLVLDIVNDLLDISKIESGKMNLHFEPVSLDEAVSEAISLVQLYANEKRILIRTSFANNIPRILADLRSVKQIALNILSNAIHFTPSGGQIIISTTHTSNEEVILRVRDTGVGMTNYELEKAMKPFGQIPNSQQIRGEGTGLGLPLAKAMVDANMGKFYIFSTPAKGTLIEIIFPLYDTSHPHDCI
cccccccccHHHHHcccccccHHHHHHHHHHcccccccccccccccHHHHHccccccccHHcccccccccccEEEcccccccEEEEEEEcccccEEEEEcHHHHHHcccHHHHccccHHHHHHHccccHHHHHHHHHHccccccccEEEcccccccEEEEEEEcccccccccccccccccEEEEEcccccccHHHHHHHHcccccHHHHcccccccccHHHccccccccccHHHHHHHHHHHcccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEccccEEEEccHHHHHHHccccHHHHHHccccccEEccccccccccHHHHHHHHHHcccccccEEEEEEEEcccccEEEEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEccccEEEEEcHHHHHHHcccHHHHccccHHHHHHccHHHHHHHHHHHHHHHccccccEEEEEEccccEEEEEEEEEccccccccEEEcccccccccccccccccccccccccccccccccHHHHHHHHcccccHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHcccccccHHHHccHHHHHHHHHHHHHHHccccEEEEEEEEccccccccccccHHHHHHHHHHccccEEcccccEEEEEEEEccccEEEEEEEEccccccHHHHHHHccccEEccccccccccccHHHHHHHHHHHHHHccEEEEEEEccccEEEEEEEEccccccccccc
cccccEcccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccEEEEEEEcccccEEEccHHHHHHHcccHHHHccccHHHHHHHHcccccHHHHHHHHccccccccEEEcccccccccccHHHHcccccccccccccccccEEEEHHHccccHHHHcHHHHcccccccccccccccccccccccccccccccccccccccccccccccHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHcccHHHHHHHHHHccccEEEEEccccEEEEcHHHHHHHcccHHHHHHcccccHHHcccHHHcHHHcccEEEEEccccccEEEEEEEEEEEccccEEEEEEEEccccccccccEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEccccEEEEccHHHHHHHcccHHHHHcccHHHHcccccHHHHHHHHHHHHHcccccEEEEEEEEcccccEEEEEEEEEcccccccEEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEccccHHHHHHHHHHHHHHHHHHcccEEEEEccccccEEEccHHHHHHHHHHHHHHHEEEcccccEEEEEEEEccccEEEEEEEEccccccHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHcccEEEEEEcccccEEEEEEEEccccccccccc
mstdsiisnpediltsnckgntqdlskkkidngfetekskkenpchdsfeqsnftdqnqesvsntnyldsentfvfdpiprtvrftwnidAHGYLKEISEELPKTIGNYAFKMIGMRLCdvsdilhidpnnhigdLLKRqntwygkttlwpiegtnlyvpidlaalpiysrnrefsgfrgfgivhvnrvdndpralgKRLDKKFSHLHEIkkghssvekekydifsqqsppphlrmknkVSSLTEYyahkddvlktekyplltseesslpeqedfhtinlnqyTKKQyfgtlqnnskesfeylshrnhpslsayfdegenltpetvdkcpipffvyshgnlfyanpsFLLLTkyksvddieiagglstlldapklsdnnaikpvmlyrsdrtcIAASARLHTIQWNrenslamtfipfekanqfpenmpqngiepedvdtRINKRKMEIEVMQLCSILEATSDGIAIINREGIILSTNRAVsklfgypvedilrkpftvfleqntpsvMNHYLTEILSLDLRQTLEKitlgstkeEKLLSLRIIIKklpfsscysltmhDISEWKQEKNKLSHAKKIAEkesshksdFLARVSHEIRTPLTAIIGFSEviknqrfgplgnpryieyANYIDRSGNLVLDIVNDLLDISkiesgkmnlhfepvsLDEAVSEAISLVQLYANEKRILIRTSFANNIPRILADLRSVKQIALNILSnaihftpsggqIIIStthtsneeVILRVRDTGVGMTNYELEKamkpfgqipnsqqirgegtglglPLAKAMVDANmgkfyifstpakgtlIEIIfplydtshphdci
mstdsiisnpediltsnckgntqdlskKKIDNGFetekskkenpchdsfeqsnftdqnqESVSNTNYLDSENTFVFDPIPRTVRFTWNIDAHGYLKEISEELPKTIGNYAFKMIGMRLCDVSDILHIDPNNHIGDLLKRQNTWYGKTTLWPIEGTNLYVPIDLAALPIYSRNREFSGFRGFGIvhvnrvdndpraLGKRLDKKFSHLHEIkkghssvekekydifsqqsppphlRMKNKVSSLTEYYAHKDDVLKTEKYPLLTseesslpeqedfHTINLNQYTKKQYFGTLQNNSKESFEYLSHRNHPSLSAYFDEGENLTPETVDKCPIPFFVYSHGNLFYANPSFLLLTKYKSVDDIEIAGGlstlldapklsDNNAIKPVMLYRSDRTCIAASARLHTIQWNRENSLAMTFIPFEKANQFPENMPQNGIEPEDVDTRINKRKMEIEVMQLCSILEATSDGIAIINREGIILSTNRAVSKLFGYPVEDILRKPFTVFLEQNTPSVMNHYLTEILSLDLRQTLEKItlgstkeekllSLRIIIKKLPFSSCYSLTMHDISEWKQEKNKLSHAKKiaekesshksdflaRVSHEIRTPLTAIIGFSEVIKNQRFGPLGNPRYIEYANYIDRSGNLVLDIVNDLLDISKIESGKMNLHFEPVSLDEAVSEAISLVQLYANEKRILIRTSFANNIPRILADLRSVKQIALNILSNAIHFTPSGGQIIIStthtsneeviLRVRDTGVGMTNYELEKAMKPFGQIPNSQQIRGEGTGLGLPLAKAMVDANMGKFYIFSTPAKGTLIEIIFPlydtshphdci
MSTDSIISNPEDILTSNCKGNTQDLSKKKIDNGFETEKSKKENPCHDSFEQSNFTDQNQESVSNTNYLDSENTFVFDPIPRTVRFTWNIDAHGYLKEISEELPKTIGNYAFKMIGMRLCDVSDILHIDPNNHIGDLLKRQNTWYGKTTLWPIEGTNLYVPIDLAALPIYSRNREFSGFRGFGIVHVNRVDNDPRALGKRLDKKFSHLHEIKKGHSSVEKEKYDIFSQQSPPPHLRMKNKVSSLTEYYAHKDDVLKTEKYPLLTSEESSLPEQEDFHTINLNQYTKKQYFGTLQNNSKESFEYLSHRNHPSLSAYFDEGENLTPETVDKCPIPFFVYSHGNLFYANPSFLLLTKYKSVDDIEIAGGLSTLLDAPKLSDNNAIKPVMLYRSDRTCIAASARLHTIQWNRENSLAMTFIPFEKANQFPENMPQNGIEPEDVDTRINKRKMEIEVMQLCSILEATSDGIAIINREGIILSTNRAVSKLFGYPVEDILRKPFTVFLEQNTPSVMNHYLTEILSLDLRQTLEKITLGSTkeekllslriiikklPFSSCYSLTMHDISEWKQEKNKLSHAKKIAEKESSHKSDFLARVSHEIRTPLTAIIGFSEVIKNQRFGPLGNPRYIEYANYIDRSGnlvldivndlldiSKIESGKMNLHFEPVSLDEAVSEAISLVQLYANEKRILIRTSFANNIPRILADLRSVKQIALNILSNAIHFTPSGGQIIISTTHTSNEEVILRVRDTGVGMTNYELEKAMKPFGQIPNSQQIRGEGTGLGLPLAKAMVDANMGKFYIFSTPAKGTLIEIIFPLYDTSHPHDCI
*******************************************************************************PRTVRFTWNIDAHGYLKEISEELPKTIGNYAFKMIGMRLCDVSDILHIDPNNHIGDLLKRQNTWYGKTTLWPIEGTNLYVPIDLAALPIYSRNREFSGFRGFGIVHVNRVDNDP************************EKEKYDIFSQQSPPPHLRMKNKVSS**************************LPEQEDFHTINLN*****************************************PETVDKCPIPFFVYSHGNLFYANPSFLLLTKYKSVDDIEIAGGLSTLLDAPKLS***AIKPVMLYRSDRTCIAASARLHTIQWNRENSLAMTFIPFEKANQFPENMPQNGIEPEDVD************MQLCSILEATSDGIAIINREGIILSTNRAVSKLFGYPVEDILRKPFTVFLEQNTPSVMNHYLTEILSL*LRQTLEKITLGSTKEEKLLSLRIIIKKLPFSSCYSLTMHDISEWKQEKNKLSHAKKIAEKESSHKSDFLARVSHEIRTPLTAIIGFSEVIKNQRFGPLGNPRYIEYANYIDRSGNLVLDIVNDLLDISKIESGKMNLHFEPVSLDEAVSEAISLVQLYANEKRILIRTSFANNIPRILADLRSVKQIALNILSNAIHFTPSGGQIIISTTHTSNEEVILRVRDTGVGMTNYELEKAMKPFGQIPNS*QIRGEGTGLGLPLAKAMVDANMGKFYIFSTPAKGTLIEIIFPLYDT*******
********NPEDILTSNCKGNTQDLSKKKIDNGFETEKSKKENPCHDSFEQSNFTDQNQESVSNTNYLDSENTFVFDPIPRTVRFTWNIDAHGYLKEISEELPKTIGNYAFKMIGMRLCDVSDILHIDPNNHIGDLLKRQNTWYGKTTLWPIEGTNLYVPIDLAALPIYSRNREFSGFRGFGIVHVNRVDNDPRALGKRLDKKFSHLHEIKKGHSSVEKEKYDIFSQQSPPPHLRMKNKVSSLTEYYAHKDDVLKTEKYPLLTSEESSLPEQEDFHTINLNQYTKKQYFGTLQNNSKESFEYLSHRNHPSLSAYFDEGENLTPETVDKCPIPFFVYSHGNLFYANPSFLLLTKYKSVDDIEIAGGLSTLLDAPKLSDNNAIKPVMLYRSDRTCIAASARLHTIQWNRENSLAMTFIPFEKANQFPENMPQNGIEPEDVDTRINKRKMEIEVMQLCSILEATSDGIAIINREGIILSTNRAVSKLFGYPVEDILRKPFTVFLEQNTPSVMNHYLTEILSLDLRQTLEKITLGSTKEEKLLSLRIIIKKLPFSSCYSLTMHDISEWK*********************DFLARVSHEIRTPLTAIIGFSEVIKNQRFGPLGNPRYIEYANYIDRSGNLVLDIVNDLLDISKIESGKMNLHFEPVSLDEAVSEAISLVQLYANEKRILIRTSFANNIPRILADLRSVKQIALNILSNAIHFTPSGGQIIISTTHTSNEEVILRVRDTGVGMTNYELEKAMKPFGQIPNSQQIRGEGTGLGLPLAKAMVDANMGKFYIFSTPAKGTLIEIIFPLYDTSHPHDCI
*****IISNPEDILTSNCKG*TQ*LSK*******ET*************EQSN*******SVSNTNYLDSENTFVFDPIPRTVRFTWNIDAHGYLKEISEELPKTIGNYAFKMIGMRLCDVSDILHIDPNNHIGDLLKRQNTWYGKTTLWPIEGTNLYVPIDLAALPIYSRNREFSGFRGFGIVHVNRVDNDPRALGKRLDKKFSH*********************************VSSLTEYYA*KDDVLKTEKYPLLTSEESSLPEQEDFHTINLNQYTKKQYFGTLQNNSK*********NHPSLSAYFDEGENLTPETVDKCPIPFFVYSHGNLFYANPSFLLLTKYKSVDDIEIAGGLSTLLDAPKLSDNNAIKPVMLYRSDRTCIAASARLHTIQWNRENSLAMTFIPFEKANQFPENMPQNGIEPEDVDTRINKRKMEIEVMQLCSILEATSDGIAIINREGIILSTNRAVSKLFGYPVEDILRKPFTVFLEQNTPSVMNHYLTEILSLDLRQTLEKITLGSTKEEKLLSLRIIIKKLPFSSCYSLTMHDISEWKQEKNKLSHAKKIAEKESSHKSDFLARVSHEIRTPLTAIIGFSEVIKNQRFGPLGNPRYIEYANYIDRSGNLVLDIVNDLLDISKIESGKMNLHFEPVSLDEAVSEAISLVQLYANEKRILIRTSFANNIPRILADLRSVKQIALNILSNAIHFTPSGGQIIISTTHTSNEEVILRVRDTGVGMTNYELEKAMKPFGQIPNSQQIRGEGTGLGLPLAKAMVDANMGKFYIFSTPAKGTLIEIIFPLYDT*******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSTDSIISNPEDILTSNCKGNTQDLSKKKIDNGFETEKSKKENPCHDSFEQSNFTDQNQESVSNTNYLDSENTFVFDPIPRTVRFTWNIDAHGYLKEISEELPKTIGNYAFKMIGMRLCDVSDILHIDPNNHIGDLLKRQNTWYGKTTLWPIEGTNLYVPIDLAALPIYSRNREFSGFRGFGIVHVNRVDNDPRALGKRLDKKFSHLHEIKKGHSSVEKEKYDIFSQQSPPPHLRMKNKVSSLTEYYAHKDDVLKTEKYPLLTSEESSLPEQEDFHTINLNQYTKKQYFGTLQNNSKESFEYLSHRNHPSLSAYFDEGENLTPETVDKCPIPFFVYSHGNLFYANPSFLLLTKYKSVDDIEIAGGLSTLLDAPKLSDNNAIKPVMLYRSDRTCIAASARLHTIQWNRENSLAMTFIPFEKANQFPENMPQNGIEPEDVDTRINKRKMEIEVMQLCSILEATSDGIAIINREGIILSTNRAVSKLFGYPVEDILRKPFTVFLEQNTPSVMNHYLTEILSLDLRQTLEKITLGSTKEEKLLSLRIIIKKLPFSSCYSLTMHDxxxxxxxxxxxxxxxxxxxxxSSHKSDFLARVSHEIRTPLTAIIGFSEVIKNQRFGPLGNPRYIEYANYIDRSGNLVLDIVNDLLDISKIESGKMNLHFEPVSLDEAVSEAISLVQLYANEKRILIRTSFANNIPRILADLRSVKQIALNILSNAIHFTPSGGQIIISTTHTSNEEVILRVRDTGVGMTNYELEKAMKPFGQIPNSQQIRGEGTGLGLPLAKAMVDANMGKFYIFSTPAKGTLIEIIFPLYDTSHPHDCI
MSTDSIISNPEDILTSNCKGNTQDLSKKKIDNGFETEKSKKENPCHDSFEQSNFTDQNQESVSNTNYLDSENTFVFDPIPRTVRFTWNIDAHGYLKEISEELPKTIGNYAFKMIGMRLCDVSDILHIDPNNHIGDLLKRQNTWYGKTTLWPIEGTNLYVPIDLAALPIYSRNREFSGFRGFGIVHVNRVDNDPRALGKRLDKKFSHLHEIKKGHSSVEKEKYDIFSQQSPPPHLRMKNKVSSLTEYYAHKDDVLKTEKYPLLTSEESSLPEQEDFHTINLNQYTKKQYFGTLQNNSKESFEYLSHRNHPSLSAYFDEGENLTPETVDKCPIPFFVYSHGNLFYANPSFLLLTKYKSVDDIEIAGGLSTLLDAPKLSDNNAIKPVMLYRSDRTCIAASARLHTIQWNRENSLAMTFIPFEKANQFPENMPQNGIEPEDVDTRINKRKMEIEVMQLCSILEATSDGIAIINREGIILSTNRAVSKLFGYPVEDILRKPFTVFLEQNTPSVMNHYLTEILSLDLRQTLEKITLGSTKEEKLLSLRIIIKKLPFSSCYSLTMHDISEWKQEKNKLSHAKKIAEKESSHKSDFLARVSHEIRTPLTAIIGFSEVIKNQRFGPLGNPRYIEYANYIDRSGNLVLDIVNDLLDISKIESGKMNLHFEPVSLDEAVSEAISLVQLYANEKRILIRTSFANNIPRILADLRSVKQIALNILSNAIHFTPSGGQIIISTTHTSNEEVILRVRDTGVGMTNYELEKAMKPFGQIPNSQQIRGEGTGLGLPLAKAMVDANMGKFYIFSTPAKGTLIEIIFPLYDTSHPHDCI
MSTDSIISNPEDILTSNCKGNTQDLSKKKIDNGFETEKSKKENPCHDSFEQSNFTDQNQESVSNTNYLDSENTFVFDPIPRTVRFTWNIDAHGYLKEISEELPKTIGNYAFKMIGMRLCDVSDILHIDPNNHIGDLLKRQNTWYGKTTLWPIEGTNLYVPIDLAALPIYSRNREFSGFRGFGIVHVNRVDNDPRALGKRLDKKFSHLHEIKKGHSSVEKEKYDIFSQQSPPPHLRMKNKVSSLTEYYAHKDDVLKTEKYPLLTSEESSLPEQEDFHTINLNQYTKKQYFGTLQNNSKESFEYLSHRNHPSLSAYFDEGENLTPETVDKCPIPFFVYSHGNLFYANPSFLLLTKYKSVDDIEIAGGLSTLLDAPKLSDNNAIKPVMLYRSDRTCIAASARLHTIQWNRENSLAMTFIPFEKANQFPENMPQNGIEPEDVDTRINKRKMEIEVMQLCSILEATSDGIAIINREGIILSTNRAVSKLFGYPVEDILRKPFTVFLEQNTPSVMNHYLTEILSLDLRQTLEKITLGSTKEEKLLSLRIIIKKLPFSSCYSLTMHDISEWKQEKNKLSHAKKIAEKESSHKSDFLARVSHEIRTPLTAIIGFSEVIKNQRFGPLGNPRYIEYANYIDRSGNLVLDIVNDLLDISKIESGKMNLHFEPVSLDEAVSEAISLVQLYANEKRILIRTSFANNIPRILADLRSVKQIALNILSNAIHFTPSGGQIIISTTHTSNEEVILRVRDTGVGMTNYELEKAMKPFGQIPNSQQIRGEGTGLGLPLAKAMVDANMGKFYIFSTPAKGTLIEIIFPLYDTSHPHDCI

