254780418

254780418

50S ribosomal protein L25/general stress protein Ctc

GeneID in NCBI database:8209404Locus tag:CLIBASIA_01515
Protein GI in NCBI database:254780418Protein Accession:YP_003064831.1
Gene range:+(322246, 322821)Protein Length:191aa
Gene description:50S ribosomal protein L25/general stress protein Ctc
COG prediction:[J] Ribosomal protein L25 (general stress protein Ctc)
KEGG prediction:50S ribosomal protein L25/general stress protein Ctc; K02897 large subunit ribosomal protein L25
SEED prediction:LSU ribosomal protein L25p
Pathway involved in KEGG:Ribosome [PATH:las03010]
Subsystem involved in SEED:Ribosome LSU bacterial
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-
MDQKECKLSAVMRDKVGKGSARLLRKNGQIPAIIYGNMSDPKPIALSAKDISKRLYSKNFMTTILTLDIGKELVHVIPKDYQLDPVSDILIHADFLQVSEGSTVTVHVPVRFINENKSPGIKQGGKLNVVCHEVSLLCPANNIPDSITVDLNDLKIGDSIHMEDIRLPEKTSSMSQLNITIATIVAPISGS
ccccEEEEEEEEEccccccHHHHHHHcccccEEEEccccccEEEEEcHHHHHHHHcccccEEEEEEEEEccEEEEEEEEEEEcccccccEEEEEEEEEccccEEEEEEEEEEEccccccHHHcccEEEEEEEEEEEEEEHHHcccEEEEEEEccccccEEEEEEEEcccccEEEcccccEEEEEEcccccc
ccccEEEEEEEEEcccccHHHHHHHHcccccEEEEccccccccEEEcHHHHHHHHHccccccEEEEEEccccEEEEEEcccccccccccEEEEEEEEEccccEEEEEEEEEEEccccccccccccEEEEEEEEEEEEEcccccccEEEEEccccccccEEEEcccccccccEEEcccccEEEEEEcccccc
MDQKECKLSAVMRDKVGKGSARLLrkngqipaiiygnmsdpkpialSAKDISKRLYSKNFMTTILTLDIGKELVhvipkdyqldpvsdiLIHADFlqvsegstvtVHVPVrfinenkspgikqggklNVVCHEVsllcpannipdsitvdlndlkigdsihmedirlpektssmsqLNITIATIVAPISGS
mdqkecklsavmrdkvgkgsarllrknGQIPaiiygnmsdpkpIALSAKDISKRLYSKNFMTTILTLDIGKELVHVIPKDYQLDPVSDILIHADFLQVSEGSTVTVHVPVRFINenkspgikqGGKLNVVCHEVSLLCPANNIPDSITVDLNDLKIGDSIHMEDIRLpektssmsqlniTIATIVAPISGS
MDQKECKLSAVMRDKVGKGSARLLRKNGQIPAIIYGNMSDPKPIALSAKDISKRLYSKNFMTTILTLDIGKELVHVIPKDYQLDPVSDILIHADFLQVSEGSTVTVHVPVRFINENKSPGIKQGGKLNVVCHEVSLLCPANNIPDSITVDLNDLKIGDSIHMEDIRLPEKTSSMSQLNITIATIVAPISGS
***KECK*SAV**********RLLRKNGQIPAIIYGNMSDPKPIALSAKDISKRLYSKNFMTTILTLDIGKELVHVIPKDYQLDPVSDILIHADFLQVSEGSTVTVHVPVRFINENKSPGIKQGGKLNVVCHEVSLLCPANNIPDSITVDLNDLKIGDSIHMEDIRLPEKTSSMSQLNITIATIVAPI***
MDQKECKLSAVMRDKVGKGSARLLRKNGQIPAIIYGNMSDPKPIALSAKDISKRLYSKNFMTTILTLDIGKELVHVIPKDYQLDPVSDILIHADFLQVSEGSTVTVHVPVRFINENKSPGIKQGGKLNVVCHEVSLLCPANNIPDSITVDLNDLKIGDSIHMEDIRLPEKTSSMSQLNITIATIVAPISGS
**QKECKLSAVMRDKVGKGSARLLRKNGQIPAIIYGNMSDPKPIALSAKDISKRLYSKNFMTTILTLDIGKELVHVIPKDYQLDPVSDILIHADFLQVSEGSTVTVHVPVRFINENKSPGIKQGGKLNVVCHEVSLLCPANNIPDSITVDLNDLKIGDSIHMEDIRLPEKTSSMSQLNITIATIVAPI***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDQKECKLSAVMRDKVGKGSARLLRKNGQIPAIIYGNMSDPKPIALSAKDISKRLYSKNFMTTILTLDIGKELVHVIPKDYQLDPVSDILIHADFLQVSEGSTVTVHVPVRFINENKSPGIKQGGKLNVVCHEVSLLCPANNIPDSITVDLNDLKIGDSIHMEDIRLPEKTSSMSQLNITIATIVAPISGS
MDQKECKLSAVMRDKVGKGSARLLRKNGQIPAIIYGNMSDPKPIALSAKDISKRLYSKNFMTTILTLDIGKELVHVIPKDYQLDPVSDILIHADFLQVSEGSTVTVHVPVRFINENKSPGIKQGGKLNVVCHEVSLLCPANNIPDSITVDLNDLKIGDSIHMEDIRLPEKTSSMSQLNITIATIVAPISGS
MDQKECKLSAVMRDKVGKGSARLLRKNGQIPAIIYGNMSDPKPIALSAKDISKRLYSKNFMTTILTLDIGKELVHVIPKDYQLDPVSDILIHADFLQVSEGSTVTVHVPVRFINENKSPGIKQGGKLNVVCHEVSLLCPANNIPDSITVDLNDLKIGDSIHMEDIRLPEKTSSMSQLNITIATIVAPISGS

