254780419

254780419

aspartyl-tRNA synthetase

GeneID in NCBI database:8209405Locus tag:CLIBASIA_01520
Protein GI in NCBI database:254780419Protein Accession:YP_003064832.1
Gene range:-(322902, 324770)Protein Length:622aa
Gene description:aspartyl-tRNA synthetase
COG prediction:[J] Aspartyl-tRNA synthetase
KEGG prediction:aspS; aspartyl-tRNA synthetase (EC:6.1.1.12); K01876 aspartyl-tRNA synthetase [EC:6.1.1.12]
SEED prediction:Aspartyl-tRNA synthetase (EC 6.1.1.12)
Pathway involved in KEGG:Aminoacyl-tRNA biosynthesis [PATH:las00970]
Subsystem involved in SEED:tRNA aminoacylation, Asp and Asn
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620--
MHRYRTHSCGDLGVSDVGSFVRLSGWVHRVRPHGGIIFLDIRDHYGITQVVANPDSACFEIAKSVRSEWVLCIDGLVMSRSAETINANIITGQIELSAQKIEILSVAEELPLPVFGEREYPESIRFKYRFLDLRRDTLHKNIVKRTRIINSMRCRMIAENFIECSTPILTASSPEGARDFLVPSRVNQGSFYALPQAPQQYKQLLMASGFDRYFQIAPCFRDEDPRSDRLPGEFYQLDMEMSFVEQDDILNTMENVLRGVFEEFSNGNTVSNNFLRICYDDAIRRYGTDKPDLRNPIIMHNVTEHFVHSEFRVFSKILSVNPGYEVWAIPAKGGGGNRAFCDRMNEWARSQGQPGLAYIFWRLDESGNVAGMGPVAKHLNIVNTEAIRVRLDMQDGDSCFFIAGDPLKFCSFAADARNHIAQELGIINCNCFEFCWIMDFPFYEWNEEEKKIDFAHNPFTMPQGGMESLKGNDLLSIKAFQYDLVCNGFEIASGGIRNHMSEVMLQAFSNVGISKEVVENRFGGLYRAFQCGMPPHGGIAAGIDRIVMLLLGAKNVREVSLFPMSQNFCDLLMGSPSTVSVEQLRELGLRIVENPKKILKISVTTILRNVYGLKIIHSITLL
ccccccccHHHccHHHcccEEEEEEEEEEEcccccEEEEEEEcccEEEEEEEEcccccHHHHHHcccccEEEEEEEEEEcccccccccccccEEEEEEEEEEEEcccccccccccccccccHHHHccEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHcccEEEccccEEcccccccccEEEcccccccccccccccHHHHHHHHHHcccccEEEEEEEEccccccccccccccEEEEEEEccccHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHccccccEEEEEEcccccccHHHHccHHHHHHHHccccccEEEEEEcccccccccccHHHHccHHHHHHHHHHcccccccEEEEEcccHHHHHHHHHHHHHHHHHHHcccccccccEEEEEEccccccccccccEEEEEccccccccccHHHHHccccccEEEEEEEEEccEEEcccHHccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHccccccccEEccHHHHHHHHcccccHHHEEccccccccccccccccccccHHHHHHHcccccccHHHHHHHHHHHHHHHHcccEEEEcEEcc
ccccccccHHHccHHHcccEEEEEEEEEEEEEccccEEEEEEEccEEEEEEEccccccHHHHcccccccEEEEEEEEEEcccccccccccccEEEEEEccEEEEcccccccccccccccccHHHHHHcHHHHcccHHHHHHHHHHHHHHHHHHHHHHHcccEEccccccEccccccccccEEEccccccEEEEcccccHHHHHHHHHccccEEEEEEEEEccccccccccccEEEEEEEEEEccccHHHHHHHHHHHHHHHHHHcccccccccccEEEHHHHHHHHcccccccccccccEEcHHHHccccccHHHHccEEccccEEEEEEcccccccHHHHHHHHHHHHHcccccEEEEEEccccccccccccHHHHcccHHHHHHHHHHHccccccEEEEEccccHHHHHHHHHHHHHHHHHHcccccccccEEEEEccEcEccccccccccEcccccEcEcHHHccHHHHcHHHcEEcEEEEEEccEEEEEEEEEcccHHHHHHHHHHHccccccHHHHcHHHHHHHccccccEEEEEEEHHHHHHHHHccccHHHHccccccccccEccccEcEEccHHHHHHHcEEEcccHHHEEEEEHHHHHHHHHcHHEEEHHccc
mhryrthscgdlgvsdvgsFVRLSGwvhrvrphggiifldirdhygitqvvanpdsaCFEIAKSVRSEWVLCIDGLVMSRSAETINANIITGQIELSAQKIEILSVaeelplpvfgereypesirFKYRFLDLRRDTLHKNIVKRTRIINSMRCRMIAENfiecstpiltasspegardflvpsrvnqgsfyalpqapqQYKQLLMASGfdryfqiapcfrdedprsdrlpgefyqldmEMSFVEQDDILNTMENVLRGVFEefsngntvsnnfLRICYDDAirrygtdkpdlrnpiimhnvtehfvhsefrvfskilsvnpgyevwaipakggggnraFCDRMNEWarsqgqpgLAYIFWRLdesgnvagmgpvakhlnIVNTEAIRVRldmqdgdscffiagdplKFCSFAADARNHIAQELGiincncfefcwimdfpfyewneeekkidfahnpftmpqggmeslkgndllSIKAFQYDLVCNGFEIASGGIRNHMSEVMLQAFSNVGISKEVVENRFGGlyrafqcgmpphggiaAGIDRIVMLLLGaknvrevslfpmsqnfcdllmgspstvSVEQLRELGLRIVENPKKILKISVTTILRNVYGLKIIHSITLL
mhryrthscgdlgvsdVGSFVRLSGWVHRVRPHGGIIFLDIRDHYGITQVVANPDSACFEIAKSVRSEWVLCIDGLVMSRSAETINANIITGQIELSAQKIEILSVAEelplpvfgereypesirfkyrfldlrrdtlhknivkrtriinSMRCRMIAENFIECSTPILTASSPEGARDFLVPSRVNQGSFYALPQAPQQYKQLLMASGFDRYFQIAPcfrdedprsdRLPGEFYQLDMEMSFVEQDDILNTMENVLRGVFEefsngntvsnnfLRICYDDAIRRYGTDKPDLRNPIIMHNVTEHFVHSEFRVFSKILSVNPGYEVWAIPAKGGGGNRAFCDRMNEWARSQGQPGLAYIFWRLDESGNVAGMGPVAKHLNIVNTEAIRVRLDMQDGDSCFFIAGDPLKFCSFAADARNHIAQELGIINCNCFEFCWIMDFPFYEWNEEEKKIDFAHNPFTMPQGGMESLKGNDLLSIKAFQYDLVCNGFEIASGGIRNHMSEVMLQAFSNVGISKEVVENRFGGLYRAFQCGMPPHGGIAAGIDRIVMLLLGAKNVREVSLFPMSQNFCDLLMGSPSTVSVEQLRELglrivenpkkilkisvttilrnvyglkiihsitll
