255764471

255764471

GTP-binding protein EngA

GeneID in NCBI database:8209408Locus tag:CLIBASIA_01535
Protein GI in NCBI database:255764471Protein Accession:YP_003064835.2
Gene range:+(327468, 328880)Protein Length:470aa
Gene description:GTP-binding protein EngA
COG prediction:[R] Predicted GTPases
KEGG prediction:engA; GTP-binding protein EngA; K03977 GTP-binding protein
SEED prediction:GTP-binding protein EngA
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Universal GTPases
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470
MIYTIAIVGAPNVGKSTLFNRLVKKKMAVVGNHPGITRDRLYGQAIINGVIFNIVDTAGIADGKNCSIAKQMNDQTELAINEAHLILFLIDSKAGITPYDHAITSFLRKKNIPIIIVSNKMDTRIAQRNFYEIYSLDFKEIVEISAEHDLGTSELHSVIFKIFKQKYPNHPLEMIENNKRNEESPKENITSEGKSSVKNISKPLRIAVVGRPNVGKSTLINRLLGYNRLLTGSQSGITRDSVSISWNWKNHPIEIFDTAGMRKPSRITESLEQKTVKKSMQSVRTCETTIVLLDATIPFEKQDLRIVDSVFNTGHAVVLALNKWDMVSDKLNLLQDLRTKAIKNLPQIGDIYINTISGRTGEGLDDLMVSVLEINKLWKTRITTSYLNSWLQKTQLQNPPPTIFNRYNRLKYITQIQSSPPSFLIFCTFPNKIPESYKRYLINRLRINFSLSGIPIRMCFQSSKNPYIKK
ccEEEEEEccccccHHHHHHHHHccccEEEcccccEEEEEEEEEEEccccEEEEEEccccccccHHHHHHHHHHHHHHHHccccEEEEEccccccccHHHHHHHHHHHHHcccEEEEEEccccccHHHHHHHHHHcccccEEEEEHHccccHHHHHHHcccccccccHHHHcccccccccccccccccccccccccccccccccEEEEEcccccccHHHHHHHHcccccEEcccccEEEEEEEEEEEEccEEEEEEEccccccccHHHHHHHHHHHHHHHHHcccccEEEEEEEccccccHHHHHHHHHHHHccccEEEEEEcccccccHHHHHHHHHHHHHHHcccccccEEEEEEccccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccccccEEEEEEEEEEEcccccEEEEEEccHHHccHHHHHHHHHHHHHHccccccEEEEEEEccccccccc
cccEEEEEccccccHHHHHHHHHcccEEEcccccccccccEEEcccccccEEEEEEcccccccccccHHHHHHHHHHHHHHHccEEEEEEEccccccHHHHHHHHHHHHccccEEEEEEcccccccHHHHHHHHHccccccccccHHccccHHHHHHHHHHHccHHHHcccHcccccccHHHHHHHcccHHHHHccccccccccEEEEEccccccHHHHHHHHHcccEEEcccccccccccEEEEccccccEEEEEEcccEcccccEccHHHHHHHHHHHHHHHHccEEEEEEEcccccHHHHHHHHHHHHHcccEEEEEEEccccccccHHHHHHHHHHHHHHHcccccccEEEEEcccccccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccccccccEEEEEEEEcccccccEEEEEcccHHHccHHHHHHHHHHHHHHcccccccEEEEEEccccccccc
MIYTIAIVgapnvgkstLFNRLVKKKMAVvgnhpgitrdrlYGQAIINGVIFNIvdtagiadgkncsiAKQMNDQTELAINEAHLILFLIdskagitpydHAITSFLrkknipiiivsnKMDTRIAQRNFYEIYSLDFKEIVEISaehdlgtsELHSVIFKIFkqkypnhplemiennkrneespkenitsegkssvkniskplriavvgrpnvgksTLINRLLGynrlltgsqsgitrdsvsiswnwknhpieifdtagmrkpsritESLEQKTVKKSMQSVRTCETTIVLLdatipfekqdlrivdSVFNTGHAVVLALNKWDMVSDKLNLLQDLRTKAIKNlpqigdiyintisgrtgegLDDLMVSVLEINKLWKTRITTSYLNSWLqktqlqnppptifnrynRLKYITQiqssppsflifctfpnkipesYKRYLINRLRInfslsgipirmcfqssknpyikk
miytiaivgapnvgksTLFNRLVKKKMAVVGnhpgitrdrlyGQAIINGVIFNIVDTAGIADGKNCSIAKQMNDQTELAINEAHLILFLIDSKAGITPYDHAITsflrkknipiIIVSNKMDTRIAQRNFYEIYSLDFKEIVEISAEHDLGTSELHSVIFKIFKQKYPNHPLEMIennkrneespkenitsegkssvkniskplriavvgrpnvgkstlinrllgynrlltgsqsgitrdsvsiswNWKNHPIEifdtagmrkpsrITESLeqktvkksmqsvrtceTTIVLLDATIPFEKQDLRIVDSVFNTGHAVVLALNKWDMVSDKLNLLQDLRTKAiknlpqigdIYINTISGRTGEGLDDLMVSVLEINKLWKTRITTSYLNswlqktqlqnpppTIFNRYNRLKYITQIQSSPPSFLIFCTFPNKIPESYKRYLINRLRINfslsgipirmcfqssknpyikk
MIYTIAIVGAPNVGKSTLFNRLVKKKMAVVGNHPGITRDRLYGQAIINGVIFNIVDTAGIADGKNCSIAKQMNDQTELAINEAHLILFLIDSKAGITPYDHAITSFLRKKNIPIIIVSNKMDTRIAQRNFYEIYSLDFKEIVEISAEHDLGTSELHSVIFKIFKQKYPNHPLEMIENNKRNEESPKENITSEGKSSVKNISKPLRIAVVGRPNVGKSTLINRLLGYNRLLTGSQSGITRDSVSISWNWKNHPIEIFDTAGMRKPSRITESLEQKTVKKSMQSVRTCETTIVLLDATIPFEKQDLRIVDSVFNTGHAVVLALNKWDMVSDKLNLLQDLRTKAIKNLPQIGDIYINTISGRTGEGLDDLMVSVLEINKLWKTRITTSYLNSWLQKTQLQNPPPTIFNRYNRLKYITQIQSSPPSFLIFCTFPNKIPESYKRYLINRLRINFSLSGIPIRMCFQSSKNPYIKK
MIYTIAIVGAPNVGKSTLFNRLVKKKMAVVGNHPGITRDRLYGQAIINGVIFNIVDTAGIADGKNCSIAKQMNDQTELAINEAHLILFLIDSKAGITPYDHAITSFLRKKNIPIIIVSNKMDTRIAQRNFYEIYSLDFKEIVEISAEHDLGTSELHSVIFKIFKQKYPNHPLEMIENNKRNEESPKE***********NISKPLRIAVVGRPNVGKSTLINRLLGYNRLLTGSQSGITRDSVSISWNWKNHPIEIFDTAGMRKPSRITESLEQKTVKKSMQSVRTCETTIVLLDATIPFEKQDLRIVDSVFNTGHAVVLALNKWDMVSDKLNLLQDLRTKAIKNLPQIGDIYINTISGRTGEGLDDLMVSVLEINKLWKTRITTSYLNSWLQKTQLQNPPPTIFNRYNRLKYITQIQSSPPSFLIFCTFPNKIPESYKRYLINRLRINFSLSGIPIRMCFQ*********
MIYTIAIVGAPNVGKSTLFNRLVKKKMAVVGNHPGITRDRLYGQAIINGVIFNIVDTAGIADGKNCSIAKQMNDQTELAINEAHLILFLIDSKAGITPYDHAITSFLRKKNIPIIIVSNKMDTRIAQRNFYEIYSLDFKEIVEISAEHDLGTSELHSVIFKIFKQKYPNHPLEMIENNK*****************VKNISKPLRIAVVGRPNVGKSTLINRLLGYNRLLTGSQSGITRDSVSISWNWKNHPIEIFDTAGMRKPSRITES*************RTCETTIVLLDATIPFEKQDLRIVDSVFNTGHAVVLALNKWDMVSDKLNLLQDLRTKAIKNLPQIGDIYINTISGRTGEGLDDLMVSVLEINKLWKTRITTSYLNSWLQKTQLQNPPPTIFNRYNRLKYITQIQSSPPSFLIFCTFPNKIPESYKRYLINRLRINFSLSGIPIRMCFQSSKNPYIKK
MIYTIAIVGAPNVGKSTLFNRLVKKKMAVVGNHPGITRDRLYGQAIINGVIFNIVDTAGIADGKNCSIAKQMNDQTELAINEAHLILFLIDSKAGITPYDHAITSFLRKKNIPIIIVSNKMDTRIAQRNFYEIYSLDFKEIVEISAEHDLGTSELHSVIFKIFKQKYP*************EE****N**SE**SSVKNISKPLRIAVVGRPNVGKSTLINRLLGYNRLLTGSQSGITRDSVSISWNWKNHPIEIFDTAGMRKPSRITESLEQKTVKKSMQSVRTCETTIVLLDATIPFEKQDLRIVDSVFNTGHAVVLALNKWDMVSDKLNLLQDLRTKAIKNLPQIGDIYINTISGRTGEGLDDLMVSVLEINKLWKTRITTSYLNSWLQKTQLQNPPPTIFNRYNRLKYITQIQSSPPSFLIFCTFPNKIPESYKRYLINRLRINFSLSGIPIRMCFQSSKN*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIYTIAIVGAPNVGKSTLFNRLVKKKMAVVGNHPGITRDRLYGQAIINGVIFNIVDTAGIADGKNCSIAKQMNDQTELAINEAHLILFLIDSKAGITPYDHAITSFLRKKNIPIIIVSNKMDTRIAQRNFYEIYSLDFKEIVEISAEHDLGTSELHSVIFKIFKQKYPNHPLEMIENNKRNEESPKENITSEGKSSVKNISKPLRIAVVGRPNVGKSTLINRLLGYNRLLTGSQSGITRDSVSISWNWKNHPIEIFDTAGMRKPSRITESLEQKTVKKSMQSVRTCETTIVLLDATIPFEKQDLRIVDSVFNTGHAVVLALNKWDMVSDKLNLLQDLRTKAIKNLPQIGDIYINTISGRTGEGLDDLMVSVLEINKLWKTRITTSYLNSWLQKTQLQNPPPTIFNRYNRLKYITQIQSSPPSFLIFCTFPNKIPESYKRYLINRLRINFSLSGIPIRMCFQSSKNPYIKK
MIYTIAIVGAPNVGKSTLFNRLVKKKMAVVGNHPGITRDRLYGQAIINGVIFNIVDTAGIADGKNCSIAKQMNDQTELAINEAHLILFLIDSKAGITPYDHAITSFLRKKNIPIIIVSNKMDTRIAQRNFYEIYSLDFKEIVEISAEHDLGTSELHSVIFKIFKQKYPNHPLEMIENNKRNEESPKENITSEGKSSVKNISKPLRIAVVGRPNVGKSTLINRLLGYNRLLTGSQSGITRDSVSISWNWKNHPIEIFDTAGMRKPSRITESLEQKTVKKSMQSVRTCETTIVLLDATIPFEKQDLRIVDSVFNTGHAVVLALNKWDMVSDKLNLLQDLRTKAIKNLPQIGDIYINTISGRTGEGLDDLMVSVLEINKLWKTRITTSYLNSWLQKTQLQNPPPTIFNRYNRLKYITQIQSSPPSFLIFCTFPNKIPESYKRYLINRLRINFSLSGIPIRMCFQSSKNPYIKK
MIYTIAIVGAPNVGKSTLFNRLVKKKMAVVGNHPGITRDRLYGQAIINGVIFNIVDTAGIADGKNCSIAKQMNDQTELAINEAHLILFLIDSKAGITPYDHAITSFLRKKNIPIIIVSNKMDTRIAQRNFYEIYSLDFKEIVEISAEHDLGTSELHSVIFKIFKQKYPNHPLEMIENNKRNEESPKENITSEGKSSVKNISKPLRIAVVGRPNVGKSTLINRLLGYNRLLTGSQSGITRDSVSISWNWKNHPIEIFDTAGMRKPSRITESLEQKTVKKSMQSVRTCETTIVLLDATIPFEKQDLRIVDSVFNTGHAVVLALNKWDMVSDKLNLLQDLRTKAIKNLPQIGDIYINTISGRTGEGLDDLMVSVLEINKLWKTRITTSYLNSWLQKTQLQNPPPTIFNRYNRLKYITQIQSSPPSFLIFCTFPNKIPESYKRYLINRLRINFSLSGIPIRMCFQSSKNPYIKK