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target820 PAS/PAC sensor signal transduction histidine kinase [Ca
254780701495 putative two-component sensor histidine kinase tra 3e-44
254780903766 two-component sensor histidine kinase protein [Can 1e-40
255764476792 two-component sensor histidine kinase protein [Can 8e-27
254780450 803 two-component sensor histidine kinase/response reg 2e-10
>gi|254780701|ref|YP_003065114.1| putative two-component sensor histidine kinase transcriptional regulatory protein [Candidatus Liberibacter asiaticus str. psy62] Length = 495 Back     alignment
 Score =  171 bits (434), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 97/258 (37%), Positives = 154/258 (59%)

Query: 552 SCYSLTMHDISEWKQEKNKLSHAKKIAEKESSHKSDFLARVSHEIRTPLTAIIGFSEVIK 611
           SC +     I+E +  K+     +K AE+E+  KS FLA +SHE+RTPL AI+GFSEVI+
Sbjct: 216 SCQAEKDDLIAELEVAKSLSDETRKRAEEENLAKSRFLASMSHELRTPLNAILGFSEVIE 275

Query: 612 NQRFGPLGNPRYIEYANYIDRSGNLVLDIVNDLLDISKIESGKMNLHFEPVSLDEAVSEA 671
            +  GPL N  Y EY   I RSG  +L+++N++LD+S+IE+G+  L    +SL + V E 
Sbjct: 276 LETMGPLNNETYKEYIGDIHRSGQHLLNLINEILDLSRIEAGRYELSESAISLIDIVREC 335

Query: 672 ISLVQLYANEKRILIRTSFANNIPRILADLRSVKQIALNILSNAIHFTPSGGQIIISTTH 731
           I ++QL A EK I I      ++  + AD + ++Q+ LN+LSNA+ FT  GG++ ++   
Sbjct: 336 IIMLQLRAQEKNIEIFQKIDPSLSSVWADEKGMRQVILNLLSNAVKFTAIGGRVHVTVGW 395

Query: 732 TSNEEVILRVRDTGVGMTNYELEKAMKPFGQIPNSQQIRGEGTGLGLPLAKAMVDANMGK 791
           TS     + ++D G G+   E+   +  FGQ   + +   +G GLGLP+A++++  + G+
Sbjct: 396 TSGRGQYISIKDNGPGIAEGEIPTVLTSFGQGSIAIKSAEQGVGLGLPIAQSIMANHGGQ 455

Query: 792 FYIFSTPAKGTLIEIIFP 809
           F I S   +G  +  I P
Sbjct: 456 FLIRSKLREGVEVIAILP 473

>gi|254780903|ref|YP_003065316.1| two-component sensor histidine kinase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 766 Back     alignment
 Score =  159 bits (403), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 103/267 (38%), Positives = 158/267 (59%), Gaps = 19/267 (7%)

Query: 557 TMHDISEWKQ----EKNKLSHA-------KKIAEKESSHKSDFLARVSHEIRTPLTAIIG 605
           T++D+S  +Q    +K +LS A       K+ AE  +  KS+FLA++SHE+RTPL AI+G
Sbjct: 504 TINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILG 563

Query: 606 FSEVIKNQRFGPLGNPRYIEYANYIDRSGNLVLDIVNDLLDISKIESGKMNLHFEPVSLD 665
           FSEVIK + FG LG+ +Y EYA  I  SG  +L+++N++L++SKIE+ K+++  +   L 
Sbjct: 564 FSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLI 623

Query: 666 EAVSEAISLVQLYANEKRILIRTSFANNIPRIL---ADLRSVKQIALNILSNAIHFTPSG 722
             ++E I L+   A  K I I       IP  L   AD R +K+I   ILSN+I FT + 
Sbjct: 624 PIINEGIRLIGSSAQSKNIKIE----KKIPSELFFNADKRIIKKILFPILSNSIKFTNNN 679

Query: 723 GQIIISTTHTSNEEVILRVRDTGVGMTNYELEKAMKPFGQIPNSQQIRGEGTGLGLPLAK 782
           G+++I T+    + VI+ + DTG+G+    LEK  +PF  + N       G GLGL ++ 
Sbjct: 680 GKMMIRTSKIG-QCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISD 738

Query: 783 AMVDANMGKFYIFSTPAKGTLIEIIFP 809
           A+ + + G+  I S   KGT++ I  P
Sbjct: 739 ALTNLHGGRLKIISQEGKGTIVTICMP 765

>gi|255764476|ref|YP_003065238.2| two-component sensor histidine kinase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 792 Back     alignment
 Score =  114 bits (284), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 94/357 (26%), Positives = 174/357 (48%), Gaps = 20/357 (5%)

Query: 462 SDGIAIINREGIILSTNRAVSKLFGYPVEDILRKPFTVFLEQNTPSVMNHYLTEILSLDL 521
           S+G+A+   +G I  +N A   L  +  E+    P T    +N  +  + Y  E    DL
Sbjct: 444 SEGVAVFGPDGRIKLSNPAFRSL--WKTEENRLSPGTHI--RNIAATCSRYYNESDGWDL 499

Query: 522 RQTL------EKITLGSTKEEKLLSLRII---IKKLPFSSCYSLTMHDISEWKQEKNKLS 572
              +      E+ +L  T E  LLS  ++   I  LP +    LT  ++++  + +  L+
Sbjct: 500 FAAIITSFDDERKSLQGTLE--LLSDSVLEYSIIPLPNAQTM-LTFVNVTDSVRAERALT 556

Query: 573 HAKKIAEKESSHKSDFLARVSHEIRTPLTAIIGFSEVIKNQRFGPLGNPRYIEYANYIDR 632
              +   K    K+ F+  VS+E+R+PLT IIGF++++K  + G L N +  +Y  YI  
Sbjct: 557 EKNEALRKADEIKNSFVQHVSYELRSPLTNIIGFTDLLKTSKLGSL-NSKQSQYVEYISA 615

Query: 633 SGNLVLDIVNDLLDISKIESGKMNLHFEPVSLDEAVSEAISLVQLYANEKRILIRTSFAN 692
           S  ++L++VND+LD++ +++G M L++  + L++ ++E    +    +E  I I+     
Sbjct: 616 SSTILLNLVNDILDLATVDAGIMKLNYSTIVLNDLLNEVKQSIATKMHENNIRIKVISDG 675

Query: 693 NIPRILADLRSVKQIALNILSNAIHFTPSGGQIIISTTHTSNEEVILRVRDTGVGMTNYE 752
            +   +AD + + QI   ILSNA+ F+  G  +I+      N + I  V++ G  +    
Sbjct: 676 KLGSFVADRQRLLQIFSKILSNAMDFSSKGSTVILKAAR-DNGDFIFSVKNNGSSIPEDM 734

Query: 753 LEKAMKPFGQIPNSQQIRGEGTGLGLPLAKAMVDANMGKFYIFSTPAKGTLIEIIFP 809
            +     F  + N+ + +  G GLGL + ++ ++ + G   I S+    T I    P
Sbjct: 735 CKSVFNRF--VSNAHRGQRRGVGLGLSIVESFINLHGGHVSISSSDEGVTTINCRIP 789

>gi|254780450|ref|YP_003064863.1| two-component sensor histidine kinase/response regulator hybrid protein [Candidatus Liberibacter asiaticus str. psy62] Length = 803 Back     alignment
 Score = 59.3 bits (142), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 63/278 (22%), Positives = 119/278 (42%), Gaps = 35/278 (12%)

Query: 560 DISEWKQEKNKLSHAKKIAEKESSHKSDFLARVSHEIRTPLTAIIGFSE-VIKNQRFGPL 618
           +I+E K  + +++  +K+     +        ++H+    LTAI+  S+ ++   R    
Sbjct: 400 EITEQKALEARMAQTQKL-----NAVGTLAGGIAHDFNNVLTAILLSSDHLLLQSRSSDA 454

Query: 619 GNPRYIEYANYIDRSGNLVLDIVNDLLDISKIESGKMNLHFEPVSLDEAVSEAISLVQ-L 677
                +E  +  +R+  LV      LL  S+    K  +    ++L E +     ++Q L
Sbjct: 455 SFADLMEIKHNANRAAILV----RQLLAFSR----KQTMRLTVLNLTEVIGNLRMMIQKL 506

Query: 678 YANEKRILIRTSFANNIPRILADLRSVKQIALNILSNAIH--FTPSGGQIIIST------ 729
            +   ++ +   +  ++  +  DL   +Q+ +N+  NA H       G + + T      
Sbjct: 507 ISEPPQVKLTVDYERDLWGVKTDLSQFEQVLVNLCVNAHHAIMLKESGSLTVRTRNIPST 566

Query: 730 -THTSN-------EEVILRVRDTGVGMTNYELEKAMKPFGQIPNSQQIRGEGTGLGLPLA 781
             HT N       + V++ V DTG+GM+   +EK  +PF     + +  GEGTGLGL + 
Sbjct: 567 EIHTFNYSDLPTKDMVLVEVEDTGIGMSPDIMEKIFEPFF----TTKKVGEGTGLGLSVV 622

Query: 782 KAMVDANMGKFYIFSTPAKGTLIEIIFPLYDTSHPHDC 819
             ++  + G     S   KGT+  I  P Y   H  + 
Sbjct: 623 YGIIRQSGGYILPESEVGKGTIFRIFLPRYVQEHTQES 660