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target191 50S ribosomal protein L25/general stress protein Ctc [C
315122138191 50S ribosomal protein L25/general stress protein Ctc [C 1 4e-76
218682558201 50S ribosomal protein L25/general stress protein Ctc [R 1 5e-53
15966107204 50S ribosomal protein L25/general stress protein Ctc [S 1 5e-52
116253213202 50S ribosomal protein L25/general stress protein Ctc [R 1 1e-51
241205729202 50S ribosomal protein L25 [Rhizobium leguminosarum bv. 1 1e-51
209550344202 50S ribosomal protein L25/general stress protein Ctc [R 1 3e-51
190892768203 50S ribosomal protein L25 [Rhizobium etli CIAT 652] Len 1 4e-51
327188360203 50S ribosomal protein L25 [Rhizobium etli CNPAF512] Len 1 6e-51
86282729233 50S ribosomal protein L25 [Rhizobium etli CFN 42] Lengt 1 7e-51
162329634204 50S ribosomal protein L25/general stress protein Ctc [R 1 8e-51
>gi|315122138|ref|YP_004062627.1| 50S ribosomal protein L25/general stress protein Ctc [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 191 Back     alignment and organism information
 Score =  287 bits (735), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 134/191 (70%), Positives = 161/191 (84%)

Query: 1   MDQKECKLSAVMRDKVGKGSARLLRKNGQIPAIIYGNMSDPKPIALSAKDISKRLYSKNF 60
           M Q+E KL  + R+KVGKGS+RLLR+NG+IPA IYGN+S PK IALS KDISKRLYSK+F
Sbjct: 1   MSQEEYKLKTITREKVGKGSSRLLRRNGKIPATIYGNISSPKSIALSTKDISKRLYSKHF 60

Query: 61  MTTILTLDIGKELVHVIPKDYQLDPVSDILIHADFLQVSEGSTVTVHVPVRFINENKSPG 120
           MTTI T+D+GKE + V+PKDYQLDPVSD+LIH DFLQ+SE ST++V VP+RFIN+NKSPG
Sbjct: 61  MTTIFTIDLGKESIRVLPKDYQLDPVSDVLIHMDFLQISEKSTISVQVPIRFINQNKSPG 120

Query: 121 IKQGGKLNVVCHEVSLLCPANNIPDSITVDLNDLKIGDSIHMEDIRLPEKTSSMSQLNIT 180
           +K GG LN++CHE+ LLCPAN IPDSI+ DL+ LKIGD+IHM DIRLPE  +S+S  N T
Sbjct: 121 LKMGGSLNIICHEIPLLCPANKIPDSISADLDGLKIGDNIHMTDIRLPEGITSVSHANST 180

