254780423

254780423

S-adenosylmethionine synthetase

GeneID in NCBI database:8209409Locus tag:CLIBASIA_01540
Protein GI in NCBI database:254780423Protein Accession:YP_003064836.1
Gene range:-(329734, 330975)Protein Length:413aa
Gene description:S-adenosylmethionine synthetase
COG prediction:[H] S-adenosylmethionine synthetase
KEGG prediction:metK; S-adenosylmethionine synthetase (EC:2.5.1.6); K00789 S-adenosylmethionine synthetase [EC:2.5.1.6]
SEED prediction:S-adenosylmethionine synthetase (EC 2.5.1.6)
Pathway involved in KEGG:Cysteine and methionine metabolism [PATH:las00270]
Selenoamino acid metabolism [PATH:las00450]
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410---
MSADFLFTSESVSEGHPDKICDRISDEIVDLVYREAIESKMDVNSVRVACEVLVTKNKVIVAGEVRLPHGLSKKDSITGQYVVDKEKFEKVVRSVIRSIGYEQEGFHWETVDVEVLLHSQSSDIAYGVDNASDDCSTLGAGDQGIMFGYACRETADFMPAPIYYAHRILRTLADARKNSGGDVSKLGPDAKSQVTIRYVDNKVCEVKSIVLSIQHFDPTWDRGKVRSVVEPYILKALEDIKISPDCSWYINPAGKFVIGGPCSDAGLTGRKIIVDTYGGASPHGGGAFSGKDITKVDRAAAYAARYLAKNIVAAGLADRCTIQLSYAIGISRPLSIFVDLHDSGKVSESCVANAINKVMDLSVSGIRDHLNLSRPIYAQTSAYGHFGRSANQDGFFPWEALDLIEPLKKAIGF
cccccEEEccccccccHHHHHHHHHHHHHHHHHHHcccccccccccEEEEEEEEcccEEEEEEEEEcccccccccccccccccccccHHHHHHHHHHHcccccccccccccEEEEEccccccHHHHHccccccccccccccccEEEEEEEccccccccHHHHHHHHHHHHHHHHHHHccccccccccccccEEEEEEEEccEEEEEEEEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHcccccEEEEccccccEEccccccccccccEEEEEcccccccccccccccccccHHHHHHHHHHHHHHHHHHHcccccEEEEEEEEEcccccccEEEEEEcccccccHHHHHHHHHHHccccHHHHHHHccccccccccccccccccccccccccccHHHHHHHHHHHHHccc
ccccccccccccccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHccEcHEEEEcccEEEEEccEEEEccccccccEEEEEEEcHHHHHHHHHHHHHHcccccccccHHHHHHHHHccccccHHHcccccccccHHHHcccccccEEEcccccccccccHHHHHHHHHHHHHHHHHHccccccccccccccEEEEEEEEcccEEEEEEEEEEEcccccccHHHHHHHHHHHHccccccHHHHcccccEEEcccccEEEEcccccccccccEEEEEccccccccccccccccccccccHHHHHHHHHHHHHHHHHccHHHcEEEEEHHccccccEEEEEEccccccccHHHHHHHHHHHccccHHHHHHHHHHccHHHHHHHHHcccccccccccccccccccHHHHHHHHccc
msadflftsesvseghpdkicDRISDEIVDLVYREAIESKMDVNSVRVACEVLVTKNKVIVagevrlphglskkdsitgqyvvdKEKFEKVVRSVIRSIGyeqegfhweTVDVEVLLHSqssdiaygvdnasddcstlgagdqgIMFGYAcretadfmpapiYYAHRILRTLADArknsggdvsklgpdaksqvtiRYVDNKVCEVKSIVLSIqhfdptwdrgkvrsvVEPYILKALEdikispdcswyinpagkfviggpcsdagltgRKIIVdtyggasphgggafsgkditKVDRAAAYAARYLAKNIVAAGLADRCTIQLSYAigisrplsifvdlhdsgkvsESCVANAINKVMDLSvsgirdhlnlsrpiyaqtsayghfgrsanqdgffpwealdlIEPLKKAIGF
msadflftsesvseghpdkicdRISDEIVDLVYREAIeskmdvnsVRVACEVLVtknkvivagevrlphglskkdsitgqyvvdkekfEKVVRSVIRSIGYEQEGFHWETVDVEVLLHSQSSDIAYGVDNASDDCSTLGAGDQGIMFGYACRETADFMPAPIYYAHRILRTLADARKNSggdvsklgpdaksqvtiryVDNKVCEVKSIVLsiqhfdptwdrgkvrSVVEPYILKALEDIKISPDCSWYINPAGKFVIGGPCSDAGLTGRKIIVDTYGGasphgggafsgkdiTKVDRAAAYAARYLAKNIVAAGLADRCTIQLSYAIGISRPLSIFVDLHDSGKVSESCVANAINKVMDLSVSGIRDHLNLSRPIYAQTSAYGHFGRSANQDGFFPWEALDLIEPLKKAIGF
MSADFLFTSESVSEGHPDKICDRISDEIVDLVYREAIESKMDVNSVRVACEVLVTKNKVIVAGEVRLPHGLSKKDSITGQYVVDKEKFEKVVRSVIRSIGYEQEGFHWETVDVEVLLHSQSSDIAYGVDNASDDCSTLGAGDQGIMFGYACRETADFMPAPIYYAHRILRTLADARKNSGGDVSKLGPDAKSQVTIRYVDNKVCEVKSIVLSIQHFDPTWDRGKVRSVVEPYILKALEDIKISPDCSWYINPAGKFVIGGPCSDAGLTGRKIIVDTYGGASPHGGGAFSGKDITKVDraaayaarylaKNIVAAGLADRCTIQLSYAIGISRPLSIFVDLHDSGKVSESCVANAINKVMDLSVSGIRDHLNLSRPIYAQTSAYGHFGRSANQDGFFPWEALDLIEPLKKAIGF
**ADFLFTSESVSEGHPDKICDRISDEIVDLVYREAIESKMDVNSVRVACEVLVTKNKVIVAGEVRLPHGLSKKDSITGQYVVDKEKFEKVVRSVIRSIGYEQEGFHWETVDVEVLLHSQSSDIAYGVDNASDDCSTLGAGDQGIMFGYACRETADFMPAPIYYAHRILRTLADARKNSGGDVSKLGPDAKSQVTIRYVDNKVCEVKSIVLSIQHFDPTWDRGKVRSVVEPYILKALEDIKISPDCSWYINPAGKFVIGGPCSDAGLTGRKIIVDTYGGASPHGGGAFSGKDITKVDRAAAYAARYLAKNIVAAGLADRCTIQLSYAIGISRPLSIFVDLHDSGKVSESCVANAINKVMDLSVSGIRDHLNLSRPIYAQTSAYGHFGRSANQDGFFPWEALDLIEPLKKAIGF
**************GHPDKICDRISDEIVDLVYREAIESKMDVNSVRVACEVLVTKNKVIVAGEVRLPHGLSKKDSITGQYVVDKEKFEKVVRSVIRSIGYEQEGFHWETVDVEVLLHSQSSDIAYGVDNASDDCSTLGAGDQGIMFGYACRETADFMPAPIYYAHRILRTLADARKNSGGDVSKLGPDAKSQVTIRYVDNKVCEVKSIVLSIQHFDPTWDRGKVRSVVEPYILKALEDIKISPDCSWYINPAGKFVIGGPCSDAGLTGRKIIVDTYGGASPHGGGAFSGKDITKVDRAAAYAARYLAKNIVAAGLADRCTIQLSYAIGISRPLSIFVDLHDSGKVSESCVANAINKVMDLSVSGIRDHLNLSRPIYAQTSAYGHFGRSANQDGFFPWEALDLIEPLKKAIGF
***********VSEGHPDKICDRISDEIVDLVYREAIESKMDVNSVRVACEVLVTKNKVIVAGEVRLPHGLSKKDSITGQYVVDKEKFEKVVRSVIRSIGYEQEGFHWETVDVEVLLHSQSSDIAYGVDNASDDCSTLGAGDQGIMFGYACRETADFMPAPIYYAHRILRTLADARKNSGGDVSKLGPDAKSQVTIRYVDNKVCEVKSIVLSIQHFDPTWDRGKVRSVVEPYILKALEDIKISPDCSWYINPAGKFVIGGPCSDAGLTGRKIIVDTYGGASPHGGGAFSGKDITKVDRAAAYAARYLAKNIVAAGLADRCTIQLSYAIGISRPLSIFVDLHDSGKVSESCVANAINKVMDLSVSGIRDHLNLSRPIYAQTSAYGHFGRSANQDGFFPWEALDLIEPLKKAIGF
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSADFLFTSESVSEGHPDKICDRISDEIVDLVYREAIESKMDVNSVRVACEVLVTKNKVIVAGEVRLPHGLSKKDSITGQYVVDKEKFEKVVRSVIRSIGYEQEGFHWETVDVEVLLHSQSSDIAYGVDNASDDCSTLGAGDQGIMFGYACRETADFMPAPIYYAHRILRTLADARKNSGGDVSKLGPDAKSQVTIRYVDNKVCEVKSIVLSIQHFDPTWDRGKVRSVVEPYILKALEDIKISPDCSWYINPAGKFVIGGPCSDAGLTGRKIIVDTYGGASPHGGGAFSGKDITKVDRAAAYAARYLAKNIVAAGLADRCTIQLSYAIGISRPLSIFVDLHDSGKVSESCVANAINKVMDLSVSGIRDHLNLSRPIYAQTSAYGHFGRSANQDGFFPWEALDLIEPLKKAIGF
MSADFLFTSESVSEGHPDKICDRISDEIVDLVYREAIESKMDVNSVRVACEVLVTKNKVIVAGEVRLPHGLSKKDSITGQYVVDKEKFEKVVRSVIRSIGYEQEGFHWETVDVEVLLHSQSSDIAYGVDNASDDCSTLGAGDQGIMFGYACRETADFMPAPIYYAHRILRTLADARKNSGGDVSKLGPDAKSQVTIRYVDNKVCEVKSIVLSIQHFDPTWDRGKVRSVVEPYILKALEDIKISPDCSWYINPAGKFVIGGPCSDAGLTGRKIIVDTYGGASPHGGGAFSGKDITKVDRAAAYAARYLAKNIVAAGLADRCTIQLSYAIGISRPLSIFVDLHDSGKVSESCVANAINKVMDLSVSGIRDHLNLSRPIYAQTSAYGHFGRSANQDGFFPWEALDLIEPLKKAIGF
MSADFLFTSESVSEGHPDKICDRISDEIVDLVYREAIESKMDVNSVRVACEVLVTKNKVIVAGEVRLPHGLSKKDSITGQYVVDKEKFEKVVRSVIRSIGYEQEGFHWETVDVEVLLHSQSSDIAYGVDNASDDCSTLGAGDQGIMFGYACRETADFMPAPIYYAHRILRTLADARKNSGGDVSKLGPDAKSQVTIRYVDNKVCEVKSIVLSIQHFDPTWDRGKVRSVVEPYILKALEDIKISPDCSWYINPAGKFVIGGPCSDAGLTGRKIIVDTYGGASPHGGGAFSGKDITKVDRAAAYAARYLAKNIVAAGLADRCTIQLSYAIGISRPLSIFVDLHDSGKVSESCVANAINKVMDLSVSGIRDHLNLSRPIYAQTSAYGHFGRSANQDGFFPWEALDLIEPLKKAIGF