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target820 PAS/PAC sensor signal transduction histidine kinase [Ca
315122143806 PAS/PAC sensor signal transduction histidine kinase [Ca 1 0.0
1503955441138 PAS/PAC sensor signal transduction histidine kinase [Si 1 1e-154
2278209161117 predicted sensor histidine kinase protein with ATP-bind 1 1e-150
2398342971047 PAS domain S-box-containing protein [Ochrobactrum inter 1 1e-140
1530112431055 PAS/PAC sensor signal transduction histidine kinase [Oc 1 1e-138
3068446071036 PAS/PAC sensor signal transduction histidine kinase [Br 1 1e-138
2547148211035 sensory box histidine kinase [Brucella ceti M644/93/1] 1 1e-138
2546942751035 sensory box histidine kinase [Brucella abortus bv. 3 st 1 1e-137
2546897861035 sensory box histidine kinase [Brucella abortus bv. 6 st 1 1e-137
622904861035 sensory box histidine kinase [Brucella abortus bv. 1 st 1 1e-137
>gi|315122143|ref|YP_004062632.1| PAS/PAC sensor signal transduction histidine kinase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 806 Back     alignment and organism information
 Score = 1054 bits (2725), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 529/813 (65%), Positives = 631/813 (77%), Gaps = 18/813 (2%)

Query: 1   MSTDSIISNPEDILTSNCKGNTQDLSKKKIDNGFETEKSKKENPC-HDSFEQSNFTDQN- 58
           MS DSI  NP +  T+NCK  ++DLS K+  N      S K NPC  +  EQS+ T QN 
Sbjct: 1   MSIDSITLNPPNSPTNNCKNTSKDLSLKETINNLGIRDSHKGNPCNQNHLEQSSPTGQNH 60

Query: 59  --QESVSNTNYLDSENTFVFDPIPRTVRFTWNIDAHGYLKEISEELPKTIGNYAFKMIGM 116
             +  +S +  L+ EN+F+FD  PRTVRFTW IDA G+L  +SEEL +TIG YA KMIGM
Sbjct: 61  APRTQISCSRNLEPENSFLFDSSPRTVRFTWKIDAQGHLNAVSEELSQTIGTYALKMIGM 120

Query: 117 RLCDVSDILHIDPNNHIGDLLKRQNTWYGKTTLWPIEGTNLYVPIDLAALPIYSRNREFS 176
            LCD++ IL ID  +H+ DLL +QNTWY KTT WPIEGT+L+VPIDLAALPIYSR+REF 
Sbjct: 121 HLCDINHILQIDSKDHLFDLLTQQNTWYSKTTFWPIEGTDLHVPIDLAALPIYSRDREFV 180

Query: 177 GFRGFGIVHVNRVDNDPRALGKRLDKKFSHLHEIKKGHSSVEKEKYDIFSQQSPPPHLRM 236
           GF+GFGI+ VN+  NDP+ LG  L +KFS  HEIKK HS ++KE       Q+ P HL +
Sbjct: 181 GFKGFGIIRVNQTKNDPKKLGTTLGEKFSQSHEIKKVHSFIKKENSPSLPYQTIPAHLDI 240

Query: 237 KNKVSSLTEYYAH-KDDVLKTEKYPLLTSEESSLPEQEDFHTINLNQYTKKQYFGTLQNN 295
           K++ S  + Y+   KDD L T K       ++   ++++FHTINLNQY +K        +
Sbjct: 241 KDRGSFPSGYFPKDKDDNLATNK-------KNYFSKRDNFHTINLNQYIEKY------PH 287

Query: 296 SKESFEYLSHRNHPSLSAYFDEGENLTPETVDKCPIPFFVYSHGNLFYANPSFLLLTKYK 355
            KESFE     NHPSLS YF EGENLTPE VDK PI  FV S   L YA+PSFLLL  YK
Sbjct: 288 PKESFEDSFQINHPSLSTYFGEGENLTPEIVDKHPISLFVCSKERLLYASPSFLLLAGYK 347

Query: 356 SVDDIEIAGGLSTLLDAPKLSDNNAIKPVMLYRSDRTCIAASARLHTIQWNRENSLAMTF 415
           SV+DIE  GG+S LLDA KLS+ N    + L+RSD T IA SA LHTIQWNRENSLAMTF
Sbjct: 348 SVEDIEKVGGVSMLLDAQKLSNGNTHGSITLHRSDGTNIAVSAHLHTIQWNRENSLAMTF 407

Query: 416 IPFEKANQFPENMPQNGIEPEDVDTRINKRKMEIEVMQLCSILEATSDGIAIINREGIIL 475
           +PFEK N+  +++ QN I+    +TR +  KMEIE+MQLCSILE+TSDGIAI+NR+G IL
Sbjct: 408 VPFEKNNKLSDHISQNEIKSGYNNTRTDANKMEIEIMQLCSILESTSDGIAIVNRDGTIL 467

Query: 476 STNRAVSKLFGYPVEDILRKPFTVFLEQNTPSVMNHYLTEILSLDLRQTLEKITLGSTKE 535
           STNRA+  LF YP +DI+ KPF +F   +   +MNH + EI S+DL +TLEK  +G T+E
Sbjct: 468 STNRAIGTLFDYPAQDIIGKPFKIFFTHDNQIIMNHCMAEISSIDLGKTLEKTAVGCTRE 527

Query: 536 EKLLSLRIIIKKLPFSSCYSLTMHDISEWKQEKNKLSHAKKIAEKESSHKSDFLARVSHE 595
            KL+SLRI +KKLPFS+CY L +HDISEWKQEKN+L HAKK+AEKE+SHK+DFLARVSHE
Sbjct: 528 GKLISLRITMKKLPFSACYCLILHDISEWKQEKNELYHAKKMAEKENSHKNDFLARVSHE 587

Query: 596 IRTPLTAIIGFSEVIKNQRFGPLGNPRYIEYANYIDRSGNLVLDIVNDLLDISKIESGKM 655
           IRTPLTAIIGFSEVIKNQRFGP+G+PRYIEYANYIDRSGNLVLDIVNDLLDISKIESGKM
Sbjct: 588 IRTPLTAIIGFSEVIKNQRFGPVGSPRYIEYANYIDRSGNLVLDIVNDLLDISKIESGKM 647

Query: 656 NLHFEPVSLDEAVSEAISLVQLYANEKRILIRTSFANNIPRILADLRSVKQIALNILSNA 715
           N HFE VSL+E +SEAISL++LYANEKRIL+RTSF+N+IP I ADLRS+KQIALNILSNA
Sbjct: 648 NFHFESVSLNETISEAISLMELYANEKRILVRTSFSNDIPPIFADLRSIKQIALNILSNA 707

Query: 716 IHFTPSGGQIIISTTHTSNEEVILRVRDTGVGMTNYELEKAMKPFGQIPNSQQIRGEGTG 775
           IHFTPSGGQI+IST +T N+EV+LRV+DTG+GMT+YELEKAMKPFGQIPNSQQ+RGEGTG
Sbjct: 708 IHFTPSGGQIVISTAYTRNKEVVLRVKDTGIGMTDYELEKAMKPFGQIPNSQQVRGEGTG 767

Query: 776 LGLPLAKAMVDANMGKFYIFSTPAKGTLIEIIF 808
           LGLPL KAMVDANMGKF +FSTP+KGTLIEIIF
Sbjct: 768 LGLPLTKAMVDANMGKFSVFSTPSKGTLIEIIF 800