Query: 181 IATIVAPISGS 191
           IA I APIS S
Sbjct: 181 IAKISAPISSS 191


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|218682558|ref|ZP_03530159.1| 50S ribosomal protein L25/general stress protein Ctc [Rhizobium etli CIAT 894] Length = 201 Back     alignment and organism information
>gi|15966107|ref|NP_386460.1| 50S ribosomal protein L25/general stress protein Ctc [Sinorhizobium meliloti 1021] Length = 204 Back     alignment and organism information
>gi|116253213|ref|YP_769051.1| 50S ribosomal protein L25/general stress protein Ctc [Rhizobium leguminosarum bv. viciae 3841] Length = 202 Back     alignment and organism information
>gi|241205729|ref|YP_002976825.1| 50S ribosomal protein L25 [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 202 Back     alignment and organism information
>gi|209550344|ref|YP_002282261.1| 50S ribosomal protein L25/general stress protein Ctc [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 202 Back     alignment and organism information
>gi|190892768|ref|YP_001979310.1| 50S ribosomal protein L25 [Rhizobium etli CIAT 652] Length = 203 Back     alignment and organism information
>gi|327188360|gb|EGE55577.1| 50S ribosomal protein L25 [Rhizobium etli CNPAF512] Length = 203 Back     alignment and organism information
>gi|86282729|gb|ABC91792.1| 50S ribosomal protein L25 [Rhizobium etli CFN 42] Length = 233 Back     alignment and organism information
>gi|162329634|ref|YP_470519.2| 50S ribosomal protein L25/general stress protein Ctc [Rhizobium etli CFN 42] Length = 204 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target191 50S ribosomal protein L25/general stress protein Ctc [C
PRK05618197 PRK05618, PRK05618, 50S ribosomal protein L25/general s 2e-60
TIGR00731176 TIGR00731, ctc_TL5, ribosomal protein L25, Ctc-form 4e-34
cd0049591 cd00495, Ribosomal_L25_TL5_CTC, Ribosomal_L25_TL5_CTC: 7e-21
COG182593 COG1825, RplY, Ribosomal protein L25 (general stress pr 6e-20
PRK0594394 PRK05943, PRK05943, 50S ribosomal protein L25; Reviewed 1e-13
pfam0138687 pfam01386, Ribosomal_L25p, Ribosomal L25p family 3e-23
>gnl|CDD|180166 PRK05618, PRK05618, 50S ribosomal protein L25/general stress protein Ctc; Reviewed Back     alignment and domain information
>gnl|CDD|162013 TIGR00731, ctc_TL5, ribosomal protein L25, Ctc-form Back     alignment and domain information
>gnl|CDD|88604 cd00495, Ribosomal_L25_TL5_CTC, Ribosomal_L25_TL5_CTC: Ribosomal L25/TL5/CTC N-terminal 5S rRNA binding domain Back     alignment and domain information
>gnl|CDD|32010 COG1825, RplY, Ribosomal protein L25 (general stress protein Ctc) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|180318 PRK05943, PRK05943, 50S ribosomal protein L25; Reviewed Back     alignment and domain information
>gnl|CDD|144833 pfam01386, Ribosomal_L25p, Ribosomal L25p family Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 191 50S ribosomal protein L25/general stress protein Ctc [C
PRK05618193 50S ribosomal protein L25/general stress protein Ctc; R 100.0
TIGR00731182 ctc_TL5 ribosomal protein L25, Ctc-form; InterPro: IPR0 100.0
PRK0594393 50S ribosomal protein L25; Reviewed 99.95
cd0049591 Ribosomal_L25_TL5_CTC Ribosomal_L25_TL5_CTC: Ribosomal 99.93
pfam0138687 Ribosomal_L25p Ribosomal L25p family. Ribosomal protein 99.93
COG182593 RplY Ribosomal protein L25 (general stress protein Ctc) 99.91
>PRK05618 50S ribosomal protein L25/general stress protein Ctc; Reviewed Back     alignment and domain information
>TIGR00731 ctc_TL5 ribosomal protein L25, Ctc-form; InterPro: IPR001021 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PRK05943 50S ribosomal protein L25; Reviewed Back     alignment and domain information
>cd00495 Ribosomal_L25_TL5_CTC Ribosomal_L25_TL5_CTC: Ribosomal L25/TL5/CTC N-terminal 5S rRNA binding domain Back     alignment and domain information
>pfam01386 Ribosomal_L25p Ribosomal L25p family Back     alignment and domain information
>COG1825 RplY Ribosomal protein L25 (general stress protein Ctc) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target191 50S ribosomal protein L25/general stress protein Ctc [C
2j01_Z206 Structure Of The Thermus Thermophilus 70s Ribosome 3e-26
3fin_Z177 T. Thermophilus 70s Ribosome In Complex With Mrna, 5e-26
3pyo_V188 Crystal Structure Of A Complex Containing Domain 3 5e-26
1feu_A206 Crystal Structure Of Ribosomal Protein Tl5, One Of 2e-25
1nkw_T253 Crystal Structure Of The Large Ribosomal Subunit Fr 7e-24
1njm_T237 The Crystal Structure Of The 50s Large Ribosomal Su 3e-23
1pnu_T173 Crystal Structure Of A Streptomycin Dependent Ribos 8e-21
1b75_A94 Solution Structure Of Ribosomal Protein L25 From Es 5e-16
1d6k_A94 Nmr Solution Structure Of The 5s Rrna E-LoopL25 COM 8e-16
gi|116668257|pdb|2J01|Z Chain Z, Structure Of The Thermus Thermophilus 70s Ribosome Complexed With Mrna, Trna And Paromomycin (Part 2 Of 4). This File Contains The 50s Subunit From Molecule I. Length = 206 Back     alignment and structure
 Score =  122 bits (305), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 47/183 (25%), Positives = 83/183 (45%), Gaps = 7/183 (3%)

Query: 5   ECKLSAVMRDKVGKGSARLLRKNGQIPAIIYGNMSDPKPIALSAKDISKRLYSKNFMTTI 64
           E +L A  R+     +   LR+ G++P ++Y N    + + +   +  K     +    I
Sbjct: 2   EYRLKAYYREGEKPSA---LRRAGKLPGVMY-NRHLNRKVYVDLVEFDKVFRQASIHHVI 57

Query: 65  LTLDIGKELVHVIPKDYQLDPVSDILIHADFLQVSEGSTVTVHVPVRFINENKSPGIKQG 124
           +      + +  + +   LD       H DF  V     V ++VP+RF+      G++ G
Sbjct: 58  VLELPDGQSLPTLVRQVNLDKRRRRPEHVDFF-VLSDEPVEMYVPLRFVGTPA--GVRAG 114

Query: 125 GKLNVVCHEVSLLCPANNIPDSITVDLNDLKIGDSIHMEDIRLPEKTSSMSQLNITIATI 184
           G L  +  ++ +     NIP+ I VD++ L+IGDS+H  D++LP           TIA +
Sbjct: 115 GVLQEIHRDILVKVSPRNIPEFIEVDVSGLEIGDSLHASDLKLPPGVELAVSPEETIAAV 174