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target470 GTP-binding protein EngA [Candidatus Liberibacter asiat
254780809440 tRNA modification GTPase TrmE [Candidatus Liberiba 3e-13
254780809440 tRNA modification GTPase TrmE [Candidatus Liberiba 4e-07
254780941311 GTP-binding protein Era [Candidatus Liberibacter a 3e-08
254780941311 GTP-binding protein Era [Candidatus Liberibacter a 9e-06
254780321 606 GTP-binding protein LepA [Candidatus Liberibacter 2e-06
254780484212 GTPase EngB [Candidatus Liberibacter asiaticus str 3e-05
254780226367 translation-associated GTPase [Candidatus Liberiba 8e-05
254780264 701 elongation factor G [Candidatus Liberibacter asiat 0.033
254780233 624 GTP-binding protein [Candidatus Liberibacter asiat 0.038
>gi|254780809|ref|YP_003065222.1| tRNA modification GTPase TrmE [Candidatus Liberibacter asiaticus str. psy62] Length = 440 Back     alignment
 Score = 67.8 bits (164), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 63/181 (34%), Positives = 88/181 (48%), Gaps = 23/181 (12%)

Query: 3   YTIAIVGAPNVGKSTLFNRLVKKKMAVVGNHPGITRDRLYGQAIINGVIFNIVDTAGIAD 62
           Y I I+G  N GKS+LFN L KK +A+V + PG TRD L     + G +  I DTAGI +
Sbjct: 220 YKIVILGHSNAGKSSLFNALAKKDVAIVTDIPGTTRDVLTIDLDLEGYLVKISDTAGIRE 279

Query: 63  GKNCSIAKQMNDQTELAINEAHLILFL--IDSKAGITPYDHAITSFLRKKNIPIIIVSNK 120
             +  + K+   +T L +  A LIL L  I+SK  I        SF   KNI  I +  K
Sbjct: 280 TDDI-VEKEGIKRTFLEVENADLILLLKEINSKKEI--------SF--PKNIDFIFIGTK 328

Query: 121 MDTRIAQRNFYEIYSLDFKEIVEISAEHDLGTSELHSVIFKIFKQKYPNHPLEMIENNKR 180
            D        Y  Y+ ++  +  IS+    G  EL + I  I   K+   P   I ++KR
Sbjct: 329 SD-------LYSTYTEEYDHL--ISSFTGEGLEELINKIKSILSNKFKKLPFS-IPSHKR 378

Query: 181 N 181
           +
Sbjct: 379 H 379

>gi|254780809|ref|YP_003065222.1| tRNA modification GTPase TrmE [Candidatus Liberibacter asiaticus str. psy62] Length = 440 Back     alignment
 Score = 47.8 bits (112), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 49/88 (55%), Gaps = 3/88 (3%)

Query: 205 RIAVVGRPNVGKSTLINRLLGYNRLLTGSQSGITRDSVSISWNWKNHPIEIFDTAGMRKP 264
           +I ++G  N GKS+L N L   +  +     G TRD ++I  + + + ++I DTAG+R+ 
Sbjct: 221 KIVILGHSNAGKSSLFNALAKKDVAIVTDIPGTTRDVLTIDLDLEGYLVKISDTAGIRET 280

Query: 265 SRITESLEQKTVKKSMQSVRTCETTIVL 292
             I   +E++ +K++   V   +  ++L
Sbjct: 281 DDI---VEKEGIKRTFLEVENADLILLL 305

>gi|254780941|ref|YP_003065354.1| GTP-binding protein Era [Candidatus Liberibacter asiaticus str. psy62] Length = 311 Back     alignment
 Score = 51.6 bits (122), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 66/131 (50%), Gaps = 13/131 (9%)

Query: 4   TIAIVGAPNVGKSTLFNRLVKKKMAVVGNHPGITRDRLYGQAIINGVIFN------IVDT 57
            +A+VGA N GKSTL NR V  K+++V +    TR      +I+ G++         +DT
Sbjct: 24  CVALVGATNAGKSTLVNRFVGAKVSIVTHKVQTTR------SIVRGIVSEKESQIVFLDT 77

Query: 58  AGIADGKNCSIAKQMNDQTELAINEAHLILFLIDSKAGITPYDHAITSFLRKKNIPIIIV 117
            GI + K+ S  K M   +   I  A ++  ++DS   +    H +   + K++  +I++
Sbjct: 78  PGIFNAKD-SYHKLMIRLSWSTIKHADIVCLVVDSHRELKVNIHDLLKEIAKRSSRLILI 136