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|150395544|ref|YP_001326011.1| PAS/PAC sensor signal transduction histidine kinase [Sinorhizobium medicae WSM419] Length = 1138 Back     alignment and organism information
>gi|227820916|ref|YP_002824886.1| predicted sensor histidine kinase protein with ATP-binding domain [Sinorhizobium fredii NGR234] Length = 1117 Back     alignment and organism information
>gi|239834297|ref|ZP_04682625.1| PAS domain S-box-containing protein [Ochrobactrum intermedium LMG 3301] Length = 1047 Back     alignment and organism information
>gi|153011243|ref|YP_001372457.1| PAS/PAC sensor signal transduction histidine kinase [Ochrobactrum anthropi ATCC 49188] Length = 1055 Back     alignment and organism information
>gi|306844607|ref|ZP_07477194.1| PAS/PAC sensor signal transduction histidine kinase [Brucella sp. BO1] Length = 1036 Back     alignment and organism information
>gi|254714821|ref|ZP_05176632.1| sensory box histidine kinase [Brucella ceti M644/93/1] Length = 1035 Back     alignment and organism information
>gi|254694275|ref|ZP_05156103.1| sensory box histidine kinase [Brucella abortus bv. 3 str. Tulya] Length = 1035 Back     alignment and organism information
>gi|254689786|ref|ZP_05153040.1| sensory box histidine kinase [Brucella abortus bv. 6 str. 870] Length = 1035 Back     alignment and organism information
>gi|62290486|ref|YP_222279.1| sensory box histidine kinase [Brucella abortus bv. 1 str. 9-941] Length = 1035 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target820 PAS/PAC sensor signal transduction histidine kinase [Ca
TIGR02956 968 TIGR02956, TMAO_torS, TMAO reductase sytem sensor TorS 4e-41
PRK15347 921 PRK15347, PRK15347, two component system sensor kinase 9e-38
PRK11107 919 PRK11107, PRK11107, hybrid sensory histidine kinase Bar 6e-34
COG2205890 COG2205, KdpD, Osmosensitive K+ channel histidine kinas 1e-32
PRK11466 914 PRK11466, PRK11466, hybrid sensory histidine kinase Tor 3e-32
PRK10841 924 PRK10841, PRK10841, hybrid sensory kinase in two-compon 7e-27
PRK11091 779 PRK11091, PRK11091, aerobic respiration control sensor 2e-26
PRK10364457 PRK10364, PRK10364, sensor protein ZraS; Provisional 6e-25
PRK09959 1197 PRK09959, PRK09959, hybrid sensory histidine kinase in 4e-21
PRK11100475 PRK11100, PRK11100, sensory histidine kinase CreC; Prov 1e-19
PRK13837 828 PRK13837, PRK13837, two-component VirA-like sensor kina 1e-18
PRK09303380 PRK09303, PRK09303, adaptive-response sensory kinase; V 1e-18
PRK10490895 PRK10490, PRK10490, sensor protein KdpD; Provisional 2e-16
COG4251750 COG4251, COG4251, Bacteriophytochrome (light-regulated 3e-16
TIGR01386457 TIGR01386, cztS_silS_copS, heavy metal sensor kinase 3e-15
COG4191603 COG4191, COG4191, Signal transduction histidine kinase 9e-15
PRK10549466 PRK10549, PRK10549, signal transduction histidine-prote 2e-14
PRK09835482 PRK09835, PRK09835, sensor kinase CusS; Provisional 4e-14
PRK09467435 PRK09467, envZ, osmolarity sensor protein; Provisional 2e-12
COG4192673 COG4192, COG4192, Signal transduction histidine kinase 2e-10
PRK10337449 PRK10337, PRK10337, sensor protein QseC; Provisional 4e-09
TIGR03785703 TIGR03785, marine_sort_HK, proteobacterial dedicated so 4e-08
PRK10604433 PRK10604, PRK10604, sensor protein RstB; Provisional 1e-06
PRK10755356 PRK10755, PRK10755, sensor protein BasS/PmrB; Provision 4e-04
PRK09470461 PRK09470, cpxA, two-component sensor protein; Provision 4e-04
COG0642336 COG0642, BaeS, Signal transduction histidine kinase [Si 3e-38
PRK11360607 PRK11360, PRK11360, sensory histidine kinase AtoS; Prov 3e-37
COG5002459 COG5002, VicK, Signal transduction histidine kinase [Si 5e-32
TIGR02966333 TIGR02966, phoR_proteo, phosphate regulon sensor kinase 2e-25
COG5000712 COG5000, NtrY, Signal transduction histidine kinase inv 9e-22
COG3852363 COG3852, NtrB, Signal transduction histidine kinase, ni 2e-15
PRK11006430 PRK11006, phoR, phosphate regulon sensor protein; Provi 5e-14
COG3290537 COG3290, CitA, Signal transduction histidine kinase reg 8e-09
PRK11073348 PRK11073, glnL, nitrogen regulation protein NR(II); Pro 1e-06
smart00387111 smart00387, HATPase_c, Histidine kinase-like ATPases 2e-20
pfam02518111 pfam02518, HATPase_c, Histidine kinase-, DNA gyrase B-, 2e-18
cd00075103 cd00075, HATPase_c, Histidine kinase-like ATPases; This 2e-15
TIGR02916679 TIGR02916, PEP_his_kin, putative PEP-CTERM system histi 5e-07
PRK13557 540 PRK13557, PRK13557, histidine kinase; Provisional 5e-07
pfam0051266 pfam00512, HisKA, His Kinase A (phosphoacceptor) domain 1e-12
cd0008265 cd00082, HisKA, Histidine Kinase A (dimerization/phosph 1e-12
smart0038866 smart00388, HisKA, His Kinase A (phosphoacceptor) domai 2e-12
TIGR02938494 TIGR02938, nifL_nitrog, nitrogen fixation negative regu 1e-06
KOG0519 786 KOG0519, KOG0519, KOG0519, Sensory transduction histidi 2e-06
smart0009167 smart00091, PAS, PAS domain 3e-05
pfam00989112 pfam00989, PAS, PAS fold 6e-05
COG3829560 COG3829, RocR, Transcriptional regulator containing PAS 4e-04
COG2202232 COG2202, AtoS, FOG: PAS/PAC domain [Signal transduction 4e-05
TIGR00229124 TIGR00229, sensory_box, PAS domain S-box 9e-05
pfam08448110 pfam08448, PAS_4, PAS fold 0.002
COG4585365 COG4585, COG4585, Signal transduction histidine kinase 0.001
>gnl|CDD|163083 TIGR02956, TMAO_torS, TMAO reductase sytem sensor TorS Back     alignment and domain information
>gnl|CDD|185245 PRK15347, PRK15347, two component system sensor kinase SsrA; Provisional Back     alignment and domain information
>gnl|CDD|182968 PRK11107, PRK11107, hybrid sensory histidine kinase BarA; Provisional Back     alignment and domain information
>gnl|CDD|32387 COG2205, KdpD, Osmosensitive K+ channel histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|183148 PRK11466, PRK11466, hybrid sensory histidine kinase TorS; Provisional Back     alignment and domain information
>gnl|CDD|182772 PRK10841, PRK10841, hybrid sensory kinase in two-component regulatory system with RcsB and YojN; Provisional Back     alignment and domain information
>gnl|CDD|182956 PRK11091, PRK11091, aerobic respiration control sensor protein ArcB; Provisional Back     alignment and domain information
>gnl|CDD|182411 PRK10364, PRK10364, sensor protein ZraS; Provisional Back     alignment and domain information
>gnl|CDD|182169 PRK09959, PRK09959, hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional Back     alignment and domain information
>gnl|CDD|182962 PRK11100, PRK11100, sensory histidine kinase CreC; Provisional Back     alignment and domain information
>gnl|CDD|184354 PRK13837, PRK13837, two-component VirA-like sensor kinase; Provisional Back     alignment and domain information
>gnl|CDD|181772 PRK09303, PRK09303, adaptive-response sensory kinase; Validated Back     alignment and domain information
>gnl|CDD|182496 PRK10490, PRK10490, sensor protein KdpD; Provisional Back     alignment and domain information
>gnl|CDD|33974 COG4251, COG4251, Bacteriophytochrome (light-regulated signal transduction histidine kinase) [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|162333 TIGR01386, cztS_silS_copS, heavy metal sensor kinase Back     alignment and domain information
>gnl|CDD|33926 COG4191, COG4191, Signal transduction histidine kinase regulating C4-dicarboxylate transport system [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|182539 PRK10549, PRK10549, signal transduction histidine-protein kinase BaeS; Provisional Back     alignment and domain information
>gnl|CDD|182101 PRK09835, PRK09835, sensor kinase CusS; Provisional Back     alignment and domain information
>gnl|CDD|181882 PRK09467, envZ, osmolarity sensor protein; Provisional Back     alignment and domain information
>gnl|CDD|33927 COG4192, COG4192, Signal transduction histidine kinase regulating phosphoglycerate transport system [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|182388 PRK10337, PRK10337, sensor protein QseC; Provisional Back     alignment and domain information
>gnl|CDD|163497 TIGR03785, marine_sort_HK, proteobacterial dedicated sortase system histidine kinase Back     alignment and domain information
>gnl|CDD|182583 PRK10604, PRK10604, sensor protein RstB; Provisional Back     alignment and domain information
>gnl|CDD|182702 PRK10755, PRK10755, sensor protein BasS/PmrB; Provisional Back     alignment and domain information
>gnl|CDD|181885 PRK09470, cpxA, two-component sensor protein; Provisional Back     alignment and domain information
>gnl|CDD|30987 COG0642, BaeS, Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|183098 PRK11360, PRK11360, sensory histidine kinase AtoS; Provisional Back     alignment and domain information
>gnl|CDD|34607 COG5002, VicK, Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|163090 TIGR02966, phoR_proteo, phosphate regulon sensor kinase PhoR Back     alignment and domain information
>gnl|CDD|34605 COG5000, NtrY, Signal transduction histidine kinase involved in nitrogen fixation and metabolism regulation [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|33642 COG3852, NtrB, Signal transduction histidine kinase, nitrogen specific [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|182895 PRK11006, phoR, phosphate regulon sensor protein; Provisional Back     alignment and domain information
>gnl|CDD|33099 COG3290, CitA, Signal transduction histidine kinase regulating citrate/malate metabolism [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|182947 PRK11073, glnL, nitrogen regulation protein NR(II); Provisional Back     alignment and domain information