Query: 185 VAP 187
           V P
Sbjct: 175 VPP 177


>gi|224510801|pdb|3FIN|Z Chain Z, T. Thermophilus 70s Ribosome In Complex With Mrna, Trnas And Ef-Tu.Gdp.Kirromycin Ternary Complex, Fitted To A 6.4 A Cryo-Em Map. This File Contains The 50s Subunit Length = 177 Back     alignment and structure
>gi|322812593|pdb|3PYO|V Chain V, Crystal Structure Of A Complex Containing Domain 3 From The Psiv Igr Ires Rna Bound To The 70s Ribosome. This File Contains The 50s Subunit Of The First 70s Ribosome. Length = 188 Back     alignment and structure
gi|14719583|pdb|1FEU|A Chain A, Crystal Structure Of Ribosomal Protein Tl5, One Of The Ctc Family Proteins, Complexed With A Fragment Of 5s Rrna. Length = 206 Back     alignment and structure
gi|28948939|pdb|1NKW|T Chain T, Crystal Structure Of The Large Ribosomal Subunit From Deinococcus Radiodurans Length = 253 Back     alignment and structure
gi|28948894|pdb|1NJM|T Chain T, The Crystal Structure Of The 50s Large Ribosomal Subunit From Deinococcus Radiodurans Complexed With A Trna Acceptor Stem Mimic (Asm) And The Antibiotic Sparsomycin Length = 237 Back     alignment and structure
>gi|34811573|pdb|1PNU|T Chain T, Crystal Structure Of A Streptomycin Dependent Ribosome From Escherichia Coli, 50s Subunit Of 70s Ribosome. This File, 1pnu, Contains Only Molecules Of The 50s Ribosomal Subunit. The 30s Subunit, Mrna, P-Site Trna, And A-Site Trna Are In The Pdb File 1pns. Length = 173 Back     alignment and structure
>gi|6980397|pdb|1B75|A Chain A, Solution Structure Of Ribosomal Protein L25 From Escherichia Coli Length = 94 Back     alignment and structure
gi|6573331|pdb|1D6K|A Chain A, Nmr Solution Structure Of The 5s Rrna E-LoopL25 COMPLEX Length = 94 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target191 50S ribosomal protein L25/general stress protein Ctc [C
1feu_A206 50S ribosomal protein L25; general stress protein CTC, 4e-39
2zjr_S237 50S ribosomal protein L25; ribosome, large ribosomal su 4e-27
1b75_A94 Protein (50S ribosomal protein L25); RNA-binding protei 5e-21
>1feu_A 50S ribosomal protein L25; general stress protein CTC, 5S rRNA-protein complex, cadmium IONS, ribosome; 2.30A {Thermus thermophilus} SCOP: b.53.1.1 PDB: 2j01_Z 1vsp_T 2hgj_Y 2hgq_Y 2hgu_Y 1vsa_T 2j03_Z 2jl6_Z 2jl8_Z 2v47_Z 2v49_Z 2wdi_Z 2wdj_Z 2wdl_Z 2wdn_Z 2wh2_Z 2wh4_Z 2wrj_Z 2wrl_Z 2wro_Z ... Length = 206 Back     alignment and structure
 Score =  155 bits (394), Expect = 4e-39
 Identities = 46/183 (25%), Positives = 82/183 (44%), Gaps = 7/183 (3%)

Query: 5   ECKLSAVMRDKVGKGSARLLRKNGQIPAIIYGNMSDPKPIALSAKDISKRLYSKNFMTTI 64
           E +L A  R+     +   LR+ G++P ++Y      + + +   +  K     +    I
Sbjct: 2   EYRLKAYYREGEKPSA---LRRAGKLPGLMYNR-HLNRKVYVDLVEFDKVFRQASIHHVI 57

Query: 65  LTLDIGKELVHVIPKDYQLDPVSDILIHADFLQVSEGSTVTVHVPVRFINENKSPGIKQG 124
           +      + +  + +   LD       H DF  V     V ++VP+RF+      G++ G
Sbjct: 58  VLELPDGQSLPTLVRQVNLDKRRRRPEHVDF-FVLSDEPVEMYVPLRFVGTP--AGVRAG 114

Query: 125 GKLNVVCHEVSLLCPANNIPDSITVDLNDLKIGDSIHMEDIRLPEKTSSMSQLNITIATI 184
           G L  +  ++ +     NIP+ I VD++ L+IGDS+H  D++LP           TIA +
Sbjct: 115 GVLQEIHRDILVKVSPRNIPEFIEVDVSGLEIGDSLHASDLKLPPGVELAVSPEETIAAV 174

Query: 185 VAP 187
           V P
Sbjct: 175 VPP 177


>2zjr_S 50S ribosomal protein L25; ribosome, large ribosomal subunit, ribonucleoprotein, RNA-binding, rRNA-binding, tRNA-binding, methylation; 2.91A {Deinococcus radiodurans} SCOP: b.53.1.1 PDB: 1njm_T* 1nwx_T* 1njp_T* 1xbp_T* 2zjp_S* 2zjq_S 1nwy_T 3cf5_S* 3dll_S* 1nkw_T 1sm1_T* 1yl3_V 2b66_Z 2b9n_Z 2b9p_Z 1pnu_T 1pny_T 1vor_W 1vou_W 1vow_W ... Length = 237 Back     alignment and structure
>1b75_A Protein (50S ribosomal protein L25); RNA-binding protein; NMR {Escherichia coli} SCOP: b.53.1.1 PDB: 1d6k_A 1dfu_P 1giy_V 1ml5_v* 1p85_T 1p86_T 1vs6_V 1vs8_V 2aw4_V 2awb_V 2gya_T 2gyc_T 2i2t_V 2i2v_V 2j28_V 2qam_V* 2qao_V* 2qba_V* 2qbc_V* 2qbe_V ... Length = 94 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target191 50S ribosomal protein L25/general stress protein Ctc [C
1feu_A206 50S ribosomal protein L25; general stress protein CTC, 100.0
2zjr_S237 50S ribosomal protein L25; ribosome, large ribosomal su 100.0
1b75_A94 Protein (50S ribosomal protein L25); RNA-binding protei 99.92
3lyw_A90 YBBR family protein; structural genomics, PSI-2, protei 90.14
>1feu_A 50S ribosomal protein L25; general stress protein CTC, 5S rRNA-protein complex, cadmium IONS, ribosome; 2.30A {Thermus thermophilus} SCOP: b.53.1.1 PDB: 2j01_Z 1vsp_T 2hgj_Y 2hgq_Y 2hgu_Y 1vsa_T 2j03_Z 2jl6_Z 2jl8_Z 2v47_Z 2v49_Z 2wdi_Z 2wdj_Z 2wdl_Z 2wdn_Z 2wh2_Z 2wh4_Z 2wrj_Z 2wrl_Z 2wro_Z ... Back     alignment and structure
Probab=100.00  E-value=0  Score=350.08  Aligned_cols=178  Identities=26%  Similarity=0.480  Sum_probs=166.7