MHRYRTHSCGDLGVSDVGSFVRLSGWVHRVRPHGGIIFLDIRDHYGITQVVANPDSACFEIAKSVRSEWVLCIDGLVMSRSAETINANIITGQIELSAQKIEILSVAEELPLPVFGEREYPESIRFKYRFLDLRRDTLHKNIVKRTRIINSMRCRMIAENFIECSTPILTASSPEGARDFLVPSRVNQGSFYALPQAPQQYKQLLMASGFDRYFQIAPCFRDEDPRSDRLPGEFYQLDMEMSFVEQDDILNTMENVLRGVFEEFSNGNTVSNNFLRICYDDAIRRYGTDKPDLRNPIIMHNVTEHFVHSEFRVFSKILSVNPGYEVWAIPAKGGGGNRAFCDRMNEWARSQGQPGLAYIFWRLDESGNVAGMGPVAKHLNIVNTEAIRVRLDMQDGDSCFFIAGDPLKFCSFAADARNHIAQELGIINCNCFEFCWIMDFPFYEWNEEEKKIDFAHNPFTMPQGGMESLKGNDLLSIKAFQYDLVCNGFEIASGGIRNHMSEVMLQAFSNVGISKEVVENRFGGLYRAFQCGMPPHGGIAAGIDRIVMLLLGAKNVREVSLFPMSQNFCDLLMGSPSTVSVEQLRELGLRIVENPKKILKISVTTILRNVYGLKIIHSITLL
**RYRTHSCGDLGVSDVGSFVRLSGWVHRVRPHGGIIFLDIRDHYGITQVVANPDSACFEIAKSVRSEWVLCIDGLVMSRSAETINANIITGQIELSAQKIEILSVAEELPLPVFGEREYPESIRFKYRFLDLRRDTLHKNIVKRTRIINSMRCRMIAENFIECSTPILTASSPEGARDFLVPSRVNQGSFYALPQAPQQYKQLLMASGFDRYFQIAPCFRDEDPRSDRLPGEFYQLDMEMSFVEQDDILNTMENVLRGVFEEFSNGNTVSNNFLRICYDDAIRRYGTDKPDLRNPIIMHNVTEHFVHSEFRVFSKILSVNPGYEVWAIPAKGGGGNRAFCDRMNEWARSQGQPGLAYIFWRLDESGNVAGMGPVAKHLNIVNTEAIRVRLDMQDGDSCFFIAGDPLKFCSFAADARNHIAQELGIINCNCFEFCWIMDFPFYEWNEEEKKIDFAHNPFTMPQGGMESLKGNDLLSIKAFQYDLVCNGFEIASGGIRNHMSEVMLQAFSNVGISKEVVENRFGGLYRAFQCGMPPHGGIAAGIDRIVMLLLGAKNVREVSLFPMSQNFCDLLMGSPSTVSVEQLRELGL*******************NVYGLKIIHSITLL
********CGDLGVSDVGSFVRLSGWVHRVRPHGGIIFLDIRDHYGITQVVANPDSACFEIAKSVRSEWVLCIDGLVMSRSAETINANIITGQIELSAQKIEILSVAEELPLPVFGEREYPESIRFKYRFLDLRRDTLHKNIVKRTRIINSMRCRMIAENFIECSTPILTASSPEGARDFLVPSRVNQGSFYALPQAPQQYKQLLMASGFDRYFQIAPCFRDEDPRSDRLPGEFYQLDMEMSFVEQDDILNTMENVLRGVFEEFSNGNTVSNNFLRICYDDAIRRYGTDKPDLRNPIIMHNVTEHFVHSEFRVFSKILSVNPGYEVWAIPAKGGGGNRAFCDRMNEWARSQGQPGLAYIFWRLDESGNVAGMGPVAKHLNIVNTEAIRVRLDMQDGDSCFFIAGDPLKFCSFAADARNHIAQELGIINCNCFEFCWIMDFPFYEWNEEEKKIDFAHNPFTMPQGGMESLKGNDLLSIKAFQYDLVCNGFEIASGGIRNHMSEVMLQAFSNVGISKEVVENRFGGLYRAFQCGMPPHGGIAAGIDRIVMLLLGAKNVREVSLFPMSQNFCDLLMGSPSTVSVEQLRELGLRIVENPKKILKISVTTILRNVYGLKIIHSITLL
****RTHSCGDLGVSDVGSFVRLSGWVHRVRPHGGIIFLDIRDHYGITQVVANPDSACFEIAKSVRSEWVLCIDGLVMSRSAETINANIITGQIELSAQKIEILSVAEELPLPVFGEREYPESIRFKYRFLDLRRDTLHKNIVKRTRIINSMRCRMIAENFIECSTPILTASSPEGARDFLVPSRVNQGSFYALPQAPQQYKQLLMASGFDRYFQIAPCFRDEDPRSDRLPGEFYQLDMEMSFVEQDDILNTMENVLRGVFEEFSNGNTVSNNFLRICYDDAIRRYGTDKPDLRNPIIMHNVTEHFVHSEFRVFSKILSVNPGYEVWAIPAKGGGGNRAFCDRMNEWARSQGQPGLAYIFWRLDESGNVAGMGPVAKHLNIVNTEAIRVRLDMQDGDSCFFIAGDPLKFCSFAADARNHIAQELGIINCNCFEFCWIMDFPFYEWNEEEKKIDFAHNPFTMPQGGMESLKGNDLLSIKAFQYDLVCNGFEIASGGIRNHMSEVMLQAFSNVGISKEVVENRFGGLYRAFQCGMPPHGGIAAGIDRIVMLLLGAKNVREVSLFPMSQNFCDLLMGSPSTVSVEQLRELGLRIVENPKKILKISVTTILRNVYGLKIIHSITLL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHRYRTHSCGDLGVSDVGSFVRLSGWVHRVRPHGGIIFLDIRDHYGITQVVANPDSACFEIAKSVRSEWVLCIDGLVMSRSAETINANIITGQIELSAQKIEILSVAEELPLPVFGEREYPESIRFKYRFLDLRRDTLHKNIVKRTRIINSMRCRMIAENFIECSTPILTASSPEGARDFLVPSRVNQGSFYALPQAPQQYKQLLMASGFDRYFQIAPCFRDEDPRSDRLPGEFYQLDMEMSFVEQDDILNTMENVLRGVFEEFSNGNTVSNNFLRICYDDAIRRYGTDKPDLRNPIIMHNVTEHFVHSEFRVFSKILSVNPGYEVWAIPAKGGGGNRAFCDRMNEWARSQGQPGLAYIFWRLDESGNVAGMGPVAKHLNIVNTEAIRVRLDMQDGDSCFFIAGDPLKFCSFAADARNHIAQELGIINCNCFEFCWIMDFPFYEWNEEEKKIDFAHNPFTMPQGGMESLKGNDLLSIKAFQYDLVCNGFEIASGGIRNHMSEVMLQAFSNVGISKEVVENRFGGLYRAFQCGMPPHGGIAAGIDRIVMLLLGAKNVREVSLFPMSQNFCDLLMGSPSTVSVEQLRELGLRIVENPKKILKISVTTILRNVYGLKIIHSITLL
MHRYRTHSCGDLGVSDVGSFVRLSGWVHRVRPHGGIIFLDIRDHYGITQVVANPDSACFEIAKSVRSEWVLCIDGLVMSRSAETINANIITGQIELSAQKIEILSVAEELPLPVFGEREYPESIRFKYRFLDLRRDTLHKNIVKRTRIINSMRCRMIAENFIECSTPILTASSPEGARDFLVPSRVNQGSFYALPQAPQQYKQLLMASGFDRYFQIAPCFRDEDPRSDRLPGEFYQLDMEMSFVEQDDILNTMENVLRGVFEEFSNGNTVSNNFLRICYDDAIRRYGTDKPDLRNPIIMHNVTEHFVHSEFRVFSKILSVNPGYEVWAIPAKGGGGNRAFCDRMNEWARSQGQPGLAYIFWRLDESGNVAGMGPVAKHLNIVNTEAIRVRLDMQDGDSCFFIAGDPLKFCSFAADARNHIAQELGIINCNCFEFCWIMDFPFYEWNEEEKKIDFAHNPFTMPQGGMESLKGNDLLSIKAFQYDLVCNGFEIASGGIRNHMSEVMLQAFSNVGISKEVVENRFGGLYRAFQCGMPPHGGIAAGIDRIVMLLLGAKNVREVSLFPMSQNFCDLLMGSPSTVSVEQLRELGLRIVENPKKILKISVTTILRNVYGLKIIHSITLL
MHRYRTHSCGDLGVSDVGSFVRLSGWVHRVRPHGGIIFLDIRDHYGITQVVANPDSACFEIAKSVRSEWVLCIDGLVMSRSAETINANIITGQIELSAQKIEILSVAEELPLPVFGEREYPESIRFKYRFLDLRRDTLHKNIVKRTRIINSMRCRMIAENFIECSTPILTASSPEGARDFLVPSRVNQGSFYALPQAPQQYKQLLMASGFDRYFQIAPCFRDEDPRSDRLPGEFYQLDMEMSFVEQDDILNTMENVLRGVFEEFSNGNTVSNNFLRICYDDAIRRYGTDKPDLRNPIIMHNVTEHFVHSEFRVFSKILSVNPGYEVWAIPAKGGGGNRAFCDRMNEWARSQGQPGLAYIFWRLDESGNVAGMGPVAKHLNIVNTEAIRVRLDMQDGDSCFFIAGDPLKFCSFAADARNHIAQELGIINCNCFEFCWIMDFPFYEWNEEEKKIDFAHNPFTMPQGGMESLKGNDLLSIKAFQYDLVCNGFEIASGGIRNHMSEVMLQAFSNVGISKEVVENRFGGLYRAFQCGMPPHGGIAAGIDRIVMLLLGAKNVREVSLFPMSQNFCDLLMGSPSTVSVEQLRELGLRIVENPKKILKISVTTILRNVYGLKIIHSITLL