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target413 S-adenosylmethionine synthetase [Candidatus Liberibacte
315122131412 S-adenosylmethionine synthetase [Candidatus Liberibacte 1 0.0
150395274426 S-adenosylmethionine synthetase [Sinorhizobium medicae 1 1e-166
15964164426 S-adenosylmethionine synthetase [Sinorhizobium meliloti 1 1e-165
325291796420 S-adenosylmethionine synthetase [Agrobacterium sp. H13- 1 1e-162
227820635422 S-adenosylmethionine synthetase [Sinorhizobium fredii N 1 1e-161
15887713420 S-adenosylmethionine synthetase [Agrobacterium tumefaci 1 1e-159
209547625412 S-adenosylmethionine synthetase [Rhizobium leguminosaru 1 1e-159
116250158412 S-adenosylmethionine synthetase [Rhizobium leguminosaru 1 1e-158
86356027417 S-adenosylmethionine synthetase [Rhizobium etli CFN 42] 1 1e-158
163757745413 S-adenosylmethionine synthetase [Hoeflea phototrophica 1 1e-157
>gi|315122131|ref|YP_004062620.1| S-adenosylmethionine synthetase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 412 Back     alignment and organism information
 Score =  713 bits (1840), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/411 (86%), Positives = 379/411 (92%)

Query: 3   ADFLFTSESVSEGHPDKICDRISDEIVDLVYREAIESKMDVNSVRVACEVLVTKNKVIVA 62
           AD LFTSESVSEGHPDKICDRISDEIVDLVYREAI SKMD NSVRVACEVLVTKNKVIVA
Sbjct: 2   ADLLFTSESVSEGHPDKICDRISDEIVDLVYREAIASKMDANSVRVACEVLVTKNKVIVA 61

Query: 63  GEVRLPHGLSKKDSITGQYVVDKEKFEKVVRSVIRSIGYEQEGFHWETVDVEVLLHSQSS 122
           GEVRLP  L K D IT QYVVDKEKFEK VRSVIRSIGYEQEGFHWETVD+E+LLHSQS 
Sbjct: 62  GEVRLPISLLKTDPITSQYVVDKEKFEKFVRSVIRSIGYEQEGFHWETVDIEILLHSQSI 121

Query: 123 DIAYGVDNASDDCSTLGAGDQGIMFGYACRETADFMPAPIYYAHRILRTLADARKNSGGD 182
           DIA GVDNASDDC+  GAGDQGIMFGYACRETADFMPAPIYYAHRILR LADARK+  GD
Sbjct: 122 DIARGVDNASDDCNNPGAGDQGIMFGYACRETADFMPAPIYYAHRILRFLADARKSGKGD 181

Query: 183 VSKLGPDAKSQVTIRYVDNKVCEVKSIVLSIQHFDPTWDRGKVRSVVEPYILKALEDIKI 242
           VSKLGPDAKSQ+TIRYVDNKV EVKSIVLS QHFDPTWDR KV SVVEPYI  ALE IKI
Sbjct: 182 VSKLGPDAKSQITIRYVDNKVFEVKSIVLSTQHFDPTWDREKVHSVVEPYIRMALEGIKI 241

Query: 243 SPDCSWYINPAGKFVIGGPCSDAGLTGRKIIVDTYGGASPHGGGAFSGKDITKVDRAAAY 302
           S DC WYINPAGKFVIGGP  DAGLTGRKI+VDTYGGA+PHGGGAFSGKD+TKVDRAA Y
Sbjct: 242 SSDCRWYINPAGKFVIGGPFGDAGLTGRKIVVDTYGGAAPHGGGAFSGKDVTKVDRAATY 301

Query: 303 AARYLAKNIVAAGLADRCTIQLSYAIGISRPLSIFVDLHDSGKVSESCVANAINKVMDLS 362
           AARYLAKNIVAA LADRCTIQLSYAIG+SRPLSIFVDLH+SGKVSE+C+A+AINKVMDLS
Sbjct: 302 AARYLAKNIVAADLADRCTIQLSYAIGVSRPLSIFVDLHNSGKVSETCIASAINKVMDLS 361

Query: 363 VSGIRDHLNLSRPIYAQTSAYGHFGRSANQDGFFPWEALDLIEPLKKAIGF 413
           VSGIR+HLNLSRPIYA+TSAYGHFGRSA+QDGFFPWE+L+L++ L+K +GF
Sbjct: 362 VSGIRNHLNLSRPIYAKTSAYGHFGRSADQDGFFPWESLNLVDSLRKCVGF 412