Query: 118 SNKMDTRIAQR 128
            NK+D    +R
Sbjct: 137 LNKIDCVKPER 147

>gi|254780941|ref|YP_003065354.1| GTP-binding protein Era [Candidatus Liberibacter asiaticus str. psy62] Length = 311 Back     alignment
 Score = 43.1 bits (100), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 42/177 (23%), Positives = 78/177 (44%), Gaps = 8/177 (4%)

Query: 192 EGKSSVKNISKPLRIAVVGRPNVGKSTLINRLLGYNRLLTGSQSGITRDSVSISWNWKNH 251
           E K  V++ S+   +A+VG  N GKSTL+NR +G    +   +   TR  V    + K  
Sbjct: 11  EHKDFVQDNSRSGCVALVGATNAGKSTLVNRFVGAKVSIVTHKVQTTRSIVRGIVSEKES 70

Query: 252 PIEIFDTAGMRKPSRITESLEQKTVKKSMQSVRTCETTIVLLDATIPFEKQDLRIVDSVF 311
            I   DT G+       +S  +  ++ S  +++  +   +++D+    +     ++  + 
Sbjct: 71  QIVFLDTPGIFNAK---DSYHKLMIRLSWSTIKHADIVCLVVDSHRELKVNIHDLLKEIA 127

Query: 312 NTGHAVVLALNKWDMVSDKLNLLQDLRTKAIKNLPQIGDIYINTISGRTGEGLDDLM 368
                ++L LNK D V  +  L Q    +    L  I   ++  +S   G G DD++
Sbjct: 128 KRSSRLILILNKIDCVKPERLLEQ---AEIANKLVFIEKTFM--VSATKGHGCDDVL 179

>gi|254780321|ref|YP_003064734.1| GTP-binding protein LepA [Candidatus Liberibacter asiaticus str. psy62] Length = 606 Back     alignment
 Score = 45.8 bits (107), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 53/221 (23%), Positives = 95/221 (42%), Gaps = 44/221 (19%)

Query: 200 ISKPLRIAVVGRPNVGKSTLINRLLGYNRLLTGSQ--------------SGITRDSVSIS 245
           +S+    ++V   + GKSTL +R + + R LT  +               GIT  + ++ 
Sbjct: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67

Query: 246 WNW-----KNHPIEIFDTAGMRKPSRITESLEQKTVKKSMQSVRTCETTIVLLDATIPFE 300
            N+     K++ + + DT     P  +  + E   V +S+ +   CE +++++DAT   E
Sbjct: 68  LNYTSTDAKDYQLNLIDT-----PGHVDFTYE---VSRSLSA---CEGSLLVVDATQGVE 116

Query: 301 KQDLRIVDSVFNTGHAVVLALNKWDMVSDKLNLLQDLRTKAIKNLPQIGDIYINTISGRT 360
            Q L  V    +  H ++  LNK D+ S       D   K I+    I       +S +T
Sbjct: 117 AQTLANVYQAIDNNHEIITVLNKADLPSAD----PDRVKKQIEETIGISTEDALLVSAKT 172

Query: 361 GEGLDDLMVSVLE----------INKLWKTRITTSYLNSWL 391
           GEG+  L+  +++           N   K  +  S+ NS+L
Sbjct: 173 GEGIPLLLERIVQQLPSPTSPEGANAPLKALLIDSWYNSYL 213

>gi|254780484|ref|YP_003064897.1| GTPase EngB [Candidatus Liberibacter asiaticus str. psy62] Length = 212 Back     alignment
 Score = 41.6 bits (96), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 41/134 (30%), Positives = 60/134 (44%), Gaps = 21/134 (15%)

Query: 5   IAIVGAPNVGKSTLFNRLVKKK-MAVVGNHPGITRD------RLYGQAIINGVIFNIVDT 57
           IA  G  NVGKS+L N LV +K +A   N PG T+       + +     N     +VD 
Sbjct: 32  IAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDM 91

Query: 58  AGI----ADGKNCS-----IAKQMNDQTELAINEAHLILFLIDSKAGITPYDHAITSFLR 108
            G     A  KN       I + +++++ L       +  LID + G+   D  + SFL 
Sbjct: 92  PGYGYARAPKKNVDSWGGLIVRYLSERSTL-----RCVYLLIDCRHGVKQIDQDVFSFLD 146

Query: 109 KKNIPIIIVSNKMD 122
           KK +   IV  K+D
Sbjct: 147 KKAVSYQIVLTKID 160

>gi|254780226|ref|YP_003064639.1| translation-associated GTPase [Candidatus Liberibacter asiaticus str. psy62] Length = 367 Back     alignment
 Score = 40.0 bits (92), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 18/37 (48%), Positives = 22/37 (59%)

Query: 1  MIYTIAIVGAPNVGKSTLFNRLVKKKMAVVGNHPGIT 37
          M +   I+G PNVGKSTLFN L +   A   N+P  T
Sbjct: 1  MGFKCGIIGLPNVGKSTLFNALTRTASAQAANYPFCT 37

>gi|254780264|ref|YP_003064677.1| elongation factor G [Candidatus Liberibacter asiaticus str. psy62] Length = 701 Back     alignment
 Score = 31.6 bits (70), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 34/80 (42%), Gaps = 11/80 (13%)

Query: 52  FNIVDTAGIADGKNCSIAKQMNDQTELAINEAHLILFLIDSKAGITPYDHAITSFLRKKN 111
             I+DT G  D            + E +I      + L+DS AG+ P    +     K +
Sbjct: 82  LTIIDTPGHVD---------FTMEVERSIRVTDGAIALLDSNAGVEPQTETVWRQADKYS 132

Query: 112 IPIIIVSNKMDTRIAQRNFY 131
           +P +I  NKMD   A  +FY
Sbjct: 133 VPRVIFCNKMDKMGA--DFY 150

>gi|254780233|ref|YP_003064646.1| GTP-binding protein [Candidatus Liberibacter asiaticus str. psy62] Length = 624 Back     alignment
 Score = 31.2 bits (69), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 38/152 (25%), Positives = 59/152 (38%), Gaps = 26/152 (17%)

Query: 2   IYTIAIVGAPNVGKSTLFNRLVKKKMAVVGNHP---------------GITRDRLYGQAI 46
           I  IAI+   + GK+TL + L+K+      N                 GIT        +
Sbjct: 19  IRNIAIIAHVDHGKTTLVDELLKQSGVFRDNQRVSERVMDCNDLEKERGITILAKVTSIV 78

Query: 47  INGVIFNIVDTAGIADGKNCSIAKQMNDQTELAINEAHLILFLIDSKAGITPYDHAITSF 106
            N V  NIVDT G AD            + E  +     ++ L+D+  G  P    +   
Sbjct: 79  WNDVRINIVDTPGHAD---------FGGEVERILCMVESVVVLVDAAEGPMPQTKFVVGK 129

Query: 107 LRKKNIPIIIVSNKMDTRIAQRN--FYEIYSL 136
             K  +  I+V NK+D   A+ +    E++ L
Sbjct: 130 ALKIGLRPIVVVNKVDRSDARADEVINEVFDL 161

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target470 GTP-binding protein EngA [Candidatus Liberibacter asiat
315122134448 GTP-binding protein EngA [Candidatus Liberibacter solan 1 0.0
190892852473 GTP-binding protein [Rhizobium etli CIAT 652] Length = 1 1e-133
327189207473 GTP-binding protein [Rhizobium etli CNPAF512] Length = 1 1e-132
86358709473 GTP-binding protein EngA [Rhizobium etli CFN 42] Length 1 1e-132
307307991476 ribosome-associated GTPase EngA [Sinorhizobium meliloti 1 1e-131
16264869476 GTP-binding protein EngA [Sinorhizobium meliloti 1021] 1 1e-130
116253295473 GTP-binding protein EngA [Rhizobium leguminosarum bv. v 1 1e-130
241205814474 GTP-binding protein EngA [Rhizobium leguminosarum bv. t 1 1e-130
209550425473 GTP-binding protein EngA [Rhizobium leguminosarum bv. t 1 1e-130
222086678475 GTP-binding protein [Agrobacterium radiobacter K84] Len 1 1e-130
>gi|315122134|ref|YP_004062623.1| GTP-binding protein EngA [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 448 Back     alignment and organism information
 Score =  667 bits (1721), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/448 (73%), Positives = 379/448 (84%), Gaps = 4/448 (0%)

Query: 27  MAVVGNHPGITRDRLYGQAIINGVIFNIVDTAGIADGKNCSIAKQMNDQTELAINEAHLI 86
           MA+VG+ PG+TRDRLYG+AIING  FN++DTAGI +  +  IAKQ NDQTE+AI+EAHL 
Sbjct: 1   MAIVGDCPGMTRDRLYGKAIINGFEFNVIDTAGIENENSHFIAKQTNDQTEIAIDEAHLA 60