Q ss_pred             EEEEEEEEECCCCCHHHHHHHHCCCCCEEEECCCCCCEEEEEEECHHHEEHHCCCCCEEEEEECC-CCCCEEEEEEEEEC
Q ss_conf             69999999168761778999978994389967898855699980022100111466225799616-77520378612121
Q gi|254780418|r    5 ECKLSAVMRDKVGKGSARLLRKNGQIPAIIYGNMSDPKPIALSAKDISKRLYSKNFMTTILTLDI-GKELVHVIPKDYQL   83 (191)
Q Consensus         5 ~~~L~~~~R~~~gk~~~r~lR~~G~VPaviYG~~~e~~~i~v~~~~l~k~l~~~~~~~~v~~l~i-~g~~~~vlikevQ~   83 (191)
                      +++|+|++|+..|++   +|||+|+||||+||++. +.+++++.++|.++++. .+.++++.|++ +|++++|++||+||
T Consensus         2 ~~~l~a~~Re~~g~~---aLRr~G~VPaViYG~~~-~~~i~v~~~e~~k~l~~-~~~~~~i~l~~~dg~~~~vlikevQ~   76 (206)
T 1feu_A            2 EYRLKAYYREGEKPS---ALRRAGKLPGLMYNRHL-NRKVYVDLVEFDKVFRQ-ASIHHVIVLELPDGQSLPTLVRQVNL   76 (206)
T ss_dssp             EEEEECEECSSSCHH---HHHHTTEEEEEEECSSC-EEEEEEEHHHHHHHHHH-HTTTSEEEEECTTSCEEEEEEEEEEE
T ss_pred             EEEEEEEEECCCCHH---HHHHCCCCEEEEECCCC-CCCEEECHHHHHHHHHH-HHCCCEEEEEECCCCEEEEEEEEEEE
T ss_conf             089999992688806---79858995099967999-81289728999977633-21032157897189689999999874


Q ss_pred             CCCCCCEEEEEEEEECCCCEEEEEEEEEEEECCCCCCCCCCCEEEEEEEEEEEEEEHHHCCCEEEECCCCCCCCCEEEEE
Q ss_conf             43268465448999328976999963699605654432123113576545788880767963468322223569779999
Q gi|254780418|r   84 DPVSDILIHADFLQVSEGSTVTVHVPVRFINENKSPGIKQGGKLNVVCHEVSLLCPANNIPDSITVDLNDLKIGDSIHME  163 (191)
Q Consensus        84 ~p~~~~i~HvDF~~v~~~~~v~v~VPI~~~ge~~~~Gvk~GG~l~~~~~~i~v~~~p~~IPe~ievDvs~L~~Gd~i~v~  163 (191)
                      ||+++.++|+|||+++ +++++++|||+|+|+  |+|++.||+|++.+++|+|+|+|.+||++|+||||+|++||+++++
T Consensus        77 ~pv~~~i~HvDF~~v~-~~~i~v~VPv~~~G~--~~gvk~GG~l~~~~~ei~v~~~p~~IPe~I~VDvs~L~iGd~i~v~  153 (206)
T 1feu_A           77 DKRRRRPEHVDFFVLS-DEPVEMYVPLRFVGT--PAGVRAGGVLQEIHRDILVKVSPRNIPEFIEVDVSGLEIGDSLHAS  153 (206)
T ss_dssp             CSSSSCEEEEEEEECC-SSCEEEEEEEEEESC--CHHHHTTCEEEECCSEEEEEECGGGCCSCEEEECTTCCTTEEEEGG
T ss_pred             CCCCCCCEEEEEEECC-CCEEEEEECEEEECC--CCCCCCCCEEEEEEEEEEEEECCCCCCCEEEEECCCCCCCCEEEEE
T ss_conf             1225773799988158-976999966599755--3211157368987638999832026985999956457689879998


Q ss_pred             EEECCCCCEECCCCCCEEEEEECCCCC
Q ss_conf             753588867836898269999448877
Q gi|254780418|r  164 DIRLPEKTSSMSQLNITIATIVAPISG  190 (191)
Q Consensus       164 Dl~lpegv~~l~d~~~~vvsv~~P~~g  190 (191)
                      ||+||+|+++++|++.+||+|.+|++.
T Consensus       154 Dl~lpegv~~~~d~~~~vv~v~~p~~~  180 (206)
T 1feu_A          154 DLKLPPGVELAVSPEETIAAVVPPEDV  180 (206)
T ss_dssp             GSCCCTTCEESSCTTCEEEEEECSSSS
T ss_pred             EECCCCCCEEECCCCCEEEEEECCCCC
T ss_conf             342899968904899669999679876