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|150395274|ref|YP_001325741.1| S-adenosylmethionine synthetase [Sinorhizobium medicae WSM419] Length = 426 Back     alignment and organism information
>gi|15964164|ref|NP_384517.1| S-adenosylmethionine synthetase [Sinorhizobium meliloti 1021] Length = 426 Back     alignment and organism information
>gi|325291796|ref|YP_004277660.1| S-adenosylmethionine synthetase [Agrobacterium sp. H13-3] Length = 420 Back     alignment and organism information
>gi|227820635|ref|YP_002824605.1| S-adenosylmethionine synthetase [Sinorhizobium fredii NGR234] Length = 422 Back     alignment and organism information
>gi|15887713|ref|NP_353394.1| S-adenosylmethionine synthetase [Agrobacterium tumefaciens str. C58] Length = 420 Back     alignment and organism information
>gi|209547625|ref|YP_002279542.1| S-adenosylmethionine synthetase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 412 Back     alignment and organism information
>gi|116250158|ref|YP_765996.1| S-adenosylmethionine synthetase [Rhizobium leguminosarum bv. viciae 3841] Length = 412 Back     alignment and organism information
>gi|86356027|ref|YP_467919.1| S-adenosylmethionine synthetase [Rhizobium etli CFN 42] Length = 417 Back     alignment and organism information
>gi|163757745|ref|ZP_02164834.1| S-adenosylmethionine synthetase [Hoeflea phototrophica DFL-43] Length = 413 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target413 S-adenosylmethionine synthetase [Candidatus Liberibacte
PRK05250384 PRK05250, PRK05250, S-adenosylmethionine synthetase; Va 1e-179
PRK12459386 PRK12459, PRK12459, S-adenosylmethionine synthetase; Pr 1e-141
TIGR01034377 TIGR01034, metK, S-adenosylmethionine synthetase 1e-126
PTZ00104398 PTZ00104, PTZ00104, S-adenosylmethionine synthase; Prov 1e-114
KOG1506383 KOG1506, KOG1506, KOG1506, S-adenosylmethionine synthet 4e-98
PLN02243386 PLN02243, PLN02243, S-adenosylmethionine synthase 8e-94
COG0192388 COG0192, MetK, S-adenosylmethionine synthetase [Coenzym 1e-150
pfam02773138 pfam02773, S-AdoMet_synt_C, S-adenosylmethionine synthe 9e-55
pfam02772119 pfam02772, S-AdoMet_synt_M, S-adenosylmethionine synthe 6e-45
pfam0043898 pfam00438, S-AdoMet_synt_N, S-adenosylmethionine synthe 5e-34
>gnl|CDD|179974 PRK05250, PRK05250, S-adenosylmethionine synthetase; Validated Back     alignment and domain information
>gnl|CDD|183537 PRK12459, PRK12459, S-adenosylmethionine synthetase; Provisional Back     alignment and domain information
>gnl|CDD|162167 TIGR01034, metK, S-adenosylmethionine synthetase Back     alignment and domain information
>gnl|CDD|185448 PTZ00104, PTZ00104, S-adenosylmethionine synthase; Provisional Back     alignment and domain information
>gnl|CDD|36719 KOG1506, KOG1506, KOG1506, S-adenosylmethionine synthetase [Coenzyme transport and metabolism] Back     alignment and domain information
>gnl|CDD|177886 PLN02243, PLN02243, S-adenosylmethionine synthase Back     alignment and domain information
>gnl|CDD|30541 COG0192, MetK, S-adenosylmethionine synthetase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|111646 pfam02773, S-AdoMet_synt_C, S-adenosylmethionine synthetase, C-terminal domain Back     alignment and domain information
>gnl|CDD|145757 pfam02772, S-AdoMet_synt_M, S-adenosylmethionine synthetase, central domain Back     alignment and domain information
>gnl|CDD|144142 pfam00438, S-AdoMet_synt_N, S-adenosylmethionine synthetase, N-terminal domain Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 413 S-adenosylmethionine synthetase [Candidatus Liberibacte
TIGR01034393 metK S-adenosylmethionine synthetase; InterPro: IPR0021 100.0
PRK12459383 S-adenosylmethionine synthetase; Provisional 100.0
PRK05250386 S-adenosylmethionine synthetase; Validated 100.0
PTZ00104391 S-adenosylmethionine synthetase; Provisional 100.0
COG0192388 MetK S-adenosylmethionine synthetase [Coenzyme metaboli 100.0
KOG1506383 consensus 100.0
pfam02773138 S-AdoMet_synt_C S-adenosylmethionine synthetase, C-term 100.0
pfam02772119 S-AdoMet_synt_M S-adenosylmethionine synthetase, centra 100.0
pfam0043898 S-AdoMet_synt_N S-adenosylmethionine synthetase, N-term 100.0
pfam01941396 AdoMet_Synthase S-adenosylmethionine synthetase (AdoMet 98.99
PRK04439400 S-adenosylmethionine synthetase; Provisional 98.96
COG1812400 MetK Archaeal S-adenosylmethionine synthetase [Amino ac 98.41
>TIGR01034 metK S-adenosylmethionine synthetase; InterPro: IPR002133 S-adenosylmethionine synthetase (MAT, 2 Back     alignment and domain information
>PRK12459 S-adenosylmethionine synthetase; Provisional Back     alignment and domain information
>PRK05250 S-adenosylmethionine synthetase; Validated Back     alignment and domain information
>PTZ00104 S-adenosylmethionine synthetase; Provisional Back     alignment and domain information
>COG0192 MetK S-adenosylmethionine synthetase [Coenzyme metabolism] Back     alignment and domain information
>KOG1506 consensus Back     alignment and domain information
>pfam02773 S-AdoMet_synt_C S-adenosylmethionine synthetase, C-terminal domain Back     alignment and domain information
>pfam02772 S-AdoMet_synt_M S-adenosylmethionine synthetase, central domain Back     alignment and domain information
>pfam00438 S-AdoMet_synt_N S-adenosylmethionine synthetase, N-terminal domain Back     alignment and domain information
>pfam01941 AdoMet_Synthase S-adenosylmethionine synthetase (AdoMet synthetase) Back     alignment and domain information
>PRK04439 S-adenosylmethionine synthetase; Provisional Back     alignment and domain information
>COG1812 MetK Archaeal S-adenosylmethionine synthetase [Amino acid transport and metabolism] Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target413 S-adenosylmethionine synthetase [Candidatus Liberibacte
1fug_A383 S-Adenosylmethionine Synthetase Length = 383 1e-141
3iml_A399 Crystal Structure Of S-Adenosylmethionine Synthetas 1e-136
1xrb_A383 S-Adenosylmethionine Synthetase (Mat, Atp: L-Methio 1e-132
2p02_A396 Crystal Structure Of The Alpha Subunit Of Human S- 1e-124
1qm4_A396 Methionine Adenosyltransferase Complexed With A L- 1e-122
2obv_A384 Crystal Structure Of The Human S-Adenosylmethionine 1e-121
1o9t_A374 Methionine Adenosyltransferase Complexed With Both 1e-119
>gi|1827907|pdb|1FUG|A Chain A, S-Adenosylmethionine Synthetase Length = 383 Back     alignment and structure
 Score =  507 bits (1305), Expect = e-141,   Method: Composition-based stats.
 Identities = 193/413 (46%), Positives = 247/413 (59%), Gaps = 33/413 (7%)

Query: 3   ADFLFTSESVSEGHPDKICDRISDEIVDLVYREAIESKMDVNSVRVACEVLVTKNKVIVA 62
           A  LFTSESVSEGHPDKI D+ISD ++D +  +  ++       RVACE  V    V+V 
Sbjct: 1   AKHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKA-------RVACETYVKTGMVLVG 53

Query: 63  GEVRLPHGLSKKDSITGQYVVDKEKFEKVVRSVIRSIGY--EQEGFHWETVDVEVLLHSQ 120
           GE+     +                 E++ R+ +R IGY     GF   +  V   +  Q
Sbjct: 54  GEITTSAWV---------------DIEEITRNTVREIGYVHSDMGFDANSCAVLSAIGKQ 98

Query: 121 SSDIAYGVDNASDDCSTLGAGDQGIMFGYACRETADFMPAPIYYAHRILRTLADARKNSG 180
           S DI  GVD A  D    GAGDQG+MFGYA  ET   MPAPI YAHR+++  A+ RKN  
Sbjct: 99  SPDINQGVDRA--DPLEQGAGDQGLMFGYATNETDVLMPAPITYAHRLVQRQAEVRKN-- 154