Query: 87  LFLIDSKAGITPYDHAITSFLRKKNIPIIIVSNKMDTRIAQRNFYEIYSLDFKEIVEISA 146
           LFLIDSK+GITPYDH I  FLRKKNIPIIIVSNKM+T IAQRNF++IYS  FKEIVEISA
Sbjct: 61  LFLIDSKSGITPYDHLIAKFLRKKNIPIIIVSNKMETHIAQRNFHDIYSFGFKEIVEISA 120

Query: 147 EHDLGTSELHSVIFKIFKQKYPNHPLEMIENNKRNEESPKENITSEGK--SSVKNI-SKP 203
           EH +G S+L+SVI K+FKQ+YP++ LE+ EN  + + S  +NI  EGK  +   NI SKP
Sbjct: 121 EHGIGISDLYSVIIKLFKQQYPDYQLEIKENPTKTKTSQDKNILIEGKEPTDSSNISSKP 180

Query: 204 LRIAVVGRPNVGKSTLINRLLGYNRLLTGSQSGITRDSVSISWNWKNHPIEIFDTAGMRK 263
           LRIAVVGRPNVGKSTLINRLLGYNR+L G ++G TRDS+ ISW WKNHPI+IFDTAGMRK
Sbjct: 181 LRIAVVGRPNVGKSTLINRLLGYNRVLIGPKAGTTRDSIPISWEWKNHPIKIFDTAGMRK 240

Query: 264 PSRITESLEQKTVKKSMQSVRTCETTIVLLDATIPFEKQDLRIVDSVFNTGHAVVLALNK 323
           PSRI E +E+K+V KSMQS+R CETTIVLLDAT+PFEKQDLRIVDSV NTG A VLA NK
Sbjct: 241 PSRIIEQVEKKSVTKSMQSIRVCETTIVLLDATVPFEKQDLRIVDSVINTGRAAVLAFNK 300

Query: 324 WDMV-SDKLNLLQDLRTKAIKNLPQIGDIYINTISGRTGEGLDDLMVSVLEINKLWKTRI 382
           WD+V +DK  LLQ+LR KA  NLPQ G+I I  ISG TGEGLD+LM SVLEINKLWKTRI
Sbjct: 301 WDLVTTDKSILLQNLRIKATNNLPQAGNIRIEAISGHTGEGLDNLMASVLEINKLWKTRI 360

Query: 383 TTSYLNSWLQKTQLQNPPPTIFNRYNRLKYITQIQSSPPSFLIFCTFPNKIPESYKRYLI 442
           +TS LNSWL++TQL+NPPPTI  RY+RLKYITQ QSSPPSF+IFC  P +IPESYKRYLI
Sbjct: 361 STSRLNSWLEQTQLKNPPPTIAGRYHRLKYITQTQSSPPSFVIFCNSPKEIPESYKRYLI 420

Query: 443 NRLRINFSLSGIPIRMCFQSSKNPYIKK 470
           NRLR +FSLSGIPIR+ FQSSKNPYIKK
Sbjct: 421 NRLRFDFSLSGIPIRIRFQSSKNPYIKK 448