>gnl|CDD|128669 smart00387, HATPase_c, Histidine kinase-like ATPases Back     alignment and domain information
>gnl|CDD|145582 pfam02518, HATPase_c, Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase Back     alignment and domain information
>gnl|CDD|28956 cd00075, HATPase_c, Histidine kinase-like ATPases; This family includes several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases, heat shock protein HSP90, phytochrome-like ATPases and DNA mismatch repair proteins Back     alignment and domain information
>gnl|CDD|163071 TIGR02916, PEP_his_kin, putative PEP-CTERM system histidine kinase Back     alignment and domain information
>gnl|CDD|184141 PRK13557, PRK13557, histidine kinase; Provisional Back     alignment and domain information
>gnl|CDD|144196 pfam00512, HisKA, His Kinase A (phosphoacceptor) domain Back     alignment and domain information
>gnl|CDD|119399 cd00082, HisKA, Histidine Kinase A (dimerization/phosphoacceptor) domain; Histidine Kinase A dimers are formed through parallel association of 2 domains creating 4-helix bundles; usually these domains contain a conserved His residue and are activated via trans-autophosphorylation by the catalytic domain of the histidine kinase Back     alignment and domain information
>gnl|CDD|128670 smart00388, HisKA, His Kinase A (phosphoacceptor) domain Back     alignment and domain information
>gnl|CDD|131984 TIGR02938, nifL_nitrog, nitrogen fixation negative regulator NifL Back     alignment and domain information
>gnl|CDD|35739 KOG0519, KOG0519, KOG0519, Sensory transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|128402 smart00091, PAS, PAS domain Back     alignment and domain information
>gnl|CDD|144544 pfam00989, PAS, PAS fold Back     alignment and domain information
>gnl|CDD|33622 COG3829, RocR, Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|32384 COG2202, AtoS, FOG: PAS/PAC domain [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|161776 TIGR00229, sensory_box, PAS domain S-box Back     alignment and domain information
>gnl|CDD|117025 pfam08448, PAS_4, PAS fold Back     alignment and domain information
>gnl|CDD|34223 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 820 PAS/PAC sensor signal transduction histidine kinase [Ca
PRK11091 779 aerobic respiration control sensor protein ArcB; Provis 100.0
PRK10841 947 hybrid sensory kinase in two-component regulatory syste 100.0
PRK09959 1197 hybrid sensory histidine kinase in two-component regula 100.0
PRK13557 538 histidine kinase; Provisional 100.0
TIGR02966339 phoR_proteo phosphate regulon sensor kinase PhoR; Inter 100.0
PRK11360607 sensory histidine kinase AtoS; Provisional 100.0
PRK11006431 phoR phosphate regulon sensor protein; Provisional 100.0
COG5002459 VicK Signal transduction histidine kinase [Signal trans 100.0
PRK11086541 sensory histidine kinase DcuS; Provisional 100.0
COG5000712 NtrY Signal transduction histidine kinase involved in n 100.0
COG3290537 CitA Signal transduction histidine kinase regulating ci 100.0
PRK13559363 hypothetical protein; Provisional 99.95
PRK10618 881 phosphotransfer intermediate protein in two-component r 99.93
TIGR02956 1052 TMAO_torS TMAO reductase sytem sensor TorS; InterPro: I 100.0
PRK11107 920 hybrid sensory histidine kinase BarA; Provisional 100.0
PRK11466 912 hybrid sensory histidine kinase TorS; Provisional 100.0
PRK09303378 adaptive-response sensory kinase; Validated 100.0
PRK10364455 sensor protein ZraS; Provisional 100.0
PRK10490895 sensor protein KdpD; Provisional 100.0
PRK13837 831 two-component VirA-like sensor kinase; Provisional 100.0
PRK10549467 signal transduction histidine-protein kinase BaeS; Prov 100.0
PRK11100475 sensory histidine kinase CreC; Provisional 100.0
PRK09835482 sensor kinase CusS; Provisional 100.0
PRK09470461 cpxA two-component sensor protein; Provisional 100.0
PRK10337446 sensor protein QseC; Provisional 100.0
PRK10604433 sensor protein RstB; Provisional 100.0
COG2205890 KdpD Osmosensitive K+ channel histidine kinase [Signal 100.0
TIGR01386483 cztS_silS_copS heavy metal sensor kinase; InterPro: IPR 100.0
PRK10755355 sensor protein BasS/PmrB; Provisional 100.0
PRK09467437 envZ osmolarity sensor protein; Provisional 100.0
PRK10815484 sensor protein PhoQ; Provisional 100.0
COG4251750 Bacteriophytochrome (light-regulated signal transductio 100.0
COG4191603 Signal transduction histidine kinase regulating C4-dica 100.0
TIGR02916696 PEP_his_kin putative PEP-CTERM system histidine kinase; 100.0
COG0642336 BaeS Signal transduction histidine kinase [Signal trans 100.0
COG4192673 Signal transduction histidine kinase regulating phospho 99.98
KOG0519 786 consensus 99.91
PRK10935568 nitrate/nitrite sensor protein NarQ; Provisional 99.87
PRK10600569 nitrate/nitrite sensor protein NarX; Provisional 99.73
COG4585365 Signal transduction histidine kinase [Signal transducti 99.64
COG3920221 Signal transduction histidine kinase [Signal transducti 99.61
PRK11644497 sensory histidine kinase UhpB; Provisional 99.6
COG2972456 Predicted signal transduction protein with a C-terminal 99.57
COG3850574 NarQ Signal transduction histidine kinase, nitrate/nitr 99.57
COG3851497 UhpB Signal transduction histidine kinase, glucose-6-ph 99.16
KOG0519 786 consensus 98.23
COG5385214 Uncharacterized protein conserved in bacteria [Function 97.55
PRK11073348 glnL nitrogen regulation protein NR(II); Provisional 100.0
COG3852363 NtrB Signal transduction histidine kinase, nitrogen spe 100.0
COG4564459 Signal transduction histidine kinase [Signal transducti 99.32
PRK13560807 hypothetical protein; Provisional 100.0
TIGR02938496 nifL_nitrog nitrogen fixation negative regulator NifL; 100.0
PRK09776 1116 putative sensor protein; Provisional 100.0
TIGR02040453 PpsR-CrtJ transcriptional regulator PpsR; InterPro: IPR 99.09
smart00387111 HATPase_c Histidine kinase-like ATPases. Histidine kina 99.95
pfam02518111 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-l 99.95
cd00075103 HATPase_c Histidine kinase-like ATPases; This family in 99.92
PRK03660146 anti-sigma F factor; Provisional 99.51
PRK04069158 serine-protein kinase RsbW; Provisional 98.77
TIGR01925137 spIIAB anti-sigma F factor; InterPro: IPR010194 This en 98.43
COG2172146 RsbW Anti-sigma regulatory factor (Ser/Thr protein kina 97.98
TIGR01924161 rsbW_low_gc anti-sigma B factor; InterPro: IPR010193 Th 93.31
COG5381184 Uncharacterized protein conserved in bacteria [Function 90.83
PRK13560807 hypothetical protein; Provisional 99.94
PRK11359799 cAMP phosphodiesterase; Provisional 99.87
PRK09776 1116 putative sensor protein; Provisional 99.87
PRK11359 799 cAMP phosphodiesterase; Provisional 99.78
COG3829560 RocR Transcriptional regulator containing PAS, AAA-type 98.61
PRK10547 662 chemotaxis protein CheA; Provisional 99.8
COG0643 716 CheA Chemotaxis protein histidine kinase and related ki 99.73
COG3275557 LytS Putative regulator of cell autolysis [Signal trans 99.31
KOG0787414 consensus 99.17
PRK13557538 histidine kinase; Provisional 99.7
PRK13559363 hypothetical protein; Provisional 99.55
PRK10060663 RNase II stability modulator; Provisional 99.41
pfam08448110 PAS_4 PAS fold. The PAS fold corresponds to the structu 99.31
pfam00989112 PAS PAS fold. The PAS fold corresponds to the structura 99.25
PRK13558674 bacterio-opsin activator; Provisional 99.17
PRK11091779 aerobic respiration control sensor protein ArcB; Provis 99.07
TIGR00229130 sensory_box PAS domain S-box; InterPro: IPR000014 PAS d 98.73
cd00130103 PAS PAS domain; PAS motifs appear in archaea, eubacteri 98.62
PRK11073348 glnL nitrogen regulation protein NR(II); Provisional 98.47
pfam0844790 PAS_3 PAS fold. The PAS fold corresponds to the structu 98.41
KOG0501 971 consensus 96.65
TIGR02966339 phoR_proteo phosphate regulon sensor kinase PhoR; Inter 96.51
KOG1229775 consensus 96.43
pfam00989112 PAS PAS fold. The PAS fold corresponds to the structura 99.37
pfam08448110 PAS_4 PAS fold. The PAS fold corresponds to the structu 99.26
TIGR00229130 sensory_box PAS domain S-box; InterPro: IPR000014 PAS d 99.24
cd00130103 PAS PAS domain; PAS motifs appear in archaea, eubacteri 98.44
COG2202232 AtoS FOG: PAS/PAC domain [Signal transduction mechanism 98.32
TIGR02040453 PpsR-CrtJ transcriptional regulator PpsR; InterPro: IPR 98.07
pfam0844790 PAS_3 PAS fold. The PAS fold corresponds to the structu 97.66
PRK10820513 DNA-binding transcriptional regulator TyrR; Provisional 97.36
KOG3561803 consensus 96.29
pfam08670148 MEKHLA MEKHLA domain. The MEKHLA domain shares similari 96.18
COG2461409 Uncharacterized conserved protein [Function unknown] 94.55
pfam0051266 HisKA His Kinase A (phosphoacceptor) domain. dimerizati 99.36
smart0038866 HisKA His Kinase A (phosphoacceptor) domain. Dimerisati 99.15
cd0008265 HisKA Histidine Kinase A (dimerization/phosphoacceptor) 99.07
PRK10060663 RNase II stability modulator; Provisional 99.12
PRK13558674 bacterio-opsin activator; Provisional 98.99
PRK11360607 sensory histidine kinase AtoS; Provisional 98.79
TIGR02938496 nifL_nitrog nitrogen fixation negative regulator NifL; 99.04
COG1389538 DNA topoisomerase VI, subunit B [DNA replication, recom 98.65
PRK11086541 sensory histidine kinase DcuS; Provisional 97.21
COG2202232 AtoS FOG: PAS/PAC domain [Signal transduction mechanism 96.61
COG3290537 CitA Signal transduction histidine kinase regulating ci 95.77
PRK11388639 DNA-binding transcriptional regulator DhaR; Provisional 94.32
KOG1229 775 consensus 93.2
TIGR01052 662 top6b DNA topoisomerase VI, B subunit; InterPro: IPR005 98.58
TIGR00585 367 mutl DNA mismatch repair protein MutL; InterPro: IPR014 97.76