>2zjr_S 50S ribosomal protein L25; ribosome, large ribosomal subunit, ribonucleoprotein, RNA-binding, rRNA-binding, tRNA-binding, methylation; 2.91A {Deinococcus radiodurans} SCOP: b.53.1.1 PDB: 1njm_T* 1nwx_T* 1njp_T* 1xbp_T* 2zjp_S* 2zjq_S 1nwy_T 3cf5_S* 3dll_S* 1nkw_T 1sm1_T* 1yl3_V 2b66_Z 2b9n_Z 2b9p_Z 1pnu_T 1pny_T 1vor_W 1vou_W 1vow_W ... Back     alignment and structure
>1b75_A Protein (50S ribosomal protein L25); RNA-binding protein, RNA binding protein; NMR {Escherichia coli} SCOP: b.53.1.1 PDB: 1d6k_A 1dfu_P 1giy_V 1ml5_v* 1p85_T 1p86_T 1vs6_V 1vs8_V 2aw4_V 2awb_V 2gya_T 2gyc_T 2i2t_V 2i2v_V 2j28_V 2qam_V* 2qao_V* 2qba_V* 2qbc_V* 2qbe_V ... Back     alignment and structure
>3lyw_A YBBR family protein; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 1.90A {Desulfitobacterium hafniense} PDB: 2kpu_A Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 191 50S ribosomal protein L25/general stress protein Ctc [C
d1feua_185 b.53.1.1 (A:) Ribosomal protein TL5 (general stress pro 4e-30
d2zjrs1175 b.53.1.1 (S:1-175) Ribosomal protein TL5 (general stres 2e-27
d1dfup_94 b.53.1.1 (P:) Ribosomal protein L25 {Escherichia coli [ 2e-21
>d1feua_ b.53.1.1 (A:) Ribosomal protein TL5 (general stress protein CTC) {Thermus thermophilus [TaxId: 274]} Length = 185 Back     information, alignment and structure

class: All beta proteins
fold: Ribosomal protein L25-like
superfamily: Ribosomal protein L25-like
family: Ribosomal protein L25-like
domain: Ribosomal protein TL5 (general stress protein CTC)
species: Thermus thermophilus [TaxId: 274]
 Score =  124 bits (312), Expect = 4e-30
 Identities = 46/183 (25%), Positives = 84/183 (45%), Gaps = 7/183 (3%)

Query: 5   ECKLSAVMRDKVGKGSARLLRKNGQIPAIIYGNMSDPKPIALSAKDISKRLYSKNFMTTI 64
           E +L A  R+     +   LR+ G++P ++Y      + + +   +  K     +    I
Sbjct: 2   EYRLKAYYREGEKPSA---LRRAGKLPGLMYNR-HLNRKVYVDLVEFDKVFRQASIHHVI 57

Query: 65  LTLDIGKELVHVIPKDYQLDPVSDILIHADFLQVSEGSTVTVHVPVRFINENKSPGIKQG 124
           +      + +  + +   LD       H DF  +S+   V ++VP+RF+      G++ G
Sbjct: 58  VLELPDGQSLPTLVRQVNLDKRRRRPEHVDFFVLSD-EPVEMYVPLRFVGTP--AGVRAG 114

Query: 125 GKLNVVCHEVSLLCPANNIPDSITVDLNDLKIGDSIHMEDIRLPEKTSSMSQLNITIATI 184
           G L  +  ++ +     NIP+ I VD++ L+IGDS+H  D++LP           TIA +
Sbjct: 115 GVLQEIHRDILVKVSPRNIPEFIEVDVSGLEIGDSLHASDLKLPPGVELAVSPEETIAAV 174

Query: 185 VAP 187
           V P
Sbjct: 175 VPP 177


>d2zjrs1 b.53.1.1 (S:1-175) Ribosomal protein TL5 (general stress protein CTC) {Deinococcus radiodurans [TaxId: 1299]} Length = 175 Back     information, alignment and structure
>d1dfup_ b.53.1.1 (P:) Ribosomal protein L25 {Escherichia coli [TaxId: 562]} Length = 94 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target191 50S ribosomal protein L25/general stress protein Ctc [C
d1feua_185 Ribosomal protein TL5 (general stress protein CTC) {The 100.0
d2zjrs1175 Ribosomal protein TL5 (general stress protein CTC) {Dei 100.0
d1dfup_94 Ribosomal protein L25 {Escherichia coli [TaxId: 562]} 99.94
>d1feua_ b.53.1.1 (A:) Ribosomal protein TL5 (general stress protein CTC) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
class: All beta proteins
fold: Ribosomal protein L25-like
superfamily: Ribosomal protein L25-like
family: Ribosomal protein L25-like
domain: Ribosomal protein TL5 (general stress protein CTC)
species: Thermus thermophilus [TaxId: 274]
Probab=100.00  E-value=0  Score=347.47  Aligned_cols=178  Identities=26%  Similarity=0.487  Sum_probs=165.1