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target622 aspartyl-tRNA synthetase [Candidatus Liberibacter asiat
254781118502 lysyl-tRNA synthetase [Candidatus Liberibacter asi 9e-10
254781118502 lysyl-tRNA synthetase [Candidatus Liberibacter asi 2e-07
254781066355 putative lysyl-tRNA synthetase protein [Candidatus 3e-05
>gi|254781118|ref|YP_003065531.1| lysyl-tRNA synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 502 Back     alignment
 Score = 57.0 bits (136), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 60/241 (24%), Positives = 115/241 (47%), Gaps = 16/241 (6%)

Query: 20  FVRLSGWVHRVRPHGGIIFLDIRDHYGITQVVANPDSACFEIAKSVRSEWVLCIDGLVMS 79
            + ++G V+  R  G  +F+DI D  G  Q+  + D+A  +      S+ +L +  +   
Sbjct: 62  MITVAGRVYSSRNSG--MFMDIHDASGKIQIFTHKDTADQD------SQNLLSMIDIGDI 113

Query: 80  RSAETINANIITGQIELSAQKIEILSVA-EELPLPVFGEREYPESIRFKYRFLDLRRDTL 138
                       G++ ++AQKI +LS A   +P   +G  +    IR++ R+LD+  ++ 
Sbjct: 114 IGITGQVRRTKRGELTVNAQKIIMLSKALNSIPETYYGLSDV--EIRYRKRYLDIISNSD 171

Query: 139 HK-NIVKRTRIINSMRCRMIAENFIECSTPILTASSPEGARD-FLVPSRVNQGSFYALPQ 196
            K    +R+ +I+ +R  M  + F+E  TPIL         D F     + +   Y L  
Sbjct: 172 SKIRFQQRSLLISQIRHFMEKKGFMEVETPILQPIYGGATADPFKTHHNILKADMY-LRI 230

Query: 197 APQQYKQLLMASGF-DRYFQIAPCFRDEDPRSDRLPGEFYQLDMEMSFVEQDDILNTMEN 255
           AP+ Y + ++ SG  D+ F++   FR+E   S   P EF  ++   ++ +  D++  +E+
Sbjct: 231 APELYLKRVLISGLTDQVFELNRNFRNEGVSSRHNP-EFTMIEAYWAYTDYRDMMKLVED 289

Query: 256 V 256
           +
Sbjct: 290 L 290

>gi|254781118|ref|YP_003065531.1| lysyl-tRNA synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 502 Back     alignment
 Score = 49.3 bits (116), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 47/91 (51%), Gaps = 13/91 (14%)

Query: 481 QYDLVCNGFEIASGGIRNHMSEVMLQAFSNVGISKEVVENRFGGLYR--------AFQCG 532
           +++  CNG+EI      N  SE+       + + ++V ++   G +         A   G
Sbjct: 405 RFETYCNGWEIC-----NAFSELNDPVEQRIRMEQQVEQSHQRGEHTILDEDFLDAMTYG 459

Query: 533 MPPHGGIAAGIDRIVMLLLGAKNVREVSLFP 563
           MPP  G+  GIDR++MLL  A ++R+V LFP
Sbjct: 460 MPPASGLGLGIDRLIMLLTNAPSIRDVILFP 490

>gi|254781066|ref|YP_003065479.1| putative lysyl-tRNA synthetase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 355 Back     alignment
 Score = 42.4 bits (98), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 23/35 (65%)

Query: 533 MPPHGGIAAGIDRIVMLLLGAKNVREVSLFPMSQN 567
           MP   GIA G DR+VML+ GA N+ EV   P SQ+
Sbjct: 316 MPQSSGIAMGFDRLVMLVTGANNINEVIWTPFSQS 350

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target622 aspartyl-tRNA synthetase [Candidatus Liberibacter asiat
315122137598 aspartyl-tRNA synthetase [Candidatus Liberibacter solan 1 0.0
13476902596 aspartyl-tRNA synthetase [Mesorhizobium loti MAFF303099 1 0.0
260466879598 aspartyl-tRNA synthetase [Mesorhizobium opportunistum W 1 0.0
319784194598 aspartyl-tRNA synthetase [Mesorhizobium ciceri biovar b 1 0.0
15888491595 aspartyl-tRNA synthetase [Agrobacterium tumefaciens str 1 0.0
163759181595 aspartyl-tRNA synthetase [Hoeflea phototrophica DFL-43] 1 0.0
227821517595 aspartyl-tRNA synthetase [Sinorhizobium fredii NGR234] 1 0.0
325292528627 Aspartyl-tRNA synthetase [Agrobacterium sp. H13-3] Leng 1 0.0
121602128596 aspartyl-tRNA synthetase [Bartonella bacilliformis KC58 1 0.0
307317752595 aspartyl-tRNA synthetase [Sinorhizobium meliloti AK83] 1 0.0
>gi|315122137|ref|YP_004062626.1| aspartyl-tRNA synthetase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 598 Back     alignment and organism information
 Score = 1072 bits (2772), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 508/596 (85%), Positives = 555/596 (93%), Gaps = 1/596 (0%)

Query: 1   MHRYRTHSCGDLGVSDVGSFVRLSGWVHRVRPHGGIIFLDIRDHYGITQVVANPDSACFE 60
           MHRYRTHSCGDL VSDVGSFVRLSGW+HRVRPHGGIIFLDIRDHYG+TQ+VANP+S+CF+
Sbjct: 1   MHRYRTHSCGDLRVSDVGSFVRLSGWIHRVRPHGGIIFLDIRDHYGLTQIVANPESSCFD 60

Query: 61  IAKSVRSEWVLCIDGLVMSRSAETINANIITGQIELSAQKIEILSVAEELPLPVFGEREY 120
           IAKSVRSEWV+CIDGLVMSR+AETIN+NI TG+IEL AQ IE+LSVAEELPLPVFGEREY
Sbjct: 61  IAKSVRSEWVVCIDGLVMSRTAETINSNIETGEIELYAQGIEVLSVAEELPLPVFGEREY 120

Query: 121 PESIRFKYRFLDLRRDTLHKNIVKRTRIINSMRCRMIAENFIECSTPILTASSPEGARDF 180
           PE+IRFKYRFLDLRRDTLHKNIVKR  II+SMR RMIAENFIE STPILTASSPEGARDF
Sbjct: 121 PENIRFKYRFLDLRRDTLHKNIVKRANIISSMRHRMIAENFIEYSTPILTASSPEGARDF 180

Query: 181 LVPSRVNQGSFYALPQAPQQYKQLLMASGFDRYFQIAPCFRDEDPRSDRLPGEFYQLDME 240
           LVPSRVNQGSFYALPQAPQQYKQLLMASGFDRYFQIAPCFRDEDPR+DRLPGEFYQLD+E
Sbjct: 181 LVPSRVNQGSFYALPQAPQQYKQLLMASGFDRYFQIAPCFRDEDPRADRLPGEFYQLDVE 240

Query: 241 MSFVEQDDILNTMENVLRGVFEEFSNGNTVSNNFLRICYDDAIRRYGTDKPDLRNPIIMH 300
           MSFVEQ+D+LNTMENVLRG+FEEF+ G  VS NF RICYDDAIR+YGTDKPDLRNPIIM+
Sbjct: 241 MSFVEQEDVLNTMENVLRGLFEEFAEGYPVSQNFPRICYDDAIRKYGTDKPDLRNPIIMN 300

Query: 301 NVTEHFVHSEFRVFSKILSVNPGYEVWAIPAKGGGGNRAFCDRMNEWARSQGQPGLAYIF 360
           NVTEHF  SEFRVFSK+LS NP YEVWAIPAK  GG RAFCDRMN WA+SQGQ GLAYIF
Sbjct: 301 NVTEHFACSEFRVFSKMLSSNPEYEVWAIPAK-KGGTRAFCDRMNAWAQSQGQVGLAYIF 359

Query: 361 WRLDESGNVAGMGPVAKHLNIVNTEAIRVRLDMQDGDSCFFIAGDPLKFCSFAADARNHI 420
           WRLDE GNV G GPVAKHLNI +TE+IR  LDMQDGD+CFFIAG PLKFC+FAA+ARN+I
Sbjct: 360 WRLDEKGNVTGAGPVAKHLNIESTESIRAMLDMQDGDACFFIAGHPLKFCAFAANARNYI 419

Query: 421 AQELGIINCNCFEFCWIMDFPFYEWNEEEKKIDFAHNPFTMPQGGMESLKGNDLLSIKAF 480
           AQELG+I+ N FE CWI+DFPFYEWNEEEKKI+FAHNPF+MPQGGM+SLKG++LLS+KAF
Sbjct: 420 AQELGMIDSNRFELCWIVDFPFYEWNEEEKKIEFAHNPFSMPQGGMKSLKGDNLLSVKAF 479