Query: 181 GDVSKLGPDAKSQVTIRYVDNKVCEVKSIVLSIQHFDPTWDRGKVRSVVEPYILKALEDI 240
           G +  L PDAKSQVT +Y D K+  + ++VLS QH +    +    +V+E  I   L   
Sbjct: 155 GTLPWLRPDAKSQVTFQYDDGKIVGIDAVVLSTQHSEEIDQKSLQEAVMEEIIKPILPAE 214

Query: 241 KISPDCSWYINPAGKFVIGGPCSDAGLTGRKIIVDTYGGASPHGGGAFSGKDITKVDRAA 300
            ++    ++INP G+FVIGGP  D GLTGRKIIVDTYGG + HGGGAFSGKD +KVDR+A
Sbjct: 215 WLTSATKFFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSA 274

Query: 301 AYAARYLAKNIVAAGLADRCTIQLSYAIGISRPLSIFVDLHDSGKVSESCVANAINKVMD 360
           AYAARY+AKNIVAAGLADRC IQ+SYAIG++ P SI V+   + KV    +   + +  D
Sbjct: 275 AYAARYVAKNIVAAGLADRCEIQVSYAIGVAEPTSIMVETFGTEKVPSEQLTLLVREFFD 334

Query: 361 LSVSGIRDHLNLSRPIYAQTSAYGHFGRSANQDGFFPWEALDLIEPLKKAIGF 413
           L   G+   L+L  PIY +T+AYGHFGR       FPWE  D  + L+ A G 
Sbjct: 335 LRPYGLIQMLDLLHPIYKETAAYGHFGRE-----HFPWEKTDKAQLLRDAAGL 382


>gi|259090326|pdb|3IML|A Chain A, Crystal Structure Of S-Adenosylmethionine Synthetase From Burkholderia Pseudomallei Length = 399 Back     alignment and structure
>gi|157834260|pdb|1XRB|A Chain A, S-Adenosylmethionine Synthetase (Mat, Atp: L-Methionine S- Adenosyltransferase, E.C.2.5.1.6) In Which Met Residues Are Replaced With Selenomethionine Residues (Mse) Length = 383 Back     alignment and structure
>gi|145580347|pdb|2P02|A Chain A, Crystal Structure Of The Alpha Subunit Of Human S- Adenosylmethionine Synthetase 2 Length = 396 Back     alignment and structure
gi|10835631|pdb|1QM4|A Chain A, Methionine Adenosyltransferase Complexed With A L- Methionine Analogous Length = 396 Back     alignment and structure
>gi|122921512|pdb|2OBV|A Chain A, Crystal Structure Of The Human S-Adenosylmethionine Synthetase 1 In Complex With The Product Length = 384 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target413 S-adenosylmethionine synthetase [Candidatus Liberibacte
1p7l_A383 S-adenosylmethionine synthetase; AMPPNP, SAM, transfera 1e-132
3iml_A399 S-adenosylmethionine synthetase; structural genomics, A 1e-122
2p02_A396 S-adenosylmethionine synthetase isoform type-2; structu 1e-111
>1p7l_A S-adenosylmethionine synthetase; AMPPNP, SAM, transferase; HET: SAM ANP PPK; 2.50A {Escherichia coli} SCOP: d.130.1.1 d.130.1.1 d.130.1.1 PDB: 1fug_A 1mxb_A* 1mxc_A* 1mxa_A* 1rg9_A* 1xra_A 1xrb_A 1xrc_A Length = 383 Back     alignment and structure
 Score =  467 bits (1202), Expect = e-132
 Identities = 197/412 (47%), Positives = 248/412 (60%), Gaps = 33/412 (8%)

Query: 3   ADFLFTSESVSEGHPDKICDRISDEIVDLVYREAIESKMDVNSVRVACEVLVTKNKVIVA 62
           A  LFTSESVSEGHPDKI D+ISD ++D +  +      D  + RVACE  V    V+V 
Sbjct: 1   AKHLFTSESVSEGHPDKIADQISDAVLDAILEQ------DPKA-RVACETYVKTGMVLVG 53

Query: 63  GEVRLPHGLSKKDSITGQYVVDKEKFEKVVRSVIRSIGYEQE--GFHWETVDVEVLLHSQ 120
           GE            IT    VD    E++ R+ +R IGY     GF   +  V   +  Q
Sbjct: 54  GE------------ITTSAWVD---IEEITRNTVREIGYVHSDMGFDANSCAVLSAIGKQ 98

Query: 121 SSDIAYGVDNASDDCSTLGAGDQGIMFGYACRETADFMPAPIYYAHRILRTLADARKNSG 180
           S DI  GVD    D    GAGDQG+MFGYA  ET   MPAPI YAHR+++  A+ RKN  
Sbjct: 99  SPDINQGVD--RADPLEQGAGDQGLMFGYATNETDVLMPAPITYAHRLVQRQAEVRKN-- 154

Query: 181 GDVSKLGPDAKSQVTIRYVDNKVCEVKSIVLSIQHFDPTWDRGKVRSVVEPYILKALEDI 240
           G +  L PDAKSQVT +Y D K+  + ++VLS QH +    +    +V+E  I   L   
Sbjct: 155 GTLPWLRPDAKSQVTFQYDDGKIVGIDAVVLSTQHSEEIDQKSLQEAVMEEIIKPILPAE 214

Query: 241 KISPDCSWYINPAGKFVIGGPCSDAGLTGRKIIVDTYGGASPHGGGAFSGKDITKVDRAA 300
            ++    ++INP G+FVIGGP  D GLTGRKIIVDTYGG + HGGGAFSGKD +KVDR+A
Sbjct: 215 WLTSATKFFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSA 274

Query: 301 AYAARYLAKNIVAAGLADRCTIQLSYAIGISRPLSIFVDLHDSGKVSESCVANAINKVMD 360
           AYAARY+AKNIVAAGLADRC IQ+SYAIG++ P SI V+   + KV    +   + +  D
Sbjct: 275 AYAARYVAKNIVAAGLADRCEIQVSYAIGVAEPTSIMVETFGTEKVPSEQLTLLVREFFD 334

Query: 361 LSVSGIRDHLNLSRPIYAQTSAYGHFGRSANQDGFFPWEALDLIEPLKKAIG 412
           L   G+   L+L  PIY +T+AYGHFGR       FPWE  D  + L+ A G
Sbjct: 335 LRPYGLIQMLDLLHPIYKETAAYGHFGREH-----FPWEKTDKAQLLRDAAG 381


>3iml_A S-adenosylmethionine synthetase; structural genomics, ATP- binding, cobalt, cytoplasm, magnesium, metal-binding, nucleotide-binding; 2.35A {Burkholderia pseudomallei} Length = 399 Back     alignment and structure
>2p02_A S-adenosylmethionine synthetase isoform type-2; structural genomics, structural genomics consortium, SGC, transferase; HET: SAM; 1.21A {Homo sapiens} SCOP: d.130.1.1 d.130.1.1 d.130.1.1 PDB: 1qm4_A 1o92_A* 1o93_A* 1o90_A* 1o9t_A 2obv_A* Length = 396 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target413 S-adenosylmethionine synthetase [Candidatus Liberibacte
3iml_A399 S-adenosylmethionine synthetase; structural genomics, A 100.0
1p7l_A383 S-adenosylmethionine synthetase; AMPPNP, SAM, transfera 100.0
2p02_A396 S-adenosylmethionine synthetase isoform type-2; structu 100.0
>3iml_A S-adenosylmethionine synthetase; structural genomics, ATP- binding, cobalt, cytoplasm, magnesium, metal-binding, nucleotide-binding; 2.35A {Burkholderia pseudomallei} Back     alignment and structure
Probab=100.00  E-value=0  Score=1351.72  Aligned_cols=386  Identities=50%  Similarity=0.814  Sum_probs=372.4