PRK10820513 DNA-binding transcriptional regulator TyrR; Provisional 98.53
smart0009167 PAS PAS domain. PAS motifs appear in archaea, eubacteri 97.74
PTZ00130824 heat shock protein 90; Provisional 96.1
KOG3558768 consensus 95.66
pfam08446107 PAS_2 PAS fold. The PAS fold corresponds to the structu 95.28
KOG3561803 consensus 92.2
TIGR02373126 photo_yellow photoactive yellow protein; InterPro: IPR0 90.84
KOG3559598 consensus 90.3
PRK04184533 DNA topoisomerase VI subunit B; Validated 98.48
smart0009167 PAS PAS domain. PAS motifs appear in archaea, eubacteri 98.27
KOG3558 768 consensus 97.41
PRK11388639 DNA-binding transcriptional regulator DhaR; Provisional 97.33
COG3283511 TyrR Transcriptional regulator of aromatic amino acids 97.26
TIGR02373126 photo_yellow photoactive yellow protein; InterPro: IPR0 94.16
PRK00095612 mutL DNA mismatch repair protein; Reviewed 98.2
KOG1979694 consensus 93.55
pfam10090181 DUF2328 Uncharacterized protein conserved in bacteria ( 98.18
PRK11006431 phoR phosphate regulon sensor protein; Provisional 97.62
COG5002459 VicK Signal transduction histidine kinase [Signal trans 96.25
COG2461409 Uncharacterized conserved protein [Function unknown] 94.27
COG0323638 MutL DNA mismatch repair enzyme (predicted ATPase) [DNA 97.46
PTZ00272701 heat shock protein 83 kDa (Hsp83); Provisional 97.32
PRK05218612 heat shock protein 90; Provisional 97.0
COG0326623 HtpG Molecular chaperone, HSP90 family [Posttranslation 96.53
COG3829560 RocR Transcriptional regulator containing PAS, AAA-type 97.09
COG3852363 NtrB Signal transduction histidine kinase, nitrogen spe 95.91
pfam07310137 PAS_5 PAS domain. This family contains a number of hypo 90.59
KOG0501 971 consensus 95.86
PRK09959 1197 hybrid sensory histidine kinase in two-component regula 95.35
COG5000712 NtrY Signal transduction histidine kinase involved in n 94.82
smart0008643 PAC Motif C-terminal to PAS motifs (likely to contribut 93.63
KOG0020785 consensus 91.6
KOG3753 1114 consensus 91.05
PRK05559633 DNA topoisomerase IV subunit B; Reviewed 90.37
KOG1978672 consensus 90.08
>PRK11091 aerobic respiration control sensor protein ArcB; Provisional Back     alignment and domain information
>PRK10841 hybrid sensory kinase in two-component regulatory system with RcsB and YojN; Provisional Back     alignment and domain information
>PRK09959 hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional Back     alignment and domain information
>PRK13557 histidine kinase; Provisional Back     alignment and domain information
>TIGR02966 phoR_proteo phosphate regulon sensor kinase PhoR; InterPro: IPR014310 Members of this protein are the regulatory histidine kinase PhoR associated with the phosphate ABC transporter found in most Proteobacteria, and related proteins from Gram-positive organisms are excluded Back     alignment and domain information
>PRK11360 sensory histidine kinase AtoS; Provisional Back     alignment and domain information
>PRK11006 phoR phosphate regulon sensor protein; Provisional Back     alignment and domain information
>COG5002 VicK Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK11086 sensory histidine kinase DcuS; Provisional Back     alignment and domain information
>COG5000 NtrY Signal transduction histidine kinase involved in nitrogen fixation and metabolism regulation [Signal transduction mechanisms] Back     alignment and domain information
>COG3290 CitA Signal transduction histidine kinase regulating citrate/malate metabolism [Signal transduction mechanisms] Back     alignment and domain information
>PRK13559 hypothetical protein; Provisional Back     alignment and domain information
>PRK10618 phosphotransfer intermediate protein in two-component regulatory system with RcsBC; Provisional Back     alignment and domain information
>TIGR02956 TMAO_torS TMAO reductase sytem sensor TorS; InterPro: IPR014302 This protein, TorS, is part of a regulatory system for the torCAD operon that encodes the pterin molybdenum cofactor-containing enzyme trimethylamine-N-oxide (TMAO) reductase (TorA), a cognate chaperone (TorD), and a penta-haem cytochrome (TorC) Back     alignment and domain information
>PRK11107 hybrid sensory histidine kinase BarA; Provisional Back     alignment and domain information
>PRK11466 hybrid sensory histidine kinase TorS; Provisional Back     alignment and domain information
>PRK09303 adaptive-response sensory kinase; Validated Back     alignment and domain information
>PRK10364 sensor protein ZraS; Provisional Back     alignment and domain information
>PRK10490 sensor protein KdpD; Provisional Back     alignment and domain information
>PRK13837 two-component VirA-like sensor kinase; Provisional Back     alignment and domain information
>PRK10549 signal transduction histidine-protein kinase BaeS; Provisional Back     alignment and domain information
>PRK11100 sensory histidine kinase CreC; Provisional Back     alignment and domain information
>PRK09835 sensor kinase CusS; Provisional Back     alignment and domain information
>PRK09470 cpxA two-component sensor protein; Provisional Back     alignment and domain information
>PRK10337 sensor protein QseC; Provisional Back     alignment and domain information
>PRK10604 sensor protein RstB; Provisional Back     alignment and domain information
>COG2205 KdpD Osmosensitive K+ channel histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>TIGR01386 cztS_silS_copS heavy metal sensor kinase; InterPro: IPR006290 Members of this family contain a sensor histidine kinase domain (IPR003661 from INTERPRO) and a domain found in bacterial signal proteins (IPR003660 from INTERPRO) Back     alignment and domain information
>PRK10755 sensor protein BasS/PmrB; Provisional Back     alignment and domain information
>PRK09467 envZ osmolarity sensor protein; Provisional Back     alignment and domain information
>PRK10815 sensor protein PhoQ; Provisional Back     alignment and domain information
>COG4251 Bacteriophytochrome (light-regulated signal transduction histidine kinase) [Signal transduction mechanisms] Back     alignment and domain information
>COG4191 Signal transduction histidine kinase regulating C4-dicarboxylate transport system [Signal transduction mechanisms] Back     alignment and domain information
>TIGR02916 PEP_his_kin putative PEP-CTERM system histidine kinase; InterPro: IPR014265 Proteins in this entry are putative periplasmic sensor signal transduction histidine kinases Back     alignment and domain information
>COG0642 BaeS Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>COG4192 Signal transduction histidine kinase regulating phosphoglycerate transport system [Signal transduction mechanisms] Back     alignment and domain information
>KOG0519 consensus Back     alignment and domain information
>PRK10935 nitrate/nitrite sensor protein NarQ; Provisional Back     alignment and domain information
>PRK10600 nitrate/nitrite sensor protein NarX; Provisional Back     alignment and domain information
>COG4585 Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>COG3920 Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK11644 sensory histidine kinase UhpB; Provisional Back     alignment and domain information
>COG2972 Predicted signal transduction protein with a C-terminal ATPase domain [Signal transduction mechanisms] Back     alignment and domain information
>COG3850 NarQ Signal transduction histidine kinase, nitrate/nitrite-specific [Signal transduction mechanisms] Back     alignment and domain information
>COG3851 UhpB Signal transduction histidine kinase, glucose-6-phosphate specific [Signal transduction mechanisms] Back     alignment and domain information
>KOG0519 consensus Back     alignment and domain information
>COG5385 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK11073 glnL nitrogen regulation protein NR(II); Provisional Back     alignment and domain information
>COG3852 NtrB Signal transduction histidine kinase, nitrogen specific [Signal transduction mechanisms] Back     alignment and domain information
>COG4564 Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK13560 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02938 nifL_nitrog nitrogen fixation negative regulator NifL; InterPro: IPR014285 NifL modulates the activity of the nitrogen fixation positive regulator protein NifA, acting as a negative regulator by binding NifA Back     alignment and domain information
>PRK09776 putative sensor protein; Provisional Back     alignment and domain information
>TIGR02040 PpsR-CrtJ transcriptional regulator PpsR; InterPro: IPR011785 This entry represents the transcriptional regulator PpsR which is strictly associated with photosynthetic proteobacteria and found in photosynthetic operons Back     alignment and domain information
>smart00387 HATPase_c Histidine kinase-like ATPases Back     alignment and domain information
>pfam02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase Back     alignment and domain information
>cd00075 HATPase_c Histidine kinase-like ATPases; This family includes several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases, heat shock protein HSP90, phytochrome-like ATPases and DNA mismatch repair proteins Back     alignment and domain information
>PRK03660 anti-sigma F factor; Provisional Back     alignment and domain information
>PRK04069 serine-protein kinase RsbW; Provisional Back     alignment and domain information
>TIGR01925 spIIAB anti-sigma F factor; InterPro: IPR010194 This entry describes the SpoIIAB anti-sigma F factor Back     alignment and domain information