Query: 481 QYDLVCNGFEIASGGIRNHMSEVMLQAFSNVGISKEVVENRFGGLYRAFQCGMPPHGGIA 540
           QYDLVCNGFEIASGGIRN+MS++M+QAFSNVGISKE VE+RFGGLYRAFQ GMPPHGG+A
Sbjct: 480 QYDLVCNGFEIASGGIRNYMSDIMIQAFSNVGISKEAVESRFGGLYRAFQYGMPPHGGMA 539

Query: 541 AGIDRIVMLLLGAKNVREVSLFPMSQNFCDLLMGSPSTVSVEQLRELGLRIVENPK 596
           AGIDRIVMLLL AK+VREVSLFPM+QNFCDLLMG+PS     QLRELGLRIVE PK
Sbjct: 540 AGIDRIVMLLLRAKSVREVSLFPMNQNFCDLLMGAPSPAISSQLRELGLRIVEKPK 595


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|13476902|ref|NP_108471.1| aspartyl-tRNA synthetase [Mesorhizobium loti MAFF303099] Length = 596 Back     alignment and organism information
>gi|260466879|ref|ZP_05813063.1| aspartyl-tRNA synthetase [Mesorhizobium opportunistum WSM2075] Length = 598 Back     alignment and organism information
>gi|319784194|ref|YP_004143670.1| aspartyl-tRNA synthetase [Mesorhizobium ciceri biovar biserrulae WSM1271] Length = 598 Back     alignment and organism information
>gi|15888491|ref|NP_354172.1| aspartyl-tRNA synthetase [Agrobacterium tumefaciens str. C58] Length = 595 Back     alignment and organism information
>gi|163759181|ref|ZP_02166267.1| aspartyl-tRNA synthetase [Hoeflea phototrophica DFL-43] Length = 595 Back     alignment and organism information
>gi|227821517|ref|YP_002825487.1| aspartyl-tRNA synthetase [Sinorhizobium fredii NGR234] Length = 595 Back     alignment and organism information
>gi|325292528|ref|YP_004278392.1| Aspartyl-tRNA synthetase [Agrobacterium sp. H13-3] Length = 627 Back     alignment and organism information
>gi|121602128|ref|YP_989155.1| aspartyl-tRNA synthetase [Bartonella bacilliformis KC583] Length = 596 Back     alignment and organism information
>gi|307317752|ref|ZP_07597190.1| aspartyl-tRNA synthetase [Sinorhizobium meliloti AK83] Length = 595 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target622 aspartyl-tRNA synthetase [Candidatus Liberibacter asiat
PRK00476588 PRK00476, aspS, aspartyl-tRNA synthetase; Validated 0.0
TIGR00459583 TIGR00459, aspS_bact, aspartyl-tRNA synthetase, bacteri 1e-152
PLN02903652 PLN02903, PLN02903, aminoacyl-tRNA ligase 1e-148
KOG2411628 KOG2411, KOG2411, KOG2411, Aspartyl-tRNA synthetase, mi 1e-121
PRK12820706 PRK12820, PRK12820, bifunctional aspartyl-tRNA syntheta 1e-116
COG0173585 COG0173, AspS, Aspartyl-tRNA synthetase [Translation, r 0.0
pfam00152341 pfam00152, tRNA-synt_2, tRNA synthetases class II (D, K 3e-62
cd00777280 cd00777, AspRS_core, Asp tRNA synthetase (aspRS) class 1e-60
cd00669269 cd00669, Asp_Lys_Asn_RS_core, Asp_Lys_Asn_tRNA syntheta 1e-33
cd00776322 cd00776, AsxRS_core, Asx tRNA synthetase (AspRS/AsnRS) 1e-20
PRK12445505 PRK12445, PRK12445, lysyl-tRNA synthetase; Reviewed 8e-13
cd00775329 cd00775, LysRS_core, Lys_tRNA synthetase (LysRS) class 9e-12
TIGR00462304 TIGR00462, genX, lysyl-tRNA synthetase-like protein Gen 2e-05
COG2269322 COG2269, COG2269, Truncated, possibly inactive, lysyl-t 0.001
cd00777280 cd00777, AspRS_core, Asp tRNA synthetase (aspRS) class 1e-50
cd00669269 cd00669, Asp_Lys_Asn_RS_core, Asp_Lys_Asn_tRNA syntheta 3e-20
PRK05159437 PRK05159, aspC, aspartyl-tRNA synthetase; Provisional 1e-19
cd04317135 cd04317, EcAspRS_like_N, EcAspRS_like_N: N-terminal, an 2e-45
cd04316108 cd04316, ND_PkAspRS_like_N, ND_PkAspRS_like_N: N-termin 1e-12
cd04319103 cd04319, PhAsnRS_like_N, PhAsnRS_like_N: N-terminal, an 9e-07
cd04322108 cd04322, LysRS_N, LysRS_N: N-terminal, anticodon recogn 5e-05
cd04320102 cd04320, AspRS_cyto_N, AspRS_cyto_N: N-terminal, antico 0.004
PRK05159437 PRK05159, aspC, aspartyl-tRNA synthetase; Provisional 2e-44
COG0017435 COG0017, AsnS, Aspartyl/asparaginyl-tRNA synthetases [T 1e-40
TIGR00458428 TIGR00458, aspS_arch, aspartyl-tRNA synthetase, archaea 1e-39
TIGR00457453 TIGR00457, asnS, asparaginyl-tRNA synthetase 2e-25
KOG0556533 KOG0556, KOG0556, KOG0556, Aspartyl-tRNA synthetase [Tr 5e-24
COG1190502 COG1190, LysU, Lysyl-tRNA synthetase (class II) [Transl 4e-20
PRK03932450 PRK03932, asnC, asparaginyl-tRNA synthetase; Validated 5e-20
PLN02850530 PLN02850, PLN02850, aspartate-tRNA ligase 2e-19
KOG0555545 KOG0555, KOG0555, KOG0555, Asparaginyl-tRNA synthetase 8e-19
KOG0554446 KOG0554, KOG0554, KOG0554, Asparaginyl-tRNA synthetase 4e-18
TIGR00499496 TIGR00499, lysS_bact, lysyl-tRNA synthetase, eukaryotic 8e-16
KOG1885560 KOG1885, KOG1885, KOG1885, Lysyl-tRNA synthetase (class 8e-14
PRK00484491 PRK00484, lysS, lysyl-tRNA synthetase; Reviewed 1e-11
PLN02502553 PLN02502, PLN02502, lysyl-tRNA synthetase 1e-07
PLN02603565 PLN02603, PLN02603, asparaginyl-tRNA synthetase 1e-07
pfam00152341 pfam00152, tRNA-synt_2, tRNA synthetases class II (D, K 2e-34
cd0410085 cd04100, Asp_Lys_Asn_RS_N, Asp_Lys_Asn_RS_N: N-terminal 3e-19
pfam0133675 pfam01336, tRNA_anti, OB-fold nucleic acid binding doma 4e-10
cd0432384 cd04323, AsnRS_cyto_like_N, AsnRS_cyto_like_N: N-termin 4e-08
cd0431882 cd04318, EcAsnRS_like_N, EcAsnRS_like_N: N-terminal, an 3e-04
PTZ00385659 PTZ00385, PTZ00385, lysyl-tRNA synthetase; Provisional 3e-13
PTZ00401550 PTZ00401, PTZ00401, aspartyl-tRNA synthetase; Provision 4e-13
PRK029831094 PRK02983, lysS, lysyl-tRNA synthetase; Provisional 7e-13
cd00776322 cd00776, AsxRS_core, Asx tRNA synthetase (AspRS/AsnRS) 1e-12
TIGR00458428 TIGR00458, aspS_arch, aspartyl-tRNA synthetase, archaea 2e-12
KOG0556533 KOG0556, KOG0556, KOG0556, Aspartyl-tRNA synthetase [Tr 4e-11
COG0017435 COG0017, AsnS, Aspartyl/asparaginyl-tRNA synthetases [T 5e-11
PLN02850530 PLN02850, PLN02850, aspartate-tRNA ligase 1e-10
PTZ00401550 PTZ00401, PTZ00401, aspartyl-tRNA synthetase; Provision 3e-10
KOG0555545 KOG0555, KOG0555, KOG0555, Asparaginyl-tRNA synthetase 0.003
TIGR00457453 TIGR00457, asnS, asparaginyl-tRNA synthetase 0.004
PRK06462335 PRK06462, PRK06462, asparagine synthetase A; Reviewed 3e-10
cd00768211 cd00768, class_II_aaRS-like_core, Class II tRNA amino-a 2e-09
PTZ00417585 PTZ00417, PTZ00417, lysine-tRNA ligase; Provisional 9e-05
PRK00484491 PRK00484, lysS, lysyl-tRNA synthetase; Reviewed 4e-08
COG1190502 COG1190, LysU, Lysyl-tRNA synthetase (class II) [Transl 5e-08
cd00775329 cd00775, LysRS_core, Lys_tRNA synthetase (LysRS) class 1e-07
TIGR00499496 TIGR00499, lysS_bact, lysyl-tRNA synthetase, eukaryotic 4e-07
PRK029831094 PRK02983, lysS, lysyl-tRNA synthetase; Provisional 9e-07
PLN02502553 PLN02502, PLN02502, lysyl-tRNA synthetase 9e-07
KOG1885560 KOG1885, KOG1885, KOG1885, Lysyl-tRNA synthetase (class 1e-06
TIGR00462304 TIGR00462, genX, lysyl-tRNA synthetase-like protein Gen 1e-06
PRK09350306 PRK09350, PRK09350, poxB regulator PoxA; Provisional 2e-05
PTZ00385659 PTZ00385, PTZ00385, lysyl-tRNA synthetase; Provisional 6e-05
COG2269322 COG2269, COG2269, Truncated, possibly inactive, lysyl-t 2e-04
PRK12445505 PRK12445, PRK12445, lysyl-tRNA synthetase; Reviewed 3e-04
PTZ00417585 PTZ00417, PTZ00417, lysine-tRNA ligase; Provisional 6e-04
KOG0554446 KOG0554, KOG0554, KOG0554, Asparaginyl-tRNA synthetase 0.002
pfam0293894 pfam02938, GAD, GAD domain 2e-06
>gnl|CDD|179042 PRK00476, aspS, aspartyl-tRNA synthetase; Validated Back     alignment and domain information
>gnl|CDD|129551 TIGR00459, aspS_bact, aspartyl-tRNA synthetase, bacterial type Back     alignment and domain information
>gnl|CDD|178491 PLN02903, PLN02903, aminoacyl-tRNA ligase Back     alignment and domain information
>gnl|CDD|37622 KOG2411, KOG2411, KOG2411, Aspartyl-tRNA synthetase, mitochondrial [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|105955 PRK12820, PRK12820, bifunctional aspartyl-tRNA synthetase/aspartyl/glutamyl-tRNA amidotransferase subunit C; Provisional Back     alignment and domain information