Q ss_pred             CCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCEEEEEECCCCEEEEEEEEECCCCCCCCCCCCCC
Q ss_conf             99873067300887883168988688999999863601235666760599993149849998785246555543344542
Q gi|254780423|r    1 MSADFLFTSESVSEGHPDKICDRISDEIVDLVYREAIESKMDVNSVRVACEVLVTKNKVIVAGEVRLPHGLSKKDSITGQ   80 (413)
Q Consensus         1 M~~~~lFTSESVs~GHPDKicDqISDaILD~~L~~Dp~sk~~~~~~RVA~Et~v~~~~V~v~GEI~~~~~i~~~~~~tt~   80 (413)
                      |+++||||||||||||||||||||||||||+||+|||+|       ||||||++++|+|+|+|||++.+.          
T Consensus         5 M~~~ylFTSESVseGHPDKiCDqISDaILDa~L~~Dp~s-------RVA~Et~v~~~~V~v~GEitt~a~----------   67 (399)
T 3iml_A            5 MANDYLFTSESVSEGHPDKVADQISDAILDAILAQDKYS-------RVAAETLCNTGLVVLAGEITTTAN----------   67 (399)
T ss_dssp             CCCEEEEEEEEECTTSHHHHHHHHHHHHHHHHHHHCTTC-------EEEEEEEECSSEEEEEEEEECSCC----------
T ss_pred             CCCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHHCCCC-------CEEEEEEEECCEEEEEEEECCCCC----------
T ss_conf             667866882567899974899988889999999759998-------779999874798999999746876----------


Q ss_pred             EECCHHHHHHHHHHHHHCCCCCCC--CCCCCCCCEEEHHHHHHHHHHHHHHHCCCCCCCCCCCCCEEEEEEEECCCCCCC
Q ss_conf             001677899999999840858701--257332210003333456777554420353000589862488874206645448
Q gi|254780423|r   81 YVVDKEKFEKVVRSVIRSIGYEQE--GFHWETVDVEVLLHSQSSDIAYGVDNASDDCSTLGAGDQGIMFGYACRETADFM  158 (413)
Q Consensus        81 ~~v~~~di~~ivR~~i~~IGY~~~--gfd~~~~~v~~~i~~QS~dIa~GVd~~~~~~~~~GAGDQGiMFGYAc~ET~~~M  158 (413)
                        +   ||++|||++|++|||+++  ||||++|.|+++|++|||||+||||...+..+++|||||||||||||||||+||
T Consensus        68 --v---D~~~ivR~~i~~IGY~~~~~gfd~~t~~v~~~i~~QSpDIa~GVd~~~~~~~e~GAGDQGiMFGYAc~ET~elM  142 (399)
T 3iml_A           68 --I---DYIQIARDTIKRIGYDNTDYGIDYRGCAVLVAYDKQSPDIAQGVDRAHDNNLDQGAGDQGLMFGYACDETPELM  142 (399)
T ss_dssp             --C---CHHHHHHHHHHHHTCC---------CCEEEEEEEEECC------------CTTCCBSSCEEEEEEEETTSTTSC
T ss_pred             --C---CHHHHHHHHHHHHCCCHHHCCCCCCCEEEEEECCCCCCCHHHCCCCCCCCCCCCCCCCCEEEEEEECCCCCCCC
T ss_conf             --8---77999999999867780551977664169985156786210032444556312487754056557638985567


Q ss_pred             CHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCEEEEEEECCCCCEEEEEEEEEEEECCCCCCHHHHHHHHHHHCCCCCC
Q ss_conf             75799999999999997520357641001178268999974976314545788765067326899999887652012332
Q gi|254780423|r  159 PAPIYYAHRILRTLADARKNSGGDVSKLGPDAKSQVTIRYVDNKVCEVKSIVLSIQHFDPTWDRGKVRSVVEPYILKALE  238 (413)
Q Consensus       159 Plpi~lAh~L~krL~~~Rk~~~g~~~~L~PDgKsQVTveY~~~kP~~i~tVViStQH~~~~~~~~~~~~ii~~vI~~~l~  238 (413)
                      ||||+|||+|+|||+++||+  +.+|||||||||||||+|+|++|.||+|||+|+||++.....+++++++++||++++|
T Consensus       143 Plpi~LAH~L~~rL~~~Rk~--~~~~~L~PD~KsQVTv~Y~~~kP~ri~tVVvS~QH~~~v~~~~l~~~i~~~vi~~v~~  220 (399)
T 3iml_A          143 PLPIHLSHRLVERQANLRRD--GRLPWLRPDAKSQVTVRYVDGKPHSIDTVVLSTQHAPEIDLPALREAVIEEVIKPTLP  220 (399)
T ss_dssp             CHHHHHHHHHHHHHHHHHHT--TSSTTEEEEEEEEEEEEEETTEEEEEEEEEEEEEECTTSCHHHHHHHHHHHTTTTTSC
T ss_pred             CHHHHHHHHHHHHHHHHHHC--CCCCCCCCCCCEEEEEEEECCEEEEEEEEEEEECCCCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             73799999999999999730--8887648886127999977992679999998734676569999999999998688767


Q ss_pred             CCCCCCCCEEEEECCCCEEECCCCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCHHH
Q ss_conf             24688542799917883785587300365556111024577666777533565744045778889999999997508232
Q gi|254780423|r  239 DIKISPDCSWYINPAGKFVIGGPCSDAGLTGRKIIVDTYGGASPHGGGAFSGKDITKVDRAAAYAARYLAKNIVAAGLAD  318 (413)
Q Consensus       239 ~~~l~~~t~~~INPtG~FviGGP~~D~GLTGRKiiVDtYGg~~~hGGGAfSGKDptKVDRSaAY~AR~iAKniVaagla~  318 (413)
                      +.+++++|+||||||||||+|||.||||||||||||||||||+||||||||||||||||||||||||||||||||||||+
T Consensus       221 ~~~l~~~t~~~INPtG~FviGGP~~D~GLTGRKiiVDTYGg~~~hGGGAfSGKDptKVDRSaAY~AR~iAKniVaagla~  300 (399)
T 3iml_A          221 ADLIKGDIKFLVNPTGRFVIGGPQGDCGLTGRKIIVDTYGGAAPHGGGAFSGKDPSKVDRSAAYAGRYVAKNIVAAGLAS  300 (399)
T ss_dssp             GGGCCTTCEEEESTTCCCCSCGGGTSCEETTSCTTTTTTTTSSCCCSCCCTTBCTTSHHHHHHHHHHHHHHHHHHTTSCS
T ss_pred             HHCCCCCCEEEECCCCCEEECCCCCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCC
T ss_conf             64588352899769888786788777888762356646677556687636788866434202326888889888752765


Q ss_pred             HHEEEEEECCCCCCCEEEEEEECCCCCCCHHHHHHHHHHHCCCCHHHHHHHCCCCCCCCHHCCCCCCCCCCCCCCCCCCH
Q ss_conf             21100130058355507999824888689899999999745999789998608998620210760207898766678954
Q gi|254780423|r  319 RCTIQLSYAIGISRPLSIFVDLHDSGKVSESCVANAINKVMDLSVSGIRDHLNLSRPIYAQTSAYGHFGRSANQDGFFPW  398 (413)
Q Consensus       319 ~c~vqlsYaIG~~~P~si~V~t~gt~~~~d~~i~~~i~~~fdl~p~~Ii~~l~L~~piy~~ta~yGHFGr~~~~~~~f~W  398 (413)
                      +||||||||||+++|+||+|+||||+++++++|.++|+++|||||++||++|+|++|||++||+||||||+   +.+|||
T Consensus       301 ~c~vqlsYaIG~a~Pvsi~V~tfGT~~~~~~~i~~~i~~~Fdl~p~~Ii~~l~L~~piY~~ta~yGHFGr~---~~~f~W  377 (399)
T 3iml_A          301 RALIQVSYAIGVAEPTSVMVNTFGTGRVSDETITKLVREHFDLRPKGIIQMLDLLRPIYEKTAAYGHFGRE---EPEFSW  377 (399)
T ss_dssp             EEEEEEEECBTCSSCSEEEEECTTCCSSCHHHHHHHHHHHCCCSHHHHHHHHTCCSSCCGGGGSSCSSSCC---CTTCGG
T ss_pred             CEEEEEEECCCCCCCEEEEEEECCCCCCCHHHHHHHHHHHCCCCHHHHHHHCCCCCCCCHHHCCCCCCCCC---CCCCCC
T ss_conf             20688764047787538999836888789999999999837998899998608999854410474788999---999885