>COG2172 RsbW Anti-sigma regulatory factor (Ser/Thr protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>TIGR01924 rsbW_low_gc anti-sigma B factor; InterPro: IPR010193 This entry describes the anti-sigma B factor also known as serine-protein kinase RsbW Back     alignment and domain information
>COG5381 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK13560 hypothetical protein; Provisional Back     alignment and domain information
>PRK11359 cAMP phosphodiesterase; Provisional Back     alignment and domain information
>PRK09776 putative sensor protein; Provisional Back     alignment and domain information
>PRK11359 cAMP phosphodiesterase; Provisional Back     alignment and domain information
>COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK10547 chemotaxis protein CheA; Provisional Back     alignment and domain information
>COG0643 CheA Chemotaxis protein histidine kinase and related kinases [Cell motility and secretion / Signal transduction mechanisms] Back     alignment and domain information
>COG3275 LytS Putative regulator of cell autolysis [Signal transduction mechanisms] Back     alignment and domain information
>KOG0787 consensus Back     alignment and domain information
>PRK13557 histidine kinase; Provisional Back     alignment and domain information
>PRK13559 hypothetical protein; Provisional Back     alignment and domain information
>PRK10060 RNase II stability modulator; Provisional Back     alignment and domain information
>pfam08448 PAS_4 PAS fold Back     alignment and domain information
>pfam00989 PAS PAS fold Back     alignment and domain information
>PRK13558 bacterio-opsin activator; Provisional Back     alignment and domain information
>PRK11091 aerobic respiration control sensor protein ArcB; Provisional Back     alignment and domain information
>TIGR00229 sensory_box PAS domain S-box; InterPro: IPR000014 PAS domains are involved in many signalling proteins where they are used as a signal sensor domain Back     alignment and domain information
>cd00130 PAS PAS domain; PAS motifs appear in archaea, eubacteria and eukarya Back     alignment and domain information
>PRK11073 glnL nitrogen regulation protein NR(II); Provisional Back     alignment and domain information
>pfam08447 PAS_3 PAS fold Back     alignment and domain information
>KOG0501 consensus Back     alignment and domain information
>TIGR02966 phoR_proteo phosphate regulon sensor kinase PhoR; InterPro: IPR014310 Members of this protein are the regulatory histidine kinase PhoR associated with the phosphate ABC transporter found in most Proteobacteria, and related proteins from Gram-positive organisms are excluded Back     alignment and domain information
>KOG1229 consensus Back     alignment and domain information
>pfam00989 PAS PAS fold Back     alignment and domain information
>pfam08448 PAS_4 PAS fold Back     alignment and domain information
>TIGR00229 sensory_box PAS domain S-box; InterPro: IPR000014 PAS domains are involved in many signalling proteins where they are used as a signal sensor domain Back     alignment and domain information
>cd00130 PAS PAS domain; PAS motifs appear in archaea, eubacteria and eukarya Back     alignment and domain information
>COG2202 AtoS FOG: PAS/PAC domain [Signal transduction mechanisms] Back     alignment and domain information
>TIGR02040 PpsR-CrtJ transcriptional regulator PpsR; InterPro: IPR011785 This entry represents the transcriptional regulator PpsR which is strictly associated with photosynthetic proteobacteria and found in photosynthetic operons Back     alignment and domain information
>pfam08447 PAS_3 PAS fold Back     alignment and domain information
>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional Back     alignment and domain information
>KOG3561 consensus Back     alignment and domain information
>pfam08670 MEKHLA MEKHLA domain Back     alignment and domain information
>COG2461 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>pfam00512 HisKA His Kinase A (phosphoacceptor) domain Back     alignment and domain information
>smart00388 HisKA His Kinase A (phosphoacceptor) domain Back     alignment and domain information
>cd00082 HisKA Histidine Kinase A (dimerization/phosphoacceptor) domain; Histidine Kinase A dimers are formed through parallel association of 2 domains creating 4-helix bundles; usually these domains contain a conserved His residue and are activated via trans-autophosphorylation by the catalytic domain of the histidine kinase Back     alignment and domain information
>PRK10060 RNase II stability modulator; Provisional Back     alignment and domain information
>PRK13558 bacterio-opsin activator; Provisional Back     alignment and domain information
>PRK11360 sensory histidine kinase AtoS; Provisional Back     alignment and domain information
>TIGR02938 nifL_nitrog nitrogen fixation negative regulator NifL; InterPro: IPR014285 NifL modulates the activity of the nitrogen fixation positive regulator protein NifA, acting as a negative regulator by binding NifA Back     alignment and domain information
>COG1389 DNA topoisomerase VI, subunit B [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK11086 sensory histidine kinase DcuS; Provisional Back     alignment and domain information
>COG2202 AtoS FOG: PAS/PAC domain [Signal transduction mechanisms] Back     alignment and domain information
>COG3290 CitA Signal transduction histidine kinase regulating citrate/malate metabolism [Signal transduction mechanisms] Back     alignment and domain information
>PRK11388 DNA-binding transcriptional regulator DhaR; Provisional Back     alignment and domain information
>KOG1229 consensus Back     alignment and domain information
>TIGR01052 top6b DNA topoisomerase VI, B subunit; InterPro: IPR005734 DNA topoisomerases regulate the number of topological links between two DNA strands (i Back     alignment and domain information
>TIGR00585 mutl DNA mismatch repair protein MutL; InterPro: IPR014763 This entry represents DNA mismatch repair proteins, such as MutL Back     alignment and domain information
>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional Back     alignment and domain information
>smart00091 PAS PAS domain Back     alignment and domain information
>PTZ00130 heat shock protein 90; Provisional Back     alignment and domain information
>KOG3558 consensus Back     alignment and domain information
>pfam08446 PAS_2 PAS fold Back     alignment and domain information
>KOG3561 consensus Back     alignment and domain information
>TIGR02373 photo_yellow photoactive yellow protein; InterPro: IPR012130 Members of this family are photoactive yellow protein, a cytosolic, 14-kDa light-sensing protein which has a 4-hydroxycinnamyl (p-coumaric acid) chromophore covalently linked to a Cys residue Back     alignment and domain information
>KOG3559 consensus Back     alignment and domain information
>PRK04184 DNA topoisomerase VI subunit B; Validated Back     alignment and domain information
>smart00091 PAS PAS domain Back     alignment and domain information
>KOG3558 consensus Back     alignment and domain information
>PRK11388 DNA-binding transcriptional regulator DhaR; Provisional Back     alignment and domain information
>COG3283 TyrR Transcriptional regulator of aromatic amino acids metabolism [Transcription / Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02373 photo_yellow photoactive yellow protein; InterPro: IPR012130 Members of this family are photoactive yellow protein, a cytosolic, 14-kDa light-sensing protein which has a 4-hydroxycinnamyl (p-coumaric acid) chromophore covalently linked to a Cys residue Back     alignment and domain information
>PRK00095 mutL DNA mismatch repair protein; Reviewed Back     alignment and domain information
>KOG1979 consensus Back     alignment and domain information
>pfam10090 DUF2328 Uncharacterized protein conserved in bacteria (DUF2328) Back     alignment and domain information
>PRK11006 phoR phosphate regulon sensor protein; Provisional Back     alignment and domain information
>COG5002 VicK Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>COG2461 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG0323 MutL DNA mismatch repair enzyme (predicted ATPase) [DNA replication, recombination, and repair] Back     alignment and domain information
>PTZ00272 heat shock protein 83 kDa (Hsp83); Provisional Back     alignment and domain information
>PRK05218 heat shock protein 90; Provisional Back     alignment and domain information
>COG0326 HtpG Molecular chaperone, HSP90 family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>COG3852 NtrB Signal transduction histidine kinase, nitrogen specific [Signal transduction mechanisms] Back     alignment and domain information
>pfam07310 PAS_5 PAS domain Back     alignment and domain information
>KOG0501 consensus Back     alignment and domain information
>PRK09959 hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional Back     alignment and domain information
>COG5000 NtrY Signal transduction histidine kinase involved in nitrogen fixation and metabolism regulation [Signal transduction mechanisms] Back     alignment and domain information
>smart00086 PAC Motif C-terminal to PAS motifs (likely to contribute to PAS structural domain) Back     alignment and domain information
>KOG0020 consensus Back     alignment and domain information
>KOG3753 consensus Back     alignment and domain information
>PRK05559 DNA topoisomerase IV subunit B; Reviewed Back     alignment and domain information
>KOG1978 consensus Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