>gnl|CDD|30522 COG0173, AspS, Aspartyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|143920 pfam00152, tRNA-synt_2, tRNA synthetases class II (D, K and N) Back     alignment and domain information
>gnl|CDD|73228 cd00777, AspRS_core, Asp tRNA synthetase (aspRS) class II core domain Back     alignment and domain information
>gnl|CDD|58337 cd00669, Asp_Lys_Asn_RS_core, Asp_Lys_Asn_tRNA synthetase class II core domain Back     alignment and domain information
>gnl|CDD|29821 cd00776, AsxRS_core, Asx tRNA synthetase (AspRS/AsnRS) class II core domain Back     alignment and domain information
>gnl|CDD|171504 PRK12445, PRK12445, lysyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|29820 cd00775, LysRS_core, Lys_tRNA synthetase (LysRS) class II core domain Back     alignment and domain information
>gnl|CDD|161889 TIGR00462, genX, lysyl-tRNA synthetase-like protein GenX Back     alignment and domain information
>gnl|CDD|32450 COG2269, COG2269, Truncated, possibly inactive, lysyl-tRNA synthetase (class II) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|73228 cd00777, AspRS_core, Asp tRNA synthetase (aspRS) class II core domain Back     alignment and domain information
>gnl|CDD|58337 cd00669, Asp_Lys_Asn_RS_core, Asp_Lys_Asn_tRNA synthetase class II core domain Back     alignment and domain information
>gnl|CDD|179948 PRK05159, aspC, aspartyl-tRNA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|58587 cd04317, EcAspRS_like_N, EcAspRS_like_N: N-terminal, anticodon recognition domain of the type found in Escherichia coli aspartyl-tRNA synthetase (AspRS), the human mitochondrial (mt) AspRS-2, the discriminating (D) Thermus thermophilus AspRS-1, and the nondiscriminating (ND) Helicobacter pylori AspRS Back     alignment and domain information
>gnl|CDD|58586 cd04316, ND_PkAspRS_like_N, ND_PkAspRS_like_N: N-terminal, anticodon recognition domain of the type found in the homodimeric non-discriminating (ND) Pyrococcus kodakaraensis aspartyl-tRNA synthetase (AspRS) Back     alignment and domain information
>gnl|CDD|58589 cd04319, PhAsnRS_like_N, PhAsnRS_like_N: N-terminal, anticodon recognition domain of the type found in Pyrococcus horikoshii AsnRS asparaginyl-tRNA synthetase (AsnRS) Back     alignment and domain information
>gnl|CDD|58592 cd04322, LysRS_N, LysRS_N: N-terminal, anticodon recognition domain of lysyl-tRNA synthetases (LysRS) Back     alignment and domain information
>gnl|CDD|58590 cd04320, AspRS_cyto_N, AspRS_cyto_N: N-terminal, anticodon recognition domain of the type found in Saccharomyces cerevisiae and human cytoplasmic aspartyl-tRNA synthetase (AspRS) Back     alignment and domain information
>gnl|CDD|179948 PRK05159, aspC, aspartyl-tRNA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|30367 COG0017, AsnS, Aspartyl/asparaginyl-tRNA synthetases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|129550 TIGR00458, aspS_arch, aspartyl-tRNA synthetase, archaeal type Back     alignment and domain information
>gnl|CDD|161887 TIGR00457, asnS, asparaginyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|35776 KOG0556, KOG0556, KOG0556, Aspartyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|31383 COG1190, LysU, Lysyl-tRNA synthetase (class II) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|179678 PRK03932, asnC, asparaginyl-tRNA synthetase; Validated Back     alignment and domain information
>gnl|CDD|178442 PLN02850, PLN02850, aspartate-tRNA ligase Back     alignment and domain information
>gnl|CDD|35775 KOG0555, KOG0555, KOG0555, Asparaginyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|35774 KOG0554, KOG0554, KOG0554, Asparaginyl-tRNA synthetase (mitochondrial) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|129590 TIGR00499, lysS_bact, lysyl-tRNA synthetase, eukaryotic and non-spirochete bacterial Back     alignment and domain information
>gnl|CDD|37096 KOG1885, KOG1885, KOG1885, Lysyl-tRNA synthetase (class II) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|179044 PRK00484, lysS, lysyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|178118 PLN02502, PLN02502, lysyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|178213 PLN02603, PLN02603, asparaginyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|143920 pfam00152, tRNA-synt_2, tRNA synthetases class II (D, K and N) Back     alignment and domain information
>gnl|CDD|58585 cd04100, Asp_Lys_Asn_RS_N, Asp_Lys_Asn_RS_N: N-terminal, anticodon recognition domain of class 2b aminoacyl-tRNA synthetases (aaRSs) Back     alignment and domain information
>gnl|CDD|144799 pfam01336, tRNA_anti, OB-fold nucleic acid binding domain Back     alignment and domain information
>gnl|CDD|58593 cd04323, AsnRS_cyto_like_N, AsnRS_cyto_like_N: N-terminal, anticodon recognition domain of the type found in human and Saccharomyces cerevisiae cytoplasmic asparaginyl-tRNA synthetase (AsnRS), in Brugia malayai AsnRs and, in various putative bacterial AsnRSs Back     alignment and domain information
>gnl|CDD|58588 cd04318, EcAsnRS_like_N, EcAsnRS_like_N: N-terminal, anticodon recognition domain of the type found in Escherichia coli asparaginyl-tRNA synthetase (AsnRS) and, in Arabidopsis thaliana and Saccharomyces cerevisiae mitochondrial (mt) AsnRS Back     alignment and domain information
>gnl|CDD|185588 PTZ00385, PTZ00385, lysyl-tRNA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|173592 PTZ00401, PTZ00401, aspartyl-tRNA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|179519 PRK02983, lysS, lysyl-tRNA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|29821 cd00776, AsxRS_core, Asx tRNA synthetase (AspRS/AsnRS) class II core domain Back     alignment and domain information
>gnl|CDD|129550 TIGR00458, aspS_arch, aspartyl-tRNA synthetase, archaeal type Back     alignment and domain information
>gnl|CDD|35776 KOG0556, KOG0556, KOG0556, Aspartyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|30367 COG0017, AsnS, Aspartyl/asparaginyl-tRNA synthetases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|178442 PLN02850, PLN02850, aspartate-tRNA ligase Back     alignment and domain information
>gnl|CDD|173592 PTZ00401, PTZ00401, aspartyl-tRNA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|35775 KOG0555, KOG0555, KOG0555, Asparaginyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|161887 TIGR00457, asnS, asparaginyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|180575 PRK06462, PRK06462, asparagine synthetase A; Reviewed Back     alignment and domain information
>gnl|CDD|29813 cd00768, class_II_aaRS-like_core, Class II tRNA amino-acyl synthetase-like catalytic core domain Back     alignment and domain information
>gnl|CDD|173607 PTZ00417, PTZ00417, lysine-tRNA ligase; Provisional Back     alignment and domain information
>gnl|CDD|179044 PRK00484, lysS, lysyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|31383 COG1190, LysU, Lysyl-tRNA synthetase (class II) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|29820 cd00775, LysRS_core, Lys_tRNA synthetase (LysRS) class II core domain Back     alignment and domain information
>gnl|CDD|129590 TIGR00499, lysS_bact, lysyl-tRNA synthetase, eukaryotic and non-spirochete bacterial Back     alignment and domain information
>gnl|CDD|179519 PRK02983, lysS, lysyl-tRNA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|178118 PLN02502, PLN02502, lysyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|37096 KOG1885, KOG1885, KOG1885, Lysyl-tRNA synthetase (class II) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|161889 TIGR00462, genX, lysyl-tRNA synthetase-like protein GenX Back     alignment and domain information