Q ss_pred             HHHHHHHHHHHHCCC
Q ss_conf             545789999986086
Q gi|254780423|r  399 EALDLIEPLKKAIGF  413 (413)
Q Consensus       399 E~~d~v~~lk~~~g~  413 (413)
                      ||+|++++||+++|+
T Consensus       378 E~~dk~~~l~~~~~~  392 (399)
T 3iml_A          378 EAADKALALAEAAGV  392 (399)
T ss_dssp             GCCTTHHHHHHHHTC
T ss_pred             CCCHHHHHHHHHCCC
T ss_conf             553279999987499



>1p7l_A S-adenosylmethionine synthetase; AMPPNP, SAM, transferase; HET: SAM ANP PPK; 2.50A {Escherichia coli} SCOP: d.130.1.1 d.130.1.1 d.130.1.1 PDB: 1fug_A 1mxb_A* 1mxc_A* 1mxa_A* 1rg9_A* 1xra_A 1xrb_A 1xrc_A Back     alignment and structure
>2p02_A S-adenosylmethionine synthetase isoform type-2; structural genomics, structural genomics consortium, SGC, transferase; HET: SAM; 1.21A {Homo sapiens} SCOP: d.130.1.1 d.130.1.1 d.130.1.1 PDB: 1qm4_A 1o92_A* 1o93_A* 1o90_A* 1o9t_A 2obv_A* Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 413 S-adenosylmethionine synthetase [Candidatus Liberibacte
d1mxaa3152 d.130.1.1 (A:232-383) S-adenosylmethionine synthetase { 3e-57
d2p02a3144 d.130.1.1 (A:274-417) S-adenosylmethionine synthetase { 5e-54
d1mxaa2124 d.130.1.1 (A:108-231) S-adenosylmethionine synthetase { 3e-31
d2p02a2126 d.130.1.1 (A:148-273) S-adenosylmethionine synthetase { 3e-31
d2p02a1110 d.130.1.1 (A:38-147) S-adenosylmethionine synthetase {H 2e-28
d1mxaa1102 d.130.1.1 (A:1-102) S-adenosylmethionine synthetase {Es 3e-24
>d1mxaa3 d.130.1.1 (A:232-383) S-adenosylmethionine synthetase {Escherichia coli [TaxId: 562]} Length = 152 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: S-adenosylmethionine synthetase
superfamily: S-adenosylmethionine synthetase
family: S-adenosylmethionine synthetase
domain: S-adenosylmethionine synthetase
species: Escherichia coli [TaxId: 562]
 Score =  216 bits (551), Expect = 3e-57
 Identities = 90/155 (58%), Positives = 108/155 (69%), Gaps = 5/155 (3%)

Query: 258 IGGPCSDAGLTGRKIIVDTYGGASPHGGGAFSGKDITKVDRAAAYAARYLAKNIVAAGLA 317
           IGGP  D GLTGRKIIVDTYGG + HGGGAFSGKD +KVDR+AAYAARY+AKNIVAAGLA
Sbjct: 1   IGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLA 60

Query: 318 DRCTIQLSYAIGISRPLSIFVDLHDSGKVSESCVANAINKVMDLSVSGIRDHLNLSRPIY 377
           DRC IQ+SYAIG++ P SI V+   + KV    +   + +  DL   G+   L+L  PIY
Sbjct: 61  DRCEIQVSYAIGVAEPTSIMVETFGTEKVPSEQLTLLVREFFDLRPYGLIQMLDLLHPIY 120

Query: 378 AQTSAYGHFGRSANQDGFFPWEALDLIEPLKKAIG 412
            +T+AYGHFGR       FPWE  D  + L+ A G
Sbjct: 121 KETAAYGHFGREH-----FPWEKTDKAQLLRDAAG 150


>d2p02a3 d.130.1.1 (A:274-417) S-adenosylmethionine synthetase {Human (Homo sapiens), isoform type-2 [TaxId: 9606]} Length = 144 Back     information, alignment and structure
>d1mxaa2 d.130.1.1 (A:108-231) S-adenosylmethionine synthetase {Escherichia coli [TaxId: 562]} Length = 124 Back     information, alignment and structure
>d2p02a2 d.130.1.1 (A:148-273) S-adenosylmethionine synthetase {Human (Homo sapiens), isoform type-2 [TaxId: 9606]} Length = 126 Back     information, alignment and structure
>d2p02a1 d.130.1.1 (A:38-147) S-adenosylmethionine synthetase {Human (Homo sapiens), isoform type-2 [TaxId: 9606]} Length = 110 Back     information, alignment and structure
>d1mxaa1 d.130.1.1 (A:1-102) S-adenosylmethionine synthetase {Escherichia coli [TaxId: 562]} Length = 102 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target413 S-adenosylmethionine synthetase [Candidatus Liberibacte
d1mxaa3152 S-adenosylmethionine synthetase {Escherichia coli [TaxI 100.0
d2p02a3144 S-adenosylmethionine synthetase {Human (Homo sapiens), 100.0
d1mxaa2124 S-adenosylmethionine synthetase {Escherichia coli [TaxI 100.0
d2p02a2126 S-adenosylmethionine synthetase {Human (Homo sapiens), 100.0
d2p02a1110 S-adenosylmethionine synthetase {Human (Homo sapiens), 100.0
d1mxaa1102 S-adenosylmethionine synthetase {Escherichia coli [TaxI 100.0
>d1mxaa3 d.130.1.1 (A:232-383) S-adenosylmethionine synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: S-adenosylmethionine synthetase
superfamily: S-adenosylmethionine synthetase
family: S-adenosylmethionine synthetase
domain: S-adenosylmethionine synthetase
species: Escherichia coli [TaxId: 562]
Probab=100.00  E-value=0  Score=562.13  Aligned_cols=151  Identities=60%  Similarity=0.995  Sum_probs=149.1

Q ss_pred             ECCCCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCHHHHHEEEEEECCCCCCCEEEE
Q ss_conf             55873003655561110245776667775335657440457788899999999975082322110013005835550799
Q gi|254780423|r  258 IGGPCSDAGLTGRKIIVDTYGGASPHGGGAFSGKDITKVDRAAAYAARYLAKNIVAAGLADRCTIQLSYAIGISRPLSIF  337 (413)
Q Consensus       258 iGGP~~D~GLTGRKiiVDtYGg~~~hGGGAfSGKDptKVDRSaAY~AR~iAKniVaagla~~c~vqlsYaIG~~~P~si~  337 (413)
                      +|||.|||||||||||||||||++||||||||||||||||||||||||||||||||+|||++|+||||||||+++|+||+
T Consensus         1 iGGp~~d~GlTGRKiivDtYGg~~~~GGGafsGKD~tKVDRSaAY~AR~iAKniVaaglA~~c~VQlsYAIGva~Pvsi~   80 (152)
T d1mxaa3           1 IGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQVSYAIGVAEPTSIM   80 (152)
T ss_dssp             SCTTTTSEEETTSSHHHHHTTTSSCCCSCCCTTBCTTCHHHHHHHHHHHHHHHHHHTTSCSEEEEEEEECTTCSSCSEEE
T ss_pred             CCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCEEEEEEEECCCCCEEEEE
T ss_conf             97986566775662789767775165887778886551101088999987777987089751377775404702000668