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|190892852|ref|YP_001979394.1| GTP-binding protein [Rhizobium etli CIAT 652] Length = 473 Back     alignment and organism information
>gi|327189207|gb|EGE56387.1| GTP-binding protein [Rhizobium etli CNPAF512] Length = 473 Back     alignment and organism information
>gi|86358709|ref|YP_470601.1| GTP-binding protein EngA [Rhizobium etli CFN 42] Length = 473 Back     alignment and organism information
>gi|307307991|ref|ZP_07587709.1| ribosome-associated GTPase EngA [Sinorhizobium meliloti BL225C] Length = 476 Back     alignment and organism information
>gi|16264869|ref|NP_437661.1| GTP-binding protein EngA [Sinorhizobium meliloti 1021] Length = 476 Back     alignment and organism information
>gi|116253295|ref|YP_769133.1| GTP-binding protein EngA [Rhizobium leguminosarum bv. viciae 3841] Length = 473 Back     alignment and organism information
>gi|241205814|ref|YP_002976910.1| GTP-binding protein EngA [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 474 Back     alignment and organism information
>gi|209550425|ref|YP_002282342.1| GTP-binding protein EngA [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 473 Back     alignment and organism information
>gi|222086678|ref|YP_002545212.1| GTP-binding protein [Agrobacterium radiobacter K84] Length = 475 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target470 GTP-binding protein EngA [Candidatus Liberibacter asiat
PRK00093435 PRK00093, PRK00093, GTP-binding protein Der; Reviewed 1e-146
TIGR03594429 TIGR03594, GTPase_EngA, ribosome-associated GTPase EngA 1e-141
PRK03003472 PRK03003, PRK03003, GTP-binding protein Der; Reviewed 2e-76
PRK09518712 PRK09518, PRK09518, bifunctional cytidylate kinase/GTPa 2e-72
KOG1191531 KOG1191, KOG1191, KOG1191, Mitochondrial GTPase [Transl 7e-28
COG1160444 COG1160, COG1160, Predicted GTPases [General function p 1e-124
cd01894157 cd01894, EngA1, EngA1 subfamily 1e-53
PRK05291449 PRK05291, trmE, tRNA modification GTPase TrmE; Reviewed 6e-29
PRK00089292 PRK00089, era, GTPase Era; Reviewed 6e-27
cd04164157 cd04164, trmE, TrmE (MnmE, ThdF, MSS1) is a 3-domain pr 7e-27
cd04163168 cd04163, Era, Era subfamily 5e-25
COG1159298 COG1159, Era, GTPase [General function prediction only] 6e-25
cd01895174 cd01895, EngA2, EngA2 subfamily 1e-24
COG0486454 COG0486, ThdF, Predicted GTPase [General function predi 2e-23
cd00880163 cd00880, Era_like, Era (E 1e-19
TIGR00231161 TIGR00231, small_GTP, small GTP-binding protein domain 6e-19
TIGR00436270 TIGR00436, era, GTP-binding protein Era 1e-16
cd01876170 cd01876, YihA_EngB, The YihA (EngB) subfamily 2e-13
pfam02421188 pfam02421, FeoB_N, Ferrous iron transport protein B 5e-13
cd01881176 cd01881, Obg_like, The Obg-like subfamily consists of f 2e-12
cd01879158 cd01879, FeoB, Ferrous iron transport protein B (FeoB) 3e-11
cd00882157 cd00882, Ras_like_GTPase, Ras-like GTPase superfamily 4e-11
COG0218200 COG0218, COG0218, Predicted GTPase [General function pr 9e-11
TIGR00437 591 TIGR00437, feoB, ferrous iron transporter FeoB 2e-10
cd01897168 cd01897, NOG, NOG1 is a nucleolar GTP-binding protein p 4e-09
PRK00454196 PRK00454, engB, GTP-binding protein YsxC; Reviewed 4e-09
COG1084346 COG1084, COG1084, Predicted GTPase [General function pr 6e-08
cd00881189 cd00881, GTP_translation_factor, GTP translation factor 1e-07
COG2262411 COG2262, HflX, GTPases [General function prediction onl 1e-07
KOG0395196 KOG0395, KOG0395, KOG0395, Ras-related GTPase [General 8e-07
COG1163365 COG1163, DRG, Predicted GTPase [General function predic 1e-06
KOG1489366 KOG1489, KOG1489, KOG1489, Predicted GTP-binding protei 3e-06
COG1100219 COG1100, COG1100, GTPase SAR1 and related small G prote 4e-06
cd01898170 cd01898, Obg, Obg subfamily 3e-05
pfam00009185 pfam00009, GTP_EFTU, Elongation factor Tu GTP binding d 9e-05
PRK09554 772 PRK09554, feoB, ferrous iron transport protein B; Revie 9e-05
cd04170268 cd04170, EF-G_bact, Elongation factor G (EF-G) subfamil 0.002
TIGR02729329 TIGR02729, Obg_CgtA, Obg family GTPase CgtA 0.002
cd01895174 cd01895, EngA2, EngA2 subfamily 2e-49
COG0486454 COG0486, ThdF, Predicted GTPase [General function predi 4e-25
cd04164157 cd04164, trmE, TrmE (MnmE, ThdF, MSS1) is a 3-domain pr 1e-23
PRK05291449 PRK05291, trmE, tRNA modification GTPase TrmE; Reviewed 1e-23
COG1160 444 COG1160, COG1160, Predicted GTPases [General function p 6e-20
TIGR00450442 TIGR00450, mnmE_trmE_thdF, tRNA modification GTPase Trm 8e-20
cd00880163 cd00880, Era_like, Era (E 2e-19
cd01894157 cd01894, EngA1, EngA1 subfamily 4e-18
PRK00089292 PRK00089, era, GTPase Era; Reviewed 7e-18
cd04163168 cd04163, Era, Era subfamily 1e-17
COG1159298 COG1159, Era, GTPase [General function prediction only] 2e-17
TIGR00231161 TIGR00231, small_GTP, small GTP-binding protein domain 3e-12
COG0370 653 COG0370, FeoB, Fe2+ transport system protein B [Inorgan 9e-12
COG0218200 COG0218, COG0218, Predicted GTPase [General function pr 2e-11
PRK15494339 PRK15494, era, GTPase Era; Provisional 3e-11
cd01876170 cd01876, YihA_EngB, The YihA (EngB) subfamily 2e-10
KOG1423379 KOG1423, KOG1423, KOG1423, Ras-like GTPase ERA [Cell cy 4e-08
cd01879158 cd01879, FeoB, Ferrous iron transport protein B (FeoB) 8e-08
TIGR00437 591 TIGR00437, feoB, ferrous iron transporter FeoB 9e-08
cd00882157 cd00882, Ras_like_GTPase, Ras-like GTPase superfamily 1e-07
pfam02421188 pfam02421, FeoB_N, Ferrous iron transport protein B 1e-06
cd00881189 cd00881, GTP_translation_factor, GTP translation factor 7e-06
KOG2486320 KOG2486, KOG2486, KOG2486, Predicted GTPase [General fu 1e-05
PRK00454196 PRK00454, engB, GTP-binding protein YsxC; Reviewed 1e-05
TIGR03598179 TIGR03598, GTPase_YsxC, ribosome biogenesis GTP-binding 1e-05
COG2262411 COG2262, HflX, GTPases [General function prediction onl 2e-05
pfam00009185 pfam00009, GTP_EFTU, Elongation factor Tu GTP binding d 2e-05
COG3596296 COG3596, COG3596, Predicted GTPase [General function pr 1e-04
TIGR03156351 TIGR03156, GTP_HflX, GTP-binding protein HflX 0.002
COG0481 603 COG0481, LepA, Membrane GTPase LepA [Cell envelope biog 0.003
KOG0467 887 KOG0467, KOG0467, KOG0467, Translation elongation facto 0.004
pfam01926106 pfam01926, MMR_HSR1, GTPase of unknown function 4e-24
TIGR00450442 TIGR00450, mnmE_trmE_thdF, tRNA modification GTPase Trm 1e-20
PRK15494339 PRK15494, era, GTPase Era; Provisional 3e-09
KOG1423379 KOG1423, KOG1423, KOG1423, Ras-like GTPase ERA [Cell cy 4e-08
TIGR03598179 TIGR03598, GTPase_YsxC, ribosome biogenesis GTP-binding 8e-07
cd00876160 cd00876, Ras, Ras family 9e-07
cd04146165 cd04146, RERG_RasL11_like, RERG/RasL11-like subfamily 1e-05
pfam08477118 pfam08477, Miro, Miro-like protein 1e-05
PRK04213201 PRK04213, PRK04213, GTP-binding protein; Provisional 2e-05
cd01896233 cd01896, DRG, The developmentally regulated GTP-binding 6e-05
KOG1490620 KOG1490, KOG1490, KOG1490, GTP-binding protein CRFG/NOG 1e-04
cd04138162 cd04138, H_N_K_Ras_like, H-Ras/N-Ras/K-Ras subfamily 0.001
COG4108528 COG4108, PrfC, Peptide chain release factor RF-3 [Trans 0.002
smart00173164 smart00173, RAS, Ras subfamily of RAS small GTPases 0.002
cd04137180 cd04137, RheB, Rheb (Ras Homolog Enriched in Brain) sub 0.004
cd04105203 cd04105, SR_beta, Signal recognition particle receptor, 0.004
pfam01926106 pfam01926, MMR_HSR1, GTPase of unknown function 3e-17
TIGR00436270 TIGR00436, era, GTP-binding protein Era 4e-08
COG1163365 COG1163, DRG, Predicted GTPase [General function predic 0.002
cd01896233 cd01896, DRG, The developmentally regulated GTP-binding 0.004
COG0370 653 COG0370, FeoB, Fe2+ transport system protein B [Inorgan 1e-12
COG1161322 COG1161, COG1161, Predicted GTPases [General function p 1e-07
COG0536369 COG0536, Obg, Predicted GTPase [General function predic 2e-06
COG3596296 COG3596, COG3596, Predicted GTPase [General function pr 5e-05
TIGR03596276 TIGR03596, GTPase_YlqF, ribosome biogenesis GTP-binding 2e-12
COG1161322 COG1161, COG1161, Predicted GTPases [General function p 1e-09
cd01859156 cd01859, MJ1464, MJ1464 1e-07
cd01849155 cd01849, YlqF_related_GTPase, YlqF-related GTPases 2e-07
cd01854287 cd01854, YjeQ_engC, YjeQ/EngC 5e-04
PRK00098298 PRK00098, PRK00098, GTPase RsgA; Reviewed 6e-04
KOG1424562 KOG1424, KOG1424, KOG1424, Predicted GTP-binding protei 0.001
PRK13796365 PRK13796, PRK13796, GTPase YqeH; Provisional 0.001
cd01855190 cd01855, YqeH, YqeH 0.002
cd01856171 cd01856, YlqF, YlqF 5e-12
TIGR03596276 TIGR03596, GTPase_YlqF, ribosome biogenesis GTP-binding 2e-10
cd01856171 cd01856, YlqF, YlqF 5e-10
PRK09563287 PRK09563, rbgA, GTPase YlqF; Reviewed 5e-10
COG0012372 COG0012, COG0012, Predicted GTPase, probable translatio 3e-05
cd04178172 cd04178, Nucleostemin_like, Nucleostemin-like 4e-05
KOG2484435 KOG2484, KOG2484, KOG2484, GTPase [General function pre 6e-05
PRK09601364 PRK09601, PRK09601, GTP-binding protein YchF; Reviewed 6e-05
KOG2485335 KOG2485, KOG2485, KOG2485, Conserved ATP/GTP binding pr 1e-04
cd01857141 cd01857, HSR1_MMR1, HSR1/MMR1 2e-04