>gnl|CDD|181791 PRK09350, PRK09350, poxB regulator PoxA; Provisional Back     alignment and domain information
>gnl|CDD|185588 PTZ00385, PTZ00385, lysyl-tRNA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|32450 COG2269, COG2269, Truncated, possibly inactive, lysyl-tRNA synthetase (class II) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|171504 PRK12445, PRK12445, lysyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|173607 PTZ00417, PTZ00417, lysine-tRNA ligase; Provisional Back     alignment and domain information
>gnl|CDD|35774 KOG0554, KOG0554, KOG0554, Asparaginyl-tRNA synthetase (mitochondrial) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|145868 pfam02938, GAD, GAD domain Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 622 aspartyl-tRNA synthetase [Candidatus Liberibacter asiat
COG0173585 AspS Aspartyl-tRNA synthetase [Translation, ribosomal s 100.0
TIGR00459653 aspS_bact aspartyl-tRNA synthetase; InterPro: IPR004524 100.0
PRK12820706 bifunctional aspartyl-tRNA synthetase/aspartyl/glutamyl 100.0
PRK00476587 aspS aspartyl-tRNA synthetase; Validated 100.0
KOG2411628 consensus 100.0
PRK05159434 aspC aspartyl-tRNA synthetase; Provisional 100.0
PRK03932462 asnC asparaginyl-tRNA synthetase; Validated 100.0
TIGR00457495 asnS asparaginyl-tRNA synthetase; InterPro: IPR004522 T 100.0
KOG0554446 consensus 100.0
PRK029831099 lysS lysyl-tRNA synthetase; Provisional 100.0
PRK12445505 lysyl-tRNA synthetase; Reviewed 100.0
PRK00484491 lysS lysyl-tRNA synthetase; Reviewed 100.0
COG0017435 AsnS Aspartyl/asparaginyl-tRNA synthetases [Translation 100.0
TIGR00458466 aspS_arch aspartyl-tRNA synthetase; InterPro: IPR004523 100.0
KOG0556533 consensus 100.0
COG1190502 LysU Lysyl-tRNA synthetase (class II) [Translation, rib 100.0
KOG1885560 consensus 100.0
KOG0555545 consensus 100.0
TIGR00499538 lysS_bact lysyl-tRNA synthetase; InterPro: IPR002313 Th 100.0
cd00777280 AspRS_core Asp tRNA synthetase (aspRS) class II core do 100.0
pfam00152341 tRNA-synt_2 tRNA synthetases class II (D, K and N). 100.0
cd00776322 AsxRS_core Asx tRNA synthetase (AspRS/AsnRS) class II c 100.0
PRK09350325 lysyl-tRNA synthetase; Provisional 100.0
cd00775329 LysRS_core Lys_tRNA synthetase (LysRS) class II core do 100.0
PRK06462332 asparagine synthetase A; Reviewed 100.0
cd00669269 Asp_Lys_Asn_RS_core Asp_Lys_Asn_tRNA synthetase class I 100.0
COG2269322 Truncated, possibly inactive, lysyl-tRNA synthetase (cl 100.0
TIGR00462330 genX lysyl-tRNA synthetase homolog GenX; InterPro: IPR0 99.96
cd04317135 EcAspRS_like_N EcAspRS_like_N: N-terminal, anticodon re 100.0
cd04316108 ND_PkAspRS_like_N ND_PkAspRS_like_N: N-terminal, antico 99.92
cd04319103 PhAsnRS_like_N PhAsnRS_like_N: N-terminal, anticodon re 99.91
cd04322108 LysRS_N LysRS_N: N-terminal, anticodon recognition doma 99.88
cd04320102 AspRS_cyto_N AspRS_cyto_N: N-terminal, anticodon recogn 99.77
cd0432186 ScAspRS_mt_like_N ScAspRS_mt_like_N: N-terminal, antico 99.83
cd0432384 AsnRS_cyto_like_N AsnRS_cyto_like_N: N-terminal, antico 99.75
cd0410085 Asp_Lys_Asn_RS_N Asp_Lys_Asn_RS_N: N-terminal, anticodo 99.71
cd0431882 EcAsnRS_like_N EcAsnRS_like_N: N-terminal, anticodon re 99.54
pfam0133675 tRNA_anti OB-fold nucleic acid binding domain. This fam 98.56
COG1107715 Archaea-specific RecJ-like exonuclease, contains DnaJ-t 96.93
cd0448392 hOBFC1_like hOBFC1_like: A subfamily of OB folds simila 96.3
cd0448773 RecJ_OBF2_like RecJ_OBF2_like: A subfamily of OB folds 95.85
cd0448584 DnaE_OBF DnaE_OBF: A subfamily of OB folds correspondin 95.65
cd0447895 RPA2_DBD_D RPA2_DBD_D: A subfamily of OB folds correspo 95.39
cd0448291 RPA2_OBF_like RPA2_OBF_like: A subgroup of uncharacteri 94.93
COG5235258 RFA2 Single-stranded DNA-binding replication protein A 94.01
cd0449283 YhaM_OBF_like YhaM_OBF_like: A subfamily of OB folds si 93.92
pfam04076126 BOF Bacterial OB fold (BOF) protein. Proteins in this f 93.55
COG3111128 Periplasmic protein with OB-fold [Function unknown] 93.22
cd0448978 ExoVII_LU_OBF ExoVII_LU_OBF: A subfamily of OB folds co 91.97
pfam0293894 GAD GAD domain. This domain is found in some members of 99.44
COG2511631 GatE Archaeal Glu-tRNAGln amidotransferase subunit E (c 97.15
cd00496218 PheRS_alpha_core Phenylalanyl-tRNA synthetase (PheRS) a 99.2
PRK00488338 pheS phenylalanyl-tRNA synthetase subunit alpha; Valida 99.15
PTZ00326505 phenylalanyl-tRNA synthetase; Provisional 99.15
COG0016335 PheS Phenylalanyl-tRNA synthetase alpha subunit [Transl 99.1
pfam01409243 tRNA-synt_2d tRNA synthetases class II core domain (F). 99.08
cd00768211 class_II_aaRS-like_core Class II tRNA amino-acyl synthe 99.02
PRK12295373 hisZ ATP phosphoribosyltransferase regulatory subunit; 98.69
pfam00587170 tRNA-synt_2b tRNA synthetase class II core domain (G, H 98.61
PRK00037417 hisS histidyl-tRNA synthetase; Reviewed 98.19
CHL00201424 syh histidine-tRNA synthetase; Provisional 98.14
cd00670235 Gly_His_Pro_Ser_Thr_tRS_core Gly_His_Pro_Ser_Thr_tRNA s 98.08
cd00771298 ThrRS_core Threonyl-tRNA synthetase (ThrRS) class II co 98.07
PRK12325438 prolyl-tRNA synthetase; Provisional 98.06
cd00779255 ProRS_core_prok Prolyl-tRNA synthetase (ProRS) class II 98.05
COG0124429 HisS Histidyl-tRNA synthetase [Translation, ribosomal s 97.99
cd00778261 ProRS_core_arch_euk Prolyl-tRNA synthetase (ProRS) clas 97.95
PRK09537420 pylS pyrolysyl-tRNA synthetase; Reviewed 97.91
PRK12420421 histidyl-tRNA synthetase; Provisional 97.82
TIGR02367453 PylS pyrrolysyl-tRNA synthetase; InterPro: IPR012739 Py 97.74
cd00772264 ProRS_core Prolyl-tRNA synthetase (ProRS) class II core 97.7
PRK12292388 hisZ ATP phosphoribosyltransferase regulatory subunit; 97.7
cd00773261 HisRS-like_core Class II Histidinyl-tRNA synthetase (Hi 97.54
COG0442500 ProS Prolyl-tRNA synthetase [Translation, ribosomal str 97.45
PRK12305576 thrS threonyl-tRNA synthetase; Reviewed 97.27
PRK12293281 hisZ ATP phosphoribosyltransferase regulatory subunit; 97.26
cd00774254 GlyRS-like_core Glycyl-tRNA synthetase (GlyRS)-like cla 97.24
PRK12421391 ATP phosphoribosyltransferase regulatory subunit; Provi 97.22
PRK09194570 prolyl-tRNA synthetase; Provisional 96.86
KOG2324457 consensus 96.8
PRK12444639 threonyl-tRNA synthetase; Reviewed 96.74
PRK04483634 threonyl-tRNA synthetase; Validated 96.74
PRK12304604 thrS threonyl-tRNA synthetase; Reviewed 96.74
PRK00413639 thrS threonyl-tRNA synthetase; Reviewed 96.59
PRK03772642 threonyl-tRNA synthetase; Validated 96.52
KOG10351351 consensus 96.11
PRK03991613 threonyl-tRNA synthetase; Validated 96.09
TIGR00442446 hisS histidyl-tRNA synthetase; InterPro: IPR015807 The 96.02
COG3705390 HisZ ATP phosphoribosyltransferase involved in histidin 95.21
TIGR00418595 thrS threonyl-tRNA synthetase; InterPro: IPR002320 The 94.26
pfam02091284 tRNA-synt_2e Glycyl-tRNA synthetase alpha subunit. 93.92
PRK08661478 prolyl-tRNA synthetase; Provisional 93.0
PRK04172501 pheS phenylalanyl-tRNA synthetase subunit alpha; Provis 99.05
TIGR00469460 pheS_mito phenylalanyl-tRNA synthetase; InterPro: IPR00 96.81
KOG2783436 consensus 94.64
PRK07892 1180 consensus 97.79
PRK05673 1143 dnaE DNA polymerase III subunit alpha; Validated 97.37
PRK07012 1173 consensus 97.35
PRK07374 1171 dnaE DNA polymerase III subunit alpha; Validated 97.32
PRK06637 1182 consensus 97.31
PRK08744 1195 consensus 97.17
PRK06326 1240 consensus 96.94
PRK08512 1185 consensus 96.86