Q ss_pred             EEEEEEEEECCCCCHHHHHHHHCCCCCEEEECCCCCCEEEEEEECHHHEEHHCCCCCEEEEEECC-CCCCEEEEEEEEEC
Q ss_conf             69999999168761778999978994389967898855699980022100111466225799616-77520378612121
Q gi|254780418|r    5 ECKLSAVMRDKVGKGSARLLRKNGQIPAIIYGNMSDPKPIALSAKDISKRLYSKNFMTTILTLDI-GKELVHVIPKDYQL   83 (191)
Q Consensus         5 ~~~L~~~~R~~~gk~~~r~lR~~G~VPaviYG~~~e~~~i~v~~~~l~k~l~~~~~~~~v~~l~i-~g~~~~vlikevQ~   83 (191)
                      +++|+|+.|++.|++   +|||+|+||||+||++. +.+++++.++|.+++++.+ .++++.+++ +|+++.||+||+|+
T Consensus         2 ~~~l~a~~Re~~~~~---~LRr~G~VPaViYG~~~-~~~i~v~~~e~~k~~~~~~-~~~~i~l~~~dg~~~~vlikevQ~   76 (185)
T d1feua_           2 EYRLKAYYREGEKPS---ALRRAGKLPGLMYNRHL-NRKVYVDLVEFDKVFRQAS-IHHVIVLELPDGQSLPTLVRQVNL   76 (185)
T ss_dssp             EEEEECEECSSSCHH---HHHHTTEEEEEEECSSC-EEEEEEEHHHHHHHHHHHT-TTSEEEEECTTSCEEEEEEEEEEE
T ss_pred             EEEEEEEEECCCCCH---HHHHCCCCEEEEECCCC-CCCEEECCHHHHHHHHHHH-CCCEEEEEEECCHHHHHEEEEEEE
T ss_conf             289999993488826---79858995499978999-8377964368876752320-244389995064113311002573


Q ss_pred             CCCCCCEEEEEEEEECCCCEEEEEEEEEEEECCCCCCCCCCCEEEEEEEEEEEEEEHHHCCCEEEECCCCCCCCCEEEEE
Q ss_conf             43268465448999328976999963699605654432123113576545788880767963468322223569779999
Q gi|254780418|r   84 DPVSDILIHADFLQVSEGSTVTVHVPVRFINENKSPGIKQGGKLNVVCHEVSLLCPANNIPDSITVDLNDLKIGDSIHME  163 (191)
Q Consensus        84 ~p~~~~i~HvDF~~v~~~~~v~v~VPI~~~ge~~~~Gvk~GG~l~~~~~~i~v~~~p~~IPe~ievDvs~L~~Gd~i~v~  163 (191)
                      ||+++.++|+|||+++ +++++++|||+|+|+  |+|+|+||+|++.+++|+|+|+|.+||++|+||+|+|++||+++++
T Consensus        77 ~pv~~~i~HvDF~~v~-~~~v~v~VPv~~~G~--~~gvk~GG~l~~~~~~i~v~~~p~~IPe~i~VDvs~L~igd~i~v~  153 (185)
T d1feua_          77 DKRRRRPEHVDFFVLS-DEPVEMYVPLRFVGT--PAGVRAGGVLQEIHRDILVKVSPRNIPEFIEVDVSGLEIGDSLHAS  153 (185)
T ss_dssp             CSSSSCEEEEEEEECC-SSCEEEEEEEEEESC--CHHHHTTCEEEECCSEEEEEECGGGCCSCEEEECTTCCTTEEEEGG
T ss_pred             CCCCCCEEEEEEEECC-CCEEEEEECEEEEEC--CCCCCCCCEEEEEEEEEEEEEECCCCCEEEEEECCCCCCCCEEEEE
T ss_conf             5320303577886146-723899933388612--3431135179998726677860007871999972037799868988


Q ss_pred             EEECCCCCEECCCCCCEEEEEECCCCC
Q ss_conf             753588867836898269999448877
Q gi|254780418|r  164 DIRLPEKTSSMSQLNITIATIVAPISG  190 (191)
Q Consensus       164 Dl~lpegv~~l~d~~~~vvsv~~P~~g  190 (191)
                      ||++|+|+++++|++.+||+|.+|++-
T Consensus       154 Dl~lp~gv~~~~d~~~~vv~v~~p~~~  180 (185)
T d1feua_         154 DLKLPPGVELAVSPEETIAAVVPPEDV  180 (185)
T ss_dssp             GSCCCTTCEESSCTTCEEEEEECSSSS
T ss_pred             EECCCCCCEECCCCCCEEEEEECCCCC
T ss_conf             223899958904899769999589853



>d2zjrs1 b.53.1.1 (S:1-175) Ribosomal protein TL5 (general stress protein CTC) {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1dfup_ b.53.1.1 (P:) Ribosomal protein L25 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 191 50S ribosomal protein L25/general stress protein C
1b75_A_94 (A:) Protein (50S ribosomal protein L25); RNA-bind 8e-25
2zjr_S_1-9191 (S:1-91) 50S ribosomal protein L25; ribosome, larg 2e-22
1feu_A_1-9393 (A:1-93) 50S ribosomal protein L25; general stress 3e-21
1feu_A_94-206113 (A:94-206) 50S ribosomal protein L25; general stre 6e-22
2zjr_S_92-237146 (S:92-237) 50S ribosomal protein L25; ribosome, la 7e-22
>1b75_A (A:) Protein (50S ribosomal protein L25); RNA-binding protein; NMR {Escherichia coli}Length = 94 Back     alignment and structure
 Score =  107 bits (270), Expect = 8e-25
 Identities = 28/92 (30%), Positives = 45/92 (48%)

Query: 7  KLSAVMRDKVGKGSARLLRKNGQIPAIIYGNMSDPKPIALSAKDISKRLYSKNFMTTILT 66
           ++A +R + GKG++R LR   + PAIIYG    P  I L    +        F + +LT
Sbjct: 3  TINAEVRKEQGKGASRRLRAANKFPAIIYGGKEAPLAIELDHDKVMNMQAKAEFYSEVLT 62

Query: 67 LDIGKELVHVIPKDYQLDPVSDILIHADFLQV 98
          + +  + + V  +D Q  P    L H DF++ 
Sbjct: 63 IVVDGKEIKVKAQDVQRHPYKPKLQHIDFVRA 94