cd01849155 cd01849, YlqF_related_GTPase, YlqF-related GTPases 6e-04
cd01855190 cd01855, YqeH, YqeH 6e-04
KOG1491391 KOG1491, KOG1491, KOG1491, Predicted GTP-binding protei 6e-04
KOG1424562 KOG1424, KOG1424, KOG1424, Predicted GTP-binding protei 0.001
PRK09602396 PRK09602, PRK09602, translation-associated GTPase; Revi 0.001
PTZ00258390 PTZ00258, PTZ00258, GTP-binding protein; Provisional 0.001
PRK09563287 PRK09563, rbgA, GTPase YlqF; Reviewed 9e-10
cd04178172 cd04178, Nucleostemin_like, Nucleostemin-like 6e-05
pfam04548200 pfam04548, AIG1, AIG1 family 9e-05
KOG2484435 KOG2484, KOG2484, KOG2484, GTPase [General function pre 0.001
PRK04213201 PRK04213, PRK04213, GTP-binding protein; Provisional 0.001
PRK01889356 PRK01889, PRK01889, GTPase RsgA; Reviewed 0.001
cd01852196 cd01852, AIG1, AIG1 (avrRpt2-induced gene 1) 0.002
PRK09554 772 PRK09554, feoB, ferrous iron transport protein B; Revie 0.002
TIGR02768744 TIGR02768, TraA_Ti, Ti-type conjugative transfer relaxa 0.003
cd01900274 cd01900, YchF, YchF subfamily 2e-04
cd01878204 cd01878, HflX, HflX subfamily 0.001
TIGR03156351 TIGR03156, GTP_HflX, GTP-binding protein HflX 0.002
COG4988559 COG4988, CydD, ABC-type transport system involved in cy 0.001
PRK09602396 PRK09602, PRK09602, translation-associated GTPase; Revi 0.001
>gnl|CDD|178858 PRK00093, PRK00093, GTP-binding protein Der; Reviewed Back     alignment and domain information
>gnl|CDD|163343 TIGR03594, GTPase_EngA, ribosome-associated GTPase EngA Back     alignment and domain information
>gnl|CDD|179525 PRK03003, PRK03003, GTP-binding protein Der; Reviewed Back     alignment and domain information
>gnl|CDD|181925 PRK09518, PRK09518, bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>gnl|CDD|36405 KOG1191, KOG1191, KOG1191, Mitochondrial GTPase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|31354 COG1160, COG1160, Predicted GTPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|133294 cd01894, EngA1, EngA1 subfamily Back     alignment and domain information
>gnl|CDD|179996 PRK05291, trmE, tRNA modification GTPase TrmE; Reviewed Back     alignment and domain information
>gnl|CDD|178854 PRK00089, era, GTPase Era; Reviewed Back     alignment and domain information
>gnl|CDD|133364 cd04164, trmE, TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes Back     alignment and domain information
>gnl|CDD|133363 cd04163, Era, Era subfamily Back     alignment and domain information
>gnl|CDD|31353 COG1159, Era, GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|133295 cd01895, EngA2, EngA2 subfamily Back     alignment and domain information
>gnl|CDD|30833 COG0486, ThdF, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|133256 cd00880, Era_like, Era (E Back     alignment and domain information
>gnl|CDD|161778 TIGR00231, small_GTP, small GTP-binding protein domain Back     alignment and domain information
>gnl|CDD|129528 TIGR00436, era, GTP-binding protein Era Back     alignment and domain information
>gnl|CDD|133278 cd01876, YihA_EngB, The YihA (EngB) subfamily Back     alignment and domain information
>gnl|CDD|145523 pfam02421, FeoB_N, Ferrous iron transport protein B Back     alignment and domain information
>gnl|CDD|133281 cd01881, Obg_like, The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1 Back     alignment and domain information
>gnl|CDD|133280 cd01879, FeoB, Ferrous iron transport protein B (FeoB) subfamily Back     alignment and domain information
>gnl|CDD|133258 cd00882, Ras_like_GTPase, Ras-like GTPase superfamily Back     alignment and domain information
>gnl|CDD|30567 COG0218, COG0218, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|161878 TIGR00437, feoB, ferrous iron transporter FeoB Back     alignment and domain information
>gnl|CDD|133297 cd01897, NOG, NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans Back     alignment and domain information
>gnl|CDD|179035 PRK00454, engB, GTP-binding protein YsxC; Reviewed Back     alignment and domain information
>gnl|CDD|31281 COG1084, COG1084, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|133257 cd00881, GTP_translation_factor, GTP translation factor family Back     alignment and domain information
>gnl|CDD|32443 COG2262, HflX, GTPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|35616 KOG0395, KOG0395, KOG0395, Ras-related GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|31357 COG1163, DRG, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|36702 KOG1489, KOG1489, KOG1489, Predicted GTP-binding protein (ODN superfamily) [General function prediction only] Back     alignment and domain information
>gnl|CDD|31297 COG1100, COG1100, GTPase SAR1 and related small G proteins [General function prediction only] Back     alignment and domain information
>gnl|CDD|133298 cd01898, Obg, Obg subfamily Back     alignment and domain information
>gnl|CDD|143801 pfam00009, GTP_EFTU, Elongation factor Tu GTP binding domain Back     alignment and domain information
>gnl|CDD|181948 PRK09554, feoB, ferrous iron transport protein B; Reviewed Back     alignment and domain information
>gnl|CDD|133370 cd04170, EF-G_bact, Elongation factor G (EF-G) subfamily Back     alignment and domain information
>gnl|CDD|162989 TIGR02729, Obg_CgtA, Obg family GTPase CgtA Back     alignment and domain information
>gnl|CDD|133295 cd01895, EngA2, EngA2 subfamily Back     alignment and domain information
>gnl|CDD|30833 COG0486, ThdF, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|133364 cd04164, trmE, TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes Back     alignment and domain information
>gnl|CDD|179996 PRK05291, trmE, tRNA modification GTPase TrmE; Reviewed Back     alignment and domain information
>gnl|CDD|31354 COG1160, COG1160, Predicted GTPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|161885 TIGR00450, mnmE_trmE_thdF, tRNA modification GTPase TrmE Back     alignment and domain information
>gnl|CDD|133256 cd00880, Era_like, Era (E Back     alignment and domain information
>gnl|CDD|133294 cd01894, EngA1, EngA1 subfamily Back     alignment and domain information
>gnl|CDD|178854 PRK00089, era, GTPase Era; Reviewed Back     alignment and domain information
>gnl|CDD|133363 cd04163, Era, Era subfamily Back     alignment and domain information
>gnl|CDD|31353 COG1159, Era, GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|161778 TIGR00231, small_GTP, small GTP-binding protein domain Back     alignment and domain information
>gnl|CDD|30719 COG0370, FeoB, Fe2+ transport system protein B [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|30567 COG0218, COG0218, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|185391 PRK15494, era, GTPase Era; Provisional Back     alignment and domain information
>gnl|CDD|133278 cd01876, YihA_EngB, The YihA (EngB) subfamily Back     alignment and domain information
>gnl|CDD|36637 KOG1423, KOG1423, KOG1423, Ras-like GTPase ERA [Cell cycle control, cell division, chromosome partitioning, Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|133280 cd01879, FeoB, Ferrous iron transport protein B (FeoB) subfamily Back     alignment and domain information
>gnl|CDD|161878 TIGR00437, feoB, ferrous iron transporter FeoB Back     alignment and domain information
>gnl|CDD|133258 cd00882, Ras_like_GTPase, Ras-like GTPase superfamily Back     alignment and domain information
>gnl|CDD|145523 pfam02421, FeoB_N, Ferrous iron transport protein B Back     alignment and domain information
>gnl|CDD|133257 cd00881, GTP_translation_factor, GTP translation factor family Back     alignment and domain information
>gnl|CDD|37697 KOG2486, KOG2486, KOG2486, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|179035 PRK00454, engB, GTP-binding protein YsxC; Reviewed Back     alignment and domain information
>gnl|CDD|163346 TIGR03598, GTPase_YsxC, ribosome biogenesis GTP-binding protein YsxC/EngB Back     alignment and domain information
>gnl|CDD|32443 COG2262, HflX, GTPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|143801 pfam00009, GTP_EFTU, Elongation factor Tu GTP binding domain Back     alignment and domain information
>gnl|CDD|33396 COG3596, COG3596, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|163162 TIGR03156, GTP_HflX, GTP-binding protein HflX Back     alignment and domain information
>gnl|CDD|30829 COG0481, LepA, Membrane GTPase LepA [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|35688 KOG0467, KOG0467, KOG0467, Translation elongation factor 2/ribosome biogenesis protein RIA1 and related proteins [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|145217 pfam01926, MMR_HSR1, GTPase of unknown function Back     alignment and domain information
>gnl|CDD|161885 TIGR00450, mnmE_trmE_thdF, tRNA modification GTPase TrmE Back     alignment and domain information
>gnl|CDD|185391 PRK15494, era, GTPase Era; Provisional Back     alignment and domain information