cd00770297 SerRS_core Seryl-tRNA synthetase (SerRS) class II core 97.77
PRK05431422 seryl-tRNA synthetase; Provisional 97.07
COG0441589 ThrS Threonyl-tRNA synthetase [Translation, ribosomal s 96.26
COG0172429 SerS Seryl-tRNA synthetase [Translation, ribosomal stru 95.84
PRK06658 1145 consensus 97.62
COG3689271 Predicted membrane protein [Function unknown] 92.69
PRK06826 1157 dnaE DNA polymerase III DnaE; Reviewed 97.56
PRK09074 1149 consensus 97.45
PRK06920 1107 dnaE DNA polymerase III DnaE; Reviewed 97.2
PRK04028631 glutamyl-tRNA(Gln) amidotransferase subunit E; Validate 96.6
PRK04036497 DNA polymerase II small subunit; Validated 96.44
cd0449079 PolII_SU_OBF PolII_SU_OBF: A subfamily of OB folds corr 96.29
COG4085204 Predicted RNA-binding protein, contains TRAM domain [Ge 94.8
PRK05425327 asparagine synthetase AsnA; Provisional 96.4
PRK06253 527 O-phosphoseryl-tRNA synthetase; Reviewed 95.49
cd00645309 AsnA Asparagine synthetase (aspartate-ammonia ligase) ( 95.3
PTZ00213350 asparagine synthetase A; Provisional 94.56
COG2502330 AsnA Asparagine synthetase A [Amino acid transport and 93.18
cd00768211 class_II_aaRS-like_core Class II tRNA amino-acyl synthe 90.09
PRK06253527 O-phosphoseryl-tRNA synthetase; Reviewed 94.45
KOG2784483 consensus 94.25
PRK09348291 glyQ glycyl-tRNA synthetase subunit alpha; Validated 94.0
cd00733279 GlyRS_alpha_core Class II Glycyl-tRNA synthetase (GlyRS 93.73
PRK00037417 hisS histidyl-tRNA synthetase; Reviewed 90.45
>COG0173 AspS Aspartyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00459 aspS_bact aspartyl-tRNA synthetase; InterPro: IPR004524 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>PRK12820 bifunctional aspartyl-tRNA synthetase/aspartyl/glutamyl-tRNA amidotransferase subunit C; Provisional Back     alignment and domain information
>PRK00476 aspS aspartyl-tRNA synthetase; Validated Back     alignment and domain information
>KOG2411 consensus Back     alignment and domain information
>PRK05159 aspC aspartyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK03932 asnC asparaginyl-tRNA synthetase; Validated Back     alignment and domain information
>TIGR00457 asnS asparaginyl-tRNA synthetase; InterPro: IPR004522 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>KOG0554 consensus Back     alignment and domain information
>PRK02983 lysS lysyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK12445 lysyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK00484 lysS lysyl-tRNA synthetase; Reviewed Back     alignment and domain information
>COG0017 AsnS Aspartyl/asparaginyl-tRNA synthetases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00458 aspS_arch aspartyl-tRNA synthetase; InterPro: IPR004523 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>KOG0556 consensus Back     alignment and domain information
>COG1190 LysU Lysyl-tRNA synthetase (class II) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1885 consensus Back     alignment and domain information
>KOG0555 consensus Back     alignment and domain information
>TIGR00499 lysS_bact lysyl-tRNA synthetase; InterPro: IPR002313 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>cd00777 AspRS_core Asp tRNA synthetase (aspRS) class II core domain Back     alignment and domain information
>pfam00152 tRNA-synt_2 tRNA synthetases class II (D, K and N) Back     alignment and domain information
>cd00776 AsxRS_core Asx tRNA synthetase (AspRS/AsnRS) class II core domain Back     alignment and domain information
>PRK09350 lysyl-tRNA synthetase; Provisional Back     alignment and domain information
>cd00775 LysRS_core Lys_tRNA synthetase (LysRS) class II core domain Back     alignment and domain information
>PRK06462 asparagine synthetase A; Reviewed Back     alignment and domain information
>cd00669 Asp_Lys_Asn_RS_core Asp_Lys_Asn_tRNA synthetase class II core domain Back     alignment and domain information
>COG2269 Truncated, possibly inactive, lysyl-tRNA synthetase (class II) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00462 genX lysyl-tRNA synthetase homolog GenX; InterPro: IPR004525 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>cd04317 EcAspRS_like_N EcAspRS_like_N: N-terminal, anticodon recognition domain of the type found in Escherichia coli aspartyl-tRNA synthetase (AspRS), the human mitochondrial (mt) AspRS-2, the discriminating (D) Thermus thermophilus AspRS-1, and the nondiscriminating (ND) Helicobacter pylori AspRS Back     alignment and domain information
>cd04316 ND_PkAspRS_like_N ND_PkAspRS_like_N: N-terminal, anticodon recognition domain of the type found in the homodimeric non-discriminating (ND) Pyrococcus kodakaraensis aspartyl-tRNA synthetase (AspRS) Back     alignment and domain information
>cd04319 PhAsnRS_like_N PhAsnRS_like_N: N-terminal, anticodon recognition domain of the type found in Pyrococcus horikoshii AsnRS asparaginyl-tRNA synthetase (AsnRS) Back     alignment and domain information
>cd04322 LysRS_N LysRS_N: N-terminal, anticodon recognition domain of lysyl-tRNA synthetases (LysRS) Back     alignment and domain information
>cd04320 AspRS_cyto_N AspRS_cyto_N: N-terminal, anticodon recognition domain of the type found in Saccharomyces cerevisiae and human cytoplasmic aspartyl-tRNA synthetase (AspRS) Back     alignment and domain information
>cd04321 ScAspRS_mt_like_N ScAspRS_mt_like_N: N-terminal, anticodon recognition domain of the type found in Saccharomyces cerevisiae mitochondrial (mt) aspartyl-tRNA synthetase (AspRS) Back     alignment and domain information
>cd04323 AsnRS_cyto_like_N AsnRS_cyto_like_N: N-terminal, anticodon recognition domain of the type found in human and Saccharomyces cerevisiae cytoplasmic asparaginyl-tRNA synthetase (AsnRS), in Brugia malayai AsnRs and, in various putative bacterial AsnRSs Back     alignment and domain information
>cd04100 Asp_Lys_Asn_RS_N Asp_Lys_Asn_RS_N: N-terminal, anticodon recognition domain of class 2b aminoacyl-tRNA synthetases (aaRSs) Back     alignment and domain information
>cd04318 EcAsnRS_like_N EcAsnRS_like_N: N-terminal, anticodon recognition domain of the type found in Escherichia coli asparaginyl-tRNA synthetase (AsnRS) and, in Arabidopsis thaliana and Saccharomyces cerevisiae mitochondrial (mt) AsnRS Back     alignment and domain information
>pfam01336 tRNA_anti OB-fold nucleic acid binding domain Back     alignment and domain information
>COG1107 Archaea-specific RecJ-like exonuclease, contains DnaJ-type Zn finger domain [DNA replication, recombination, and repair] Back     alignment and domain information
>cd04483 hOBFC1_like hOBFC1_like: A subfamily of OB folds similar to that found in human OB fold containing protein 1 (hOBFC1) Back     alignment and domain information
>cd04487 RecJ_OBF2_like RecJ_OBF2_like: A subfamily of OB folds corresponding to the second OB fold (OBF2) of archaeal-specific proteins with similarity to eubacterial RecJ Back     alignment and domain information
>cd04485 DnaE_OBF DnaE_OBF: A subfamily of OB folds corresponding to the C-terminal OB-fold nucleic acid binding domain of Thermus aquaticus and Escherichia coli type C replicative DNA polymerase III alpha subunit (DnaE) Back     alignment and domain information
>cd04478 RPA2_DBD_D RPA2_DBD_D: A subfamily of OB folds corresponding to the OB fold of the central ssDNA-binding domain (DBD)-D of human RPA2 (also called RPA32) Back     alignment and domain information
>cd04482 RPA2_OBF_like RPA2_OBF_like: A subgroup of uncharacterized archaeal OB folds with similarity to the OB fold of the central ssDNA-binding domain (DBD)-D of human RPA2 (also called RPA32) Back     alignment and domain information