>2zjr_S (S:1-91) 50S ribosomal protein L25; ribosome, large ribosomal subunit, ribonucleoprotein, RNA-binding, rRNA-binding, tRNA-binding, methylation; 2.91A {Deinococcus radiodurans}Length = 91 Back     alignment and structure
>1feu_A (A:1-93) 50S ribosomal protein L25; general stress protein CTC, 5S rRNA-protein complex, cadmium IONS, ribosome; 2.30A {Thermus thermophilus}Length = 93 Back     alignment and structure
>1feu_A (A:94-206) 50S ribosomal protein L25; general stress protein CTC, 5S rRNA-protein complex, cadmium IONS, ribosome; 2.30A {Thermus thermophilus}Length = 113 Back     alignment and structure
>2zjr_S (S:92-237) 50S ribosomal protein L25; ribosome, large ribosomal subunit, ribonucleoprotein, RNA-binding, rRNA-binding, tRNA-binding, methylation; 2.91A {Deinococcus radiodurans}Length = 146 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target191 50S ribosomal protein L25/general stress protein Ctc [C
1b75_A_94 Protein (50S ribosomal protein L25); RNA-binding p 99.93
1feu_A_1-9393 50S ribosomal protein L25; general stress protein 99.9
2zjr_S_1-9191 50S ribosomal protein L25; ribosome, large ribosom 99.9
1feu_A_94-206113 50S ribosomal protein L25; general stress protein 99.9
2zjr_S_92-237146 50S ribosomal protein L25; ribosome, large ribosom 99.89
2kpu_A_96 YBBR family protein; structural genomics, PSI-2, p 90.7
>1b75_A (A:) Protein (50S ribosomal protein L25); RNA-binding protein; NMR {Escherichia coli} Back     alignment and structure
Probab=99.93  E-value=5.8e-28  Score=195.06  Aligned_cols=93  Identities=30%  Similarity=0.507  Sum_probs=90.1

Q ss_pred             EEEEEEEECCCCCHHHHHHHHCCCCCEEEECCCCCCEEEEEEECHHHEEHHCCCCCEEEEEECCCCCCEEEEEEEEECCC
Q ss_conf             99999991687617789999789943899678988556999800221001114662257996167752037861212143
Q gi|254780418|r    6 CKLSAVMRDKVGKGSARLLRKNGQIPAIIYGNMSDPKPIALSAKDISKRLYSKNFMTTILTLDIGKELVHVIPKDYQLDP   85 (191)
Q Consensus         6 ~~L~~~~R~~~gk~~~r~lR~~G~VPaviYG~~~e~~~i~v~~~~l~k~l~~~~~~~~v~~l~i~g~~~~vlikevQ~~p   85 (191)
                      ++|+|++|+.+||+++|+||++|+||||+||++.+|++++++.++|.+++++.++.+.+|+|+++|++++|++||+|+||
T Consensus         2 i~L~a~~R~~~gk~~~rklR~~G~vPaviYG~~~~~~~i~v~~~~~~k~l~~~~~~~~ii~l~~~g~~~~vlikeiQ~~p   81 (94)
T 1b75_A            2 FTINAEVRKEQGKGASRRLRAANKFPAIIYGGKEAPLAIELDHDKVMNMQAKAEFYSEVLTIVVDGKEIKVKAQDVQRHP   81 (94)
T ss_dssp             CCEEECSSCCSSSSSSSSTTTTTBCCEEEECSSSCCEEECCBSHHHHHHHTTTHHHHTCEEEEESSCEEEECCSEEECCS
T ss_pred             EEEEEEEECCCCCHHHHHHHHCCCCCEEEECCCCCCCEEEECHHHHHHHHCCCCCCCEEEEEEECCCEEEEEHHEEEECC
T ss_conf             38999991577857899999869962999788887716773499996454014644615999748938871112146567


Q ss_pred             CCCCEEEEEEEEE
Q ss_conf             2684654489993
Q gi|254780418|r   86 VSDILIHADFLQV   98 (191)
Q Consensus        86 ~~~~i~HvDF~~v   98 (191)
                      +++.++|+|||+|
T Consensus        82 ~~~~i~HvDF~~V   94 (94)
T 1b75_A           82 YKPKLQHIDFVRA   94 (94)
T ss_dssp             SSCCCCEEEEEBC
T ss_pred             CCCCEEEEEEECC
T ss_conf             7898788961149



>1feu_A (A:1-93) 50S ribosomal protein L25; general stress protein CTC, 5S rRNA-protein complex, cadmium IONS, ribosome; 2.30A {Thermus thermophilus} Back     alignment and structure
>2zjr_S (S:1-91) 50S ribosomal protein L25; ribosome, large ribosomal subunit, ribonucleoprotein, RNA-binding, rRNA-binding, tRNA-binding, methylation; 2.91A {Deinococcus radiodurans} Back     alignment and structure
>1feu_A (A:94-206) 50S ribosomal protein L25; general stress protein CTC, 5S rRNA-protein complex, cadmium IONS, ribosome; 2.30A {Thermus thermophilus} Back     alignment and structure
>2zjr_S (S:92-237) 50S ribosomal protein L25; ribosome, large ribosomal subunit, ribonucleoprotein, RNA-binding, rRNA-binding, tRNA-binding, methylation; 2.91A {Deinococcus radiodurans} Back     alignment and structure
>2kpu_A (A:) YBBR family protein; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Desulfitobacterium hafniense dcb-2} Back     alignment and structure