>gnl|CDD|36637 KOG1423, KOG1423, KOG1423, Ras-like GTPase ERA [Cell cycle control, cell division, chromosome partitioning, Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|163346 TIGR03598, GTPase_YsxC, ribosome biogenesis GTP-binding protein YsxC/EngB Back     alignment and domain information
>gnl|CDD|133252 cd00876, Ras, Ras family Back     alignment and domain information
>gnl|CDD|133346 cd04146, RERG_RasL11_like, RERG/RasL11-like subfamily Back     alignment and domain information
>gnl|CDD|149505 pfam08477, Miro, Miro-like protein Back     alignment and domain information
>gnl|CDD|179790 PRK04213, PRK04213, GTP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|133296 cd01896, DRG, The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins Back     alignment and domain information
>gnl|CDD|36703 KOG1490, KOG1490, KOG1490, GTP-binding protein CRFG/NOG1 (ODN superfamily) [General function prediction only] Back     alignment and domain information
>gnl|CDD|133338 cd04138, H_N_K_Ras_like, H-Ras/N-Ras/K-Ras subfamily Back     alignment and domain information
>gnl|CDD|33865 COG4108, PrfC, Peptide chain release factor RF-3 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|128470 smart00173, RAS, Ras subfamily of RAS small GTPases Back     alignment and domain information
>gnl|CDD|133337 cd04137, RheB, Rheb (Ras Homolog Enriched in Brain) subfamily Back     alignment and domain information
>gnl|CDD|133305 cd04105, SR_beta, Signal recognition particle receptor, beta subunit (SR-beta) Back     alignment and domain information
>gnl|CDD|145217 pfam01926, MMR_HSR1, GTPase of unknown function Back     alignment and domain information
>gnl|CDD|129528 TIGR00436, era, GTP-binding protein Era Back     alignment and domain information
>gnl|CDD|31357 COG1163, DRG, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|133296 cd01896, DRG, The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins Back     alignment and domain information
>gnl|CDD|30719 COG0370, FeoB, Fe2+ transport system protein B [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|31355 COG1161, COG1161, Predicted GTPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|30882 COG0536, Obg, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|33396 COG3596, COG3596, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|163345 TIGR03596, GTPase_YlqF, ribosome biogenesis GTP-binding protein YlqF Back     alignment and domain information
>gnl|CDD|31355 COG1161, COG1161, Predicted GTPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|57930 cd01859, MJ1464, MJ1464 Back     alignment and domain information
>gnl|CDD|57924 cd01849, YlqF_related_GTPase, YlqF-related GTPases Back     alignment and domain information
>gnl|CDD|57925 cd01854, YjeQ_engC, YjeQ/EngC Back     alignment and domain information
>gnl|CDD|178861 PRK00098, PRK00098, GTPase RsgA; Reviewed Back     alignment and domain information
>gnl|CDD|36638 KOG1424, KOG1424, KOG1424, Predicted GTP-binding protein MMR1 [General function prediction only] Back     alignment and domain information
>gnl|CDD|184332 PRK13796, PRK13796, GTPase YqeH; Provisional Back     alignment and domain information
>gnl|CDD|57926 cd01855, YqeH, YqeH Back     alignment and domain information
>gnl|CDD|57927 cd01856, YlqF, YlqF Back     alignment and domain information
>gnl|CDD|163345 TIGR03596, GTPase_YlqF, ribosome biogenesis GTP-binding protein YlqF Back     alignment and domain information
>gnl|CDD|57927 cd01856, YlqF, YlqF Back     alignment and domain information
>gnl|CDD|181957 PRK09563, rbgA, GTPase YlqF; Reviewed Back     alignment and domain information
>gnl|CDD|30362 COG0012, COG0012, Predicted GTPase, probable translation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|57931 cd04178, Nucleostemin_like, Nucleostemin-like Back     alignment and domain information
>gnl|CDD|37695 KOG2484, KOG2484, KOG2484, GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|181981 PRK09601, PRK09601, GTP-binding protein YchF; Reviewed Back     alignment and domain information
>gnl|CDD|37696 KOG2485, KOG2485, KOG2485, Conserved ATP/GTP binding protein [General function prediction only] Back     alignment and domain information
>gnl|CDD|57928 cd01857, HSR1_MMR1, HSR1/MMR1 Back     alignment and domain information
>gnl|CDD|57924 cd01849, YlqF_related_GTPase, YlqF-related GTPases Back     alignment and domain information
>gnl|CDD|57926 cd01855, YqeH, YqeH Back     alignment and domain information
>gnl|CDD|36704 KOG1491, KOG1491, KOG1491, Predicted GTP-binding protein (ODN superfamily) [General function prediction only] Back     alignment and domain information
>gnl|CDD|36638 KOG1424, KOG1424, KOG1424, Predicted GTP-binding protein MMR1 [General function prediction only] Back     alignment and domain information
>gnl|CDD|181982 PRK09602, PRK09602, translation-associated GTPase; Reviewed Back     alignment and domain information
>gnl|CDD|185530 PTZ00258, PTZ00258, GTP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|181957 PRK09563, rbgA, GTPase YlqF; Reviewed Back     alignment and domain information
>gnl|CDD|57931 cd04178, Nucleostemin_like, Nucleostemin-like Back     alignment and domain information
>gnl|CDD|146942 pfam04548, AIG1, AIG1 family Back     alignment and domain information
>gnl|CDD|37695 KOG2484, KOG2484, KOG2484, GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|179790 PRK04213, PRK04213, GTP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|179346 PRK01889, PRK01889, GTPase RsgA; Reviewed Back     alignment and domain information
>gnl|CDD|133261 cd01852, AIG1, AIG1 (avrRpt2-induced gene 1) Back     alignment and domain information
>gnl|CDD|181948 PRK09554, feoB, ferrous iron transport protein B; Reviewed Back     alignment and domain information
>gnl|CDD|163008 TIGR02768, TraA_Ti, Ti-type conjugative transfer relaxase TraA Back     alignment and domain information
>gnl|CDD|133300 cd01900, YchF, YchF subfamily Back     alignment and domain information
>gnl|CDD|133279 cd01878, HflX, HflX subfamily Back     alignment and domain information
>gnl|CDD|163162 TIGR03156, GTP_HflX, GTP-binding protein HflX Back     alignment and domain information
>gnl|CDD|34593 COG4988, CydD, ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|181982 PRK09602, PRK09602, translation-associated GTPase; Reviewed Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 470 GTP-binding protein EngA [Candidatus Liberibacter asiat
PRK09518714 bifunctional cytidylate kinase/GTP-binding protein; Rev 100.0
PRK00093438 engA GTP-binding protein EngA; Reviewed 100.0
COG1160444 Predicted GTPases [General function prediction only] 100.0
PRK03003474 engA GTP-binding protein EngA; Reviewed 100.0
TIGR03594429 GTPase_EngA ribosome-associated GTPase EngA. EngA (YfgK 100.0
KOG1191531 consensus 100.0
TIGR00484 705 EF-G translation elongation factor G; InterPro: IPR0045 99.17
cd01895174 EngA2 EngA2 subfamily. This CD represents the second GT 100.0
PRK00089296 era GTP-binding protein Era; Reviewed 100.0
PRK05291445 trmE tRNA modification GTPase TrmE; Reviewed 100.0
cd01894157 EngA1 EngA1 subfamily. This CD represents the first GTP 100.0
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) is a 100.0
TIGR00450473 thdF tRNA modification GTPase TrmE; InterPro: IPR004520 100.0
PRK00454196 engB GTPase EngB; Reviewed 100.0
cd04164157 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein foun 100.0
pfam02421188 FeoB_N Ferrous iron transport protein B. Escherichia co 100.0
COG1159298 Era GTPase [General function prediction only] 100.0
TIGR03598179 GTPase_YsxC ribosome biogenesis GTP-binding protein Ysx 100.0
cd01876170 YihA_EngB The YihA (EngB) subfamily. This subfamily of 100.0
cd00880163 Era_like Era (E. coli Ras-like protein)-like. This fami 100.0
cd01898170 Obg Obg subfamily. The Obg nucleotide binding protein s 100.0
cd01879158 FeoB Ferrous iron transport protein B (FeoB) subfamily. 100.0
cd01897168 NOG NOG1 is a nucleolar GTP-binding protein present in 99.97
PRK04213195 GTP-binding protein; Provisional 99.97
cd01878204 HflX HflX subfamily. A distinct conserved domain with a 99.97
pfam00009185 GTP_EFTU Elongation factor Tu GTP binding domain. This 99.97
cd04171164 SelB SelB subfamily. SelB is an elongation factor neede 99.97
cd01881176 Obg_like The Obg-like subfamily consists of five well-d 99.97
cd00881189 GTP_translation_factor GTP translation factor family. T 99.96
cd01887168 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic i 99.96
TIGR03156351 GTP_HflX GTP-binding protein HflX. This protein family 99.96
cd01896233 DRG The developmentally regulated GTP-binding protein ( 99.95
PRK11058426 putative GTPase HflX; Provisional 99.94
pfam10662143 PduV-EutP Ethanolamine utilisation - propanediol utilis 99.94
TIGR00437 733 feoB ferrous iron transport protein B; InterPro: IPR003 99.93
COG2262411 HflX GTPases [General function prediction only] 99.93
PRK09554 772 feoB ferrous iron transport protein B; Reviewed 99.93
KOG1423379 consensus 99.92
PRK12299334 obgE GTPase ObgE; Reviewed 99.91
CHL00189 770 infB translation initiation factor 2; Provisional 99.91