Q ss_pred             EEECCCCCCCHHHHHHHHHHHCCCCHHHHHHHCCCCCCCCHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCC
Q ss_conf             9824888689899999999745999789998608998620210760207898766678954545789999986086
Q gi|254780423|r  338 VDLHDSGKVSESCVANAINKVMDLSVSGIRDHLNLSRPIYAQTSAYGHFGRSANQDGFFPWEALDLIEPLKKAIGF  413 (413)
Q Consensus       338 V~t~gt~~~~d~~i~~~i~~~fdl~p~~Ii~~l~L~~piy~~ta~yGHFGr~~~~~~~f~WE~~d~v~~lk~~~g~  413 (413)
                      |+||||+++++++|.++|+++|||||++||++|+|++|||++||+||||||+     +||||++|++++||+++||
T Consensus        81 V~t~gt~~~~~~~i~~~I~~~FDl~P~~II~~L~L~~PiY~~TAayGHFGR~-----~f~WEk~d~v~~lk~a~gl  151 (152)
T d1mxaa3          81 VETFGTEKVPSEQLTLLVREFFDLRPYGLIQMLDLLHPIYKETAAYGHFGRE-----HFPWEKTDKAQLLRDAAGL  151 (152)
T ss_dssp             EEECSCCSSCHHHHHHHHHHHCCCSHHHHHHHTTCCSSCCGGGGSSCSSSCS-----SSGGGCCTTHHHHHHHSSC
T ss_pred             EEECCCCCCHHHHHHHHHHHHCCCCHHHHHHHCCCCCCCCCCCCCCCCCCCC-----CCCCCCCHHHHHHHHHCCC
T ss_conf             8842686300588999999835987899987408999745123787788899-----9796241469999997089



>d2p02a3 d.130.1.1 (A:274-417) S-adenosylmethionine synthetase {Human (Homo sapiens), isoform type-2 [TaxId: 9606]} Back     information, alignment and structure
>d1mxaa2 d.130.1.1 (A:108-231) S-adenosylmethionine synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p02a2 d.130.1.1 (A:148-273) S-adenosylmethionine synthetase {Human (Homo sapiens), isoform type-2 [TaxId: 9606]} Back     information, alignment and structure
>d2p02a1 d.130.1.1 (A:38-147) S-adenosylmethionine synthetase {Human (Homo sapiens), isoform type-2 [TaxId: 9606]} Back     information, alignment and structure
>d1mxaa1 d.130.1.1 (A:1-102) S-adenosylmethionine synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 413 S-adenosylmethionine synthetase [Candidatus Liberi
1p7l_A_99-132_233-383185 (A:99-132,A:233-383) S-adenosylmethionine syntheta 4e-56
3iml_A_116-140_241-399184 (A:116-140,A:241-399) S-adenosylmethionine synthet 7e-56
2p02_A_115-149_254-396178 (A:115-149,A:254-396) S-adenosylmethionine synthet 2e-52
1p7l_A_99-132_233-383185 (A:99-132,A:233-383) S-adenosylmethionine syntheta 1e-08
3iml_A_116-140_241-399184 (A:116-140,A:241-399) S-adenosylmethionine synthet 1e-05
2p02_A_115-149_254-396178 (A:115-149,A:254-396) S-adenosylmethionine synthet 4e-08
1p7l_A_1-13_133-232113 (A:1-13,A:133-232) S-adenosylmethionine synthetase 2e-27
3iml_A_1-19_141-240119 (A:1-19,A:141-240) S-adenosylmethionine synthetase 3e-26
2p02_A_1-29_150-253133 (A:1-29,A:150-253) S-adenosylmethionine synthetase 2e-24
3iml_A_20-11596 (A:20-115) S-adenosylmethionine synthetase; struct 9e-22
2p02_A_30-11485 (A:30-114) S-adenosylmethionine synthetase isoform 1e-19
1p7l_A_14-9885 (A:14-98) S-adenosylmethionine synthetase; AMPPNP, 3e-19
>1p7l_A (A:99-132,A:233-383) S-adenosylmethionine synthetase; AMPPNP, SAM, transferase; HET: SAM ANP PPK; 2.50A {Escherichia coli}Length = 185 Back     alignment and structure
 Score =  213 bits (543), Expect = 4e-56
 Identities = 89/154 (57%), Positives = 107/154 (69%), Gaps = 5/154 (3%)

Query: 259 GGPCSDAGLTGRKIIVDTYGGASPHGGGAFSGKDITKVDRAAAYAARYLAKNIVAAGLAD 318
           GGP  D GLTGRKIIVDTYGG + HGGGAFSGKD +KVDR+AAYAARY+AKNIVAAGLAD
Sbjct: 35  GGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLAD 94

Query: 319 RCTIQLSYAIGISRPLSIFVDLHDSGKVSESCVANAINKVMDLSVSGIRDHLNLSRPIYA 378
           RC IQ+SYAIG++ P SI V+   + KV    +   + +  DL   G+   L+L  PIY 
Sbjct: 95  RCEIQVSYAIGVAEPTSIMVETFGTEKVPSEQLTLLVREFFDLRPYGLIQMLDLLHPIYK 154

Query: 379 QTSAYGHFGRSANQDGFFPWEALDLIEPLKKAIG 412
           +T+AYGHFGR       FPWE  D  + L+ A G
Sbjct: 155 ETAAYGHFGRE-----HFPWEKTDKAQLLRDAAG 183


>3iml_A (A:116-140,A:241-399) S-adenosylmethionine synthetase; structural genomics, ATP- binding, cobalt, cytoplasm, magnesium, metal-binding, nucleotide-binding; 2.35A {Burkholderia pseudomallei}Length = 184 Back     alignment and structure
>2p02_A (A:115-149,A:254-396) S-adenosylmethionine synthetase isoform type-2; structural genomics, structural genomics consortium, SGC, transferase; HET: SAM; 1.21A {Homo sapiens}Length = 178 Back     alignment and structure
>1p7l_A (A:99-132,A:233-383) S-adenosylmethionine synthetase; AMPPNP, SAM, transferase; HET: SAM ANP PPK; 2.50A {Escherichia coli}Length = 185 Back     alignment and structure
>3iml_A (A:116-140,A:241-399) S-adenosylmethionine synthetase; structural genomics, ATP- binding, cobalt, cytoplasm, magnesium, metal-binding, nucleotide-binding; 2.35A {Burkholderia pseudomallei}Length = 184 Back     alignment and structure
>2p02_A (A:115-149,A:254-396) S-adenosylmethionine synthetase isoform type-2; structural genomics, structural genomics consortium, SGC, transferase; HET: SAM; 1.21A {Homo sapiens}Length = 178 Back     alignment and structure
>1p7l_A (A:1-13,A:133-232) S-adenosylmethionine synthetase; AMPPNP, SAM, transferase; HET: SAM ANP PPK; 2.50A {Escherichia coli}Length = 113 Back     alignment and structure
>3iml_A (A:1-19,A:141-240) S-adenosylmethionine synthetase; structural genomics, ATP- binding, cobalt, cytoplasm, magnesium, metal-binding, nucleotide-binding; 2.35A {Burkholderia pseudomallei}Length = 119 Back     alignment and structure
>2p02_A (A:1-29,A:150-253) S-adenosylmethionine synthetase isoform type-2; structural genomics, structural genomics consortium, SGC, transferase; HET: SAM; 1.21A {Homo sapiens}Length = 133 Back     alignment and structure
>3iml_A (A:20-115) S-adenosylmethionine synthetase; structural genomics, ATP- binding, cobalt, cytoplasm, magnesium, metal-binding, nucleotide-binding; 2.35A {Burkholderia pseudomallei}Length = 96 Back     alignment and structure
>2p02_A (A:30-114) S-adenosylmethionine synthetase isoform type-2; structural genomics, structural genomics consortium, SGC, transferase; HET: SAM; 1.21A {Homo sapiens}Length = 85 Back     alignment and structure
>1p7l_A (A:14-98) S-adenosylmethionine synthetase; AMPPNP, SAM, transferase; HET: SAM ANP PPK; 2.50A {Escherichia coli}Length = 85 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target413 S-adenosylmethionine synthetase [Candidatus Liberibacte
1p7l_A_99-132_233-383185 S-adenosylmethionine synthetase; AMPPNP, SAM, tran 100.0
2p02_A_115-149_254-396178 S-adenosylmethionine synthetase isoform type-2; st 100.0
3iml_A_116-140_241-399184 S-adenosylmethionine synthetase; structural genomi 100.0
3iml_A_20-11596 S-adenosylmethionine synthetase; structural genomi 100.0
1p7l_A_14-9885 S-adenosylmethionine synthetase; AMPPNP, SAM, tran 100.0
2p02_A_30-11485 S-adenosylmethionine synthetase isoform type-2; st 100.0
3iml_A_1-19_141-240119 S-adenosylmethionine synthetase; structural genomi 100.0
1p7l_A_1-13_133-232113 S-adenosylmethionine synthetase; AMPPNP, SAM, tran 100.0
2p02_A_1-29_150-253133 S-adenosylmethionine synthetase isoform type-2; st 100.0
3iml_A_1-19_141-240119 S-adenosylmethionine synthetase; structural genomi 95.37
>1p7l_A (A:99-132,A:233-383) S-adenosylmethionine synthetase; AMPPNP, SAM, transferase; HET: SAM ANP PPK; 2.50A {Escherichia coli} Back     alignment and structure
Probab=100.00  E-value=0  Score=650.34  Aligned_cols=184  Identities=59%  Similarity=0.961  Sum_probs=178.1