>COG5235 RFA2 Single-stranded DNA-binding replication protein A (RPA), medium (30 kD) subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>cd04492 YhaM_OBF_like YhaM_OBF_like: A subfamily of OB folds similar to that found in Bacillus subtilis YhaM and Staphylococcus aureus cmp-binding factor-1 (SaCBF1) Back     alignment and domain information
>pfam04076 BOF Bacterial OB fold (BOF) protein Back     alignment and domain information
>COG3111 Periplasmic protein with OB-fold [Function unknown] Back     alignment and domain information
>cd04489 ExoVII_LU_OBF ExoVII_LU_OBF: A subfamily of OB folds corresponding to the N-terminal OB-fold domain of Escherichia coli exodeoxyribonuclease VII (ExoVII) large subunit Back     alignment and domain information
>pfam02938 GAD GAD domain Back     alignment and domain information
>COG2511 GatE Archaeal Glu-tRNAGln amidotransferase subunit E (contains GAD domain) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd00496 PheRS_alpha_core Phenylalanyl-tRNA synthetase (PheRS) alpha chain catalytic core domain Back     alignment and domain information
>PRK00488 pheS phenylalanyl-tRNA synthetase subunit alpha; Validated Back     alignment and domain information
>PTZ00326 phenylalanyl-tRNA synthetase; Provisional Back     alignment and domain information
>COG0016 PheS Phenylalanyl-tRNA synthetase alpha subunit [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>pfam01409 tRNA-synt_2d tRNA synthetases class II core domain (F) Back     alignment and domain information
>cd00768 class_II_aaRS-like_core Class II tRNA amino-acyl synthetase-like catalytic core domain Back     alignment and domain information
>PRK12295 hisZ ATP phosphoribosyltransferase regulatory subunit; Provisional Back     alignment and domain information
>pfam00587 tRNA-synt_2b tRNA synthetase class II core domain (G, H, P, S and T) Back     alignment and domain information
>PRK00037 hisS histidyl-tRNA synthetase; Reviewed Back     alignment and domain information
>CHL00201 syh histidine-tRNA synthetase; Provisional Back     alignment and domain information
>cd00670 Gly_His_Pro_Ser_Thr_tRS_core Gly_His_Pro_Ser_Thr_tRNA synthetase class II core domain Back     alignment and domain information
>cd00771 ThrRS_core Threonyl-tRNA synthetase (ThrRS) class II core catalytic domain Back     alignment and domain information
>PRK12325 prolyl-tRNA synthetase; Provisional Back     alignment and domain information
>cd00779 ProRS_core_prok Prolyl-tRNA synthetase (ProRS) class II core catalytic domain Back     alignment and domain information
>COG0124 HisS Histidyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd00778 ProRS_core_arch_euk Prolyl-tRNA synthetase (ProRS) class II core catalytic domain Back     alignment and domain information
>PRK09537 pylS pyrolysyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK12420 histidyl-tRNA synthetase; Provisional Back     alignment and domain information
>TIGR02367 PylS pyrrolysyl-tRNA synthetase; InterPro: IPR012739 PylS is the archaeal enzyme responsible for charging the pyrrolysine tRNA, PylT, by ligating a free molecule of pyrrolysine Back     alignment and domain information
>cd00772 ProRS_core Prolyl-tRNA synthetase (ProRS) class II core catalytic domain Back     alignment and domain information
>PRK12292 hisZ ATP phosphoribosyltransferase regulatory subunit; Provisional Back     alignment and domain information
>cd00773 HisRS-like_core Class II Histidinyl-tRNA synthetase (HisRS)-like catalytic core domain Back     alignment and domain information
>COG0442 ProS Prolyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK12305 thrS threonyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK12293 hisZ ATP phosphoribosyltransferase regulatory subunit; Provisional Back     alignment and domain information
>cd00774 GlyRS-like_core Glycyl-tRNA synthetase (GlyRS)-like class II core catalytic domain Back     alignment and domain information
>PRK12421 ATP phosphoribosyltransferase regulatory subunit; Provisional Back     alignment and domain information
>PRK09194 prolyl-tRNA synthetase; Provisional Back     alignment and domain information
>KOG2324 consensus Back     alignment and domain information
>PRK12444 threonyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK04483 threonyl-tRNA synthetase; Validated Back     alignment and domain information
>PRK12304 thrS threonyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK00413 thrS threonyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK03772 threonyl-tRNA synthetase; Validated Back     alignment and domain information
>KOG1035 consensus Back     alignment and domain information
>PRK03991 threonyl-tRNA synthetase; Validated Back     alignment and domain information
>TIGR00442 hisS histidyl-tRNA synthetase; InterPro: IPR015807 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>COG3705 HisZ ATP phosphoribosyltransferase involved in histidine biosynthesis [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00418 thrS threonyl-tRNA synthetase; InterPro: IPR002320 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>pfam02091 tRNA-synt_2e Glycyl-tRNA synthetase alpha subunit Back     alignment and domain information
>PRK08661 prolyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK04172 pheS phenylalanyl-tRNA synthetase subunit alpha; Provisional Back     alignment and domain information
>TIGR00469 pheS_mito phenylalanyl-tRNA synthetase; InterPro: IPR004530 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>KOG2783 consensus Back     alignment and domain information
>PRK07892 consensus Back     alignment and domain information
>PRK05673 dnaE DNA polymerase III subunit alpha; Validated Back     alignment and domain information
>PRK07012 consensus Back     alignment and domain information
>PRK07374 dnaE DNA polymerase III subunit alpha; Validated Back     alignment and domain information
>PRK06637 consensus Back     alignment and domain information
>PRK08744 consensus Back     alignment and domain information
>PRK06326 consensus Back     alignment and domain information
>PRK08512 consensus Back     alignment and domain information
>cd00770 SerRS_core Seryl-tRNA synthetase (SerRS) class II core catalytic domain Back     alignment and domain information
>PRK05431 seryl-tRNA synthetase; Provisional Back     alignment and domain information
>COG0441 ThrS Threonyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0172 SerS Seryl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK06658 consensus Back     alignment and domain information
>COG3689 Predicted membrane protein [Function unknown] Back     alignment and domain information
>PRK06826 dnaE DNA polymerase III DnaE; Reviewed Back     alignment and domain information
>PRK09074 consensus Back     alignment and domain information
>PRK06920 dnaE DNA polymerase III DnaE; Reviewed Back     alignment and domain information
>PRK04028 glutamyl-tRNA(Gln) amidotransferase subunit E; Validated Back     alignment and domain information
>PRK04036 DNA polymerase II small subunit; Validated Back     alignment and domain information
>cd04490 PolII_SU_OBF PolII_SU_OBF: A subfamily of OB folds corresponding to the OB fold found in Pyrococcus abyssi DNA polymerase II (PolII) small subunit Back     alignment and domain information
>COG4085 Predicted RNA-binding protein, contains TRAM domain [General function prediction only] Back     alignment and domain information