<
IdentityAlignment graphLength Definition E-value
Target820 PAS/PAC sensor signal transduction histidine kinase [Ca
3a0r_A349 Sensor protein; four helix bundle, PAS fold, kinase, ph 6e-50
1gkz_A388 [3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kin 1e-43
2c2a_A258 Sensor histidine kinase; phosphotransfer, PHOQ, selenom 8e-49
3jz3_A222 Sensor protein QSEC; helix-turn-helix, kinase domain, A 2e-46
3d36_A244 Sporulation kinase B; GHKL ATPase, four helix bundle, c 1e-44
2e0a_A394 Pyruvate dehydrogenase kinase isozyme 4; PDK4, ATP-bind 6e-23
1y8o_A419 [pyruvate dehydrogenase [lipoamide]] kinase isozyme 3; 4e-21
2btz_A394 Pyruvate dehydrogenase kinase isoenzyme 2; GHKL motif r 4e-18
1b3q_A 379 Protein (chemotaxis protein CHEA); histine kinase, sign 2e-12
1id0_A152 PHOQ histidine kinase; PHOQ/PHOP, signal transduction, 8e-25
1bxd_A161 ENVZ(290-450), protein (osmolarity sensor protein (ENVZ 1e-24
1ysr_A150 Sensor-type histidine kinase PRRB; ATP-binding domain, 1e-23
3a0y_A152 Sensor protein; ATP-LID, kinase, phosphoprotein, transf 7e-23