Q ss_pred             HHHHHHHHHHCCCCCCCCCCCCCEEEEEEEECCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCEEEEEEECC
Q ss_conf             56777554420353000589862488874206645448757999999999999975203576410011782689999749
Q gi|254780423|r  121 SSDIAYGVDNASDDCSTLGAGDQGIMFGYACRETADFMPAPIYYAHRILRTLADARKNSGGDVSKLGPDAKSQVTIRYVD  200 (413)
Q Consensus       121 S~dIa~GVd~~~~~~~~~GAGDQGiMFGYAc~ET~~~MPlpi~lAh~L~krL~~~Rk~~~g~~~~L~PDgKsQVTveY~~  200 (413)
                      ||||+||||...  .+++|||||||||||||||||+                                            
T Consensus         1 S~dIa~gv~~~~--~~~~GAGDQGimfGyA~~ET~~--------------------------------------------   34 (185)
T 1p7l_A            1 SPDINQGVDRAD--PLEQGAGDQGLMFGYATNETDV--------------------------------------------   34 (185)
T ss_dssp             CHHHHHHHSCSS--TTTCCCSSCEEEEEEEETTSTT--------------------------------------------
T ss_pred             CHHHHCCCCCCC--CCCCCCCCCCEEEEEECCCCCC--------------------------------------------
T ss_conf             777760355333--1113667641587675279855--------------------------------------------


Q ss_pred             CCCEEEEEEEEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCEEEEECCCCEEECCCCCCCCCCCCCEEECCCCCC
Q ss_conf             76314545788765067326899999887652012332246885427999178837855873003655561110245776
Q gi|254780423|r  201 NKVCEVKSIVLSIQHFDPTWDRGKVRSVVEPYILKALEDIKISPDCSWYINPAGKFVIGGPCSDAGLTGRKIIVDTYGGA  280 (413)
Q Consensus       201 ~kP~~i~tVViStQH~~~~~~~~~~~~ii~~vI~~~l~~~~l~~~t~~~INPtG~FviGGP~~D~GLTGRKiiVDtYGg~  280 (413)
                                                                                |||.|||||||||||||||||+
T Consensus        35 ----------------------------------------------------------GGP~gD~GlTGRKiivDtYGg~   56 (185)
T 1p7l_A           35 ----------------------------------------------------------GGPMGDCGLTGRKIIVDTYGGM   56 (185)
T ss_dssp             ----------------------------------------------------------CHHHHSCEETTCCTTTTTTTTS
T ss_pred             ----------------------------------------------------------CCCCCCCCCCCCCCEECCCCCC
T ss_conf             ----------------------------------------------------------7985456777752013255564


Q ss_pred             CCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCHHHHHEEEEEECCCCCCCEEEEEEECCCCCCCHHHHHHHHHHHCC
Q ss_conf             66777533565744045778889999999997508232211001300583555079998248886898999999997459
Q gi|254780423|r  281 SPHGGGAFSGKDITKVDRAAAYAARYLAKNIVAAGLADRCTIQLSYAIGISRPLSIFVDLHDSGKVSESCVANAINKVMD  360 (413)
Q Consensus       281 ~~hGGGAfSGKDptKVDRSaAY~AR~iAKniVaagla~~c~vqlsYaIG~~~P~si~V~t~gt~~~~d~~i~~~i~~~fd  360 (413)
                      ++|||||||||||||||||||||||||||||||||||+||+||||||||+++|+||+|+||||+++++++|.++|+++||
T Consensus        57 ~~hGGGAfSGKD~tKVDRSaaY~AR~iAK~iVaagla~~c~vqlsYAIGva~Pvsi~V~tfGT~~~sd~~i~~iI~~~FD  136 (185)
T 1p7l_A           57 ARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQVSYAIGVAEPTSIMVETFGTEKVPSEQLTLLVREFFD  136 (185)
T ss_dssp             SCCCSCCCTTBCTTSHHHHHHHHHHHHHHHHHHTTSBSEEEEEEEECTTCCSCSEEEEECTTCBSSCHHHHHHHHHHHCC
T ss_pred             CCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCEEEEEEECCCCCCCHHHHHHHHHHCCC
T ss_conf             46688646788855333312446778789998648877548986211377787389998468888899999999998079


Q ss_pred             CCHHHHHHHCCCCCCCCHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCC
Q ss_conf             99789998608998620210760207898766678954545789999986086
Q gi|254780423|r  361 LSVSGIRDHLNLSRPIYAQTSAYGHFGRSANQDGFFPWEALDLIEPLKKAIGF  413 (413)
Q Consensus       361 l~p~~Ii~~l~L~~piy~~ta~yGHFGr~~~~~~~f~WE~~d~v~~lk~~~g~  413 (413)
                      |||++||++|+|++|||++||+||||||+     +||||++|+++.||+++++
T Consensus       137 lrP~~II~~L~L~~PiY~kTA~YGHFGr~-----df~WEk~d~v~~lk~~~~~  184 (185)
T 1p7l_A          137 LRPYGLIQMLDLLHPIYKETAAYGHFGRE-----HFPWEKTDKAQLLRDAAGL  184 (185)
T ss_dssp             CSHHHHHHHHTCCSSCCGGGGSSCSSSCT-----TSTTTCCSHHHHHHHTSCC
T ss_pred             CCHHHHHHHHCCCCCCCHHHCCCCCCCCC-----CCCCCCCHHHHHHHHHCCC
T ss_conf             98899998718999864311575688999-----9881664259999987089



>2p02_A (A:115-149,A:254-396) S-adenosylmethionine synthetase isoform type-2; structural genomics, structural genomics consortium, SGC, transferase; HET: SAM; 1.21A {Homo sapiens} Back     alignment and structure
>3iml_A (A:116-140,A:241-399) S-adenosylmethionine synthetase; structural genomics, ATP- binding, cobalt, cytoplasm, magnesium, metal-binding, nucleotide-binding; 2.35A {Burkholderia pseudomallei} Back     alignment and structure
>3iml_A (A:20-115) S-adenosylmethionine synthetase; structural genomics, ATP- binding, cobalt, cytoplasm, magnesium, metal-binding, nucleotide-binding; 2.35A {Burkholderia pseudomallei} Back     alignment and structure
>1p7l_A (A:14-98) S-adenosylmethionine synthetase; AMPPNP, SAM, transferase; HET: SAM ANP PPK; 2.50A {Escherichia coli} Back     alignment and structure
>2p02_A (A:30-114) S-adenosylmethionine synthetase isoform type-2; structural genomics, structural genomics consortium, SGC, transferase; HET: SAM; 1.21A {Homo sapiens} Back     alignment and structure
>3iml_A (A:1-19,A:141-240) S-adenosylmethionine synthetase; structural genomics, ATP- binding, cobalt, cytoplasm, magnesium, metal-binding, nucleotide-binding; 2.35A {Burkholderia pseudomallei} Back     alignment and structure
>1p7l_A (A:1-13,A:133-232) S-adenosylmethionine synthetase; AMPPNP, SAM, transferase; HET: SAM ANP PPK; 2.50A {Escherichia coli} Back     alignment and structure
>2p02_A (A:1-29,A:150-253) S-adenosylmethionine synthetase isoform type-2; structural genomics, structural genomics consortium, SGC, transferase; HET: SAM; 1.21A {Homo sapiens} Back     alignment and structure
>3iml_A (A:1-19,A:141-240) S-adenosylmethionine synthetase; structural genomics, ATP- binding, cobalt, cytoplasm, magnesium, metal-binding, nucleotide-binding; 2.35A {Burkholderia pseudomallei} Back     alignment and structure