cd01890179 LepA LepA subfamily. LepA belongs to the GTPase family 99.91
COG0370 653 FeoB Fe2+ transport system protein B [Inorganic ion tra 99.9
PRK12297429 obgE GTPase ObgE; Reviewed 99.89
COG1084346 Predicted GTPase [General function prediction only] 99.89
COG0218200 Predicted GTPase [General function prediction only] 99.89
PRK12298380 obgE GTPase ObgE; Reviewed 99.89
cd01889192 SelB_euk SelB subfamily. SelB is an elongation factor n 99.88
cd01891194 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA 99.88
PRK05306 839 infB translation initiation factor IF-2; Validated 99.88
cd01884195 EF_Tu EF-Tu subfamily. This subfamily includes ortholog 99.85
KOG1489366 consensus 99.84
PRK12312 610 infB translation initiation factor IF-2; Provisional 99.84
cd01888203 eIF2_gamma eIF2-gamma (gamma subunit of initiation fact 99.83
cd04154173 Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are memb 99.82
pfam00025174 Arf ADP-ribosylation factor family. Pfam combines a num 99.82
COG1163365 DRG Predicted GTPase [General function prediction only] 99.82
cd04166208 CysN_ATPS CysN_ATPS subfamily. CysN, together with prot 99.82
KOG1145 683 consensus 99.81
COG0536369 Obg Predicted GTPase [General function prediction only] 99.8
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf family 99.79
PRK04004 592 translation initiation factor IF-2; Validated 99.78
cd00878158 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) sm 99.77
TIGR01393 598 lepA GTP-binding protein LepA; InterPro: IPR006297 LepA 99.76
pfam00071162 Ras Ras family. Includes sub-families Ras, Rab, Rac, Ra 99.73
cd00154159 Rab Rab family. Rab GTPases form the largest family wit 99.73
cd04159159 Arl10_like Arl10-like subfamily. Arl9/Arl10 was identif 99.73
cd04167213 Snu114p Snu114p subfamily. Snu114p is one of several pr 99.72
PTZ00133182 ADP-ribosylation factor; Provisional 99.72
cd04160167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related protein 1) 99.72
cd04153174 Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) and Ar 99.71
PRK05433 601 GTP-binding protein LepA; Provisional 99.71
COG0532 509 InfB Translation initiation factor 2 (IF-2; GTPase) [Tr 99.71
cd04152183 Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) is hig 99.7
cd04165224 GTPBP1_like GTPBP1-like. Mammalian GTP binding protein 99.7
cd00876160 Ras Ras family. The Ras family of the Ras superfamily i 99.7
smart00177175 ARF ARF-like small GTPases; ARF, ADP-ribosylation facto 99.69
smart00173164 RAS Ras subfamily of RAS small GTPases. Similar in fold 99.69
cd04156160 ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor suppres 99.69
cd01893166 Miro1 Miro1 subfamily. Miro (mitochondrial Rho) protein 99.68
cd04137180 RheB Rheb (Ras Homolog Enriched in Brain) subfamily. Rh 99.68
cd01892169 Miro2 Miro2 subfamily. Miro (mitochondrial Rho) protein 99.68
cd04139164 RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) subfa 99.68
cd04121189 Rab40 Rab40 subfamily. This subfamily contains Rab40a, 99.67
cd04177168 RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the Rap s 99.67
cd04120202 Rab12 Rab12 subfamily. Rab12 was first identified in ca 99.67
cd04145164 M_R_Ras_like M-Ras/R-Ras-like subfamily. This subfamily 99.67
cd04128182 Spg1 Spg1p. Spg1p (septum-promoting GTPase) was first i 99.67
cd04132187 Rho4_like Rho4-like subfamily. Rho4 is a GTPase that co 99.67
cd04149168 Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor 6) p 99.66
cd00882157 Ras_like_GTPase Ras-like GTPase superfamily. The Ras-li 99.66
cd04151158 Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes to the 99.66
cd04136163 Rap_like Rap-like subfamily. The Rap subfamily consists 99.66
cd04176163 Rap2 Rap2 subgroup. The Rap2 subgroup is part of the Ra 99.66
cd04141172 Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like protei 99.66
KOG0410410 consensus 99.66
cd04101164 RabL4 RabL4 (Rab-like4) subfamily. RabL4s are novel pro 99.66
cd04110199 Rab35 Rab35 subfamily. Rab35 is one of several Rab prot 99.66
cd04150159 Arf1_5_like Arf1-Arf5-like subfamily. This subfamily co 99.66
cd04124161 RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily. Rab 99.66
cd01862172 Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase that re 99.65
cd04146165 RERG_RasL11_like RERG/RasL11-like subfamily. RERG (Ras- 99.65
cd04112191 Rab26 Rab26 subfamily. First identified in rat pancreat 99.65
cd04117161 Rab15 Rab15 subfamily. Rab15 colocalizes with the trans 99.65
cd00157171 Rho Rho (Ras homology) family. Members of the Rho famil 99.65
cd04125188 RabA_like RabA-like subfamily. RabA was first identifie 99.65
cd04147198 Ras_dva Ras-dva subfamily. Ras-dva (Ras - dorsal-ventra 99.65
cd04113161 Rab4 Rab4 subfamily. Rab4 has been implicated in numero 99.65
smart00175164 RAB Rab subfamily of small GTPases. Rab GTPases are imp 99.65
cd01869166 Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in every e 99.65
cd04142198 RRP22 RRP22 subfamily. RRP22 (Ras-related protein on ch 99.65
cd01870175 RhoA_like RhoA-like subfamily. The RhoA subfamily consi 99.64
cd04107201 Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38 are 99.64
cd04123162 Rab21 Rab21 subfamily. The localization and function of 99.64
cd01867167 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Ypt2 ar 99.64
cd04114169 Rab30 Rab30 subfamily. Rab30 appears to be associated w 99.64
cd04108170 Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found primari 99.64
cd04122166 Rab14 Rab14 subfamily. Rab14 GTPases are localized to b 99.64
smart00174174 RHO Rho (Ras homology) subfamily of Ras-like small GTPa 99.64
cd04126220 Rab20 Rab20 subfamily. Rab20 is one of several Rab prot 99.64
cd04175164 Rap1 Rap1 subgroup. The Rap1 subgroup is part of the Ra 99.64
cd04118193 Rab24 Rab24 subfamily. Rab24 is distinct from other Rab 99.63
cd01868165 Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 are cl 99.63
cd04140165 ARHI_like ARHI subfamily. ARHI (A Ras homolog member I) 99.63
cd04116170 Rab9 Rab9 subfamily. Rab9 is found in late endosomes, t 99.63
cd04157162 Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a subfamil 99.63
cd04138162 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, N-Ra 99.63
cd01875191 RhoG RhoG subfamily. RhoG is a GTPase with high sequenc 99.63
cd01871174 Rac1_like Rac1-like subfamily. The Rac1-like subfamily 99.63
cd04143247 Rhes_like Rhes_like subfamily. This subfamily includes 99.63
cd01874175 Cdc42 Cdc42 subfamily. Cdc42 is an essential GTPase tha 99.63
cd04134189 Rho3 Rho3 subfamily. Rho3 is a member of the Rho family 99.63
cd01864165 Rab19 Rab19 subfamily. Rab19 proteins are associated wi 99.63
cd04158169 ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor doma 99.63
cd01865165 Rab3 Rab3 subfamily. The Rab3 subfamily contains Rab3A, 99.63
TIGR00231186 small_GTP small GTP-binding protein domain; InterPro: I 99.63
cd01860163 Rab5_related Rab5-related subfamily. This subfamily inc 99.62
cd01866168 Rab2 Rab2 subfamily. Rab2 is localized on cis-Golgi mem 99.62
cd04127180 Rab27A Rab27a subfamily. The Rab27a subfamily consists 99.62
PTZ00132209 GTP-binding nuclear protein; Provisional 99.62
cd00879190 Sar1 Sar1 subfamily. Sar1 is an essential component of 99.62
cd04144190 Ras2 Ras2 subfamily. The Ras2 subfamily, found exclusiv 99.62
PRK12317 426 elongation factor 1-alpha; Reviewed 99.62
cd04130173 Wrch_1 Wrch-1 subfamily. Wrch-1 (Wnt-1 responsive Cdc42 99.61
KOG0462 650 consensus 99.61
cd04106162 Rab23_lke Rab23-like subfamily. Rab23 is a member of th 99.61
cd04115170 Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is ubiqui 99.61
PRK05506 613 bifunctional sulfate adenylyltransferase subunit 1/aden 99.61
cd00877166 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily o 99.6
cd01863161 Rab18 Rab18 subfamily. Mammalian Rab18 is implicated in 99.6
cd04133176 Rop_like Rop subfamily. The Rop (Rho-related protein fr 99.6
cd04119168 RJL RJL (RabJ-Like) subfamily. RJLs are found in many p 99.6
cd04135174 Tc10 TC10 subfamily. TC10 is a Rho family protein that 99.6
smart00178184 SAR Sar1p-like members of the Ras-family of small GTPas 99.6
cd04111211 Rab39 Rab39 subfamily. Found in eukaryotes, Rab39 is ma 99.59
COG3596296 Predicted GTPase [General function prediction only] 99.59
cd01861161 Rab6 Rab6 subfamily. Rab6 is involved in microtubule-de 99.59
cd04131178 Rnd Rnd subfamily. The Rnd subfamily contains Rnd1/Rho6 99.58
PRK05124 475 cysN sulfate adenylyltransferase subunit 1; Provisional 99.58
cd04129187 Rho2 Rho2 subfamily. Rho2 is a fungal GTPase that plays 99.58
cd04148221 RGK RGK subfamily. The RGK (Rem, Rem2, Rad, Gem/Kir) su 99.58
TIGR00475 627 selB selenocysteine-specific translation elongation fac 99.57
KOG2486320 consensus 99.57
PTZ00336 449 elongation factor 1-alpha; Provisional 99.57
PTZ00141 443 elongation factor 1 alpha; Provisional 99.57
PRK12735 396 elongation factor Tu; Reviewed 99.57
PRK00049 397 elongation factor Tu; Reviewed 99.57
PRK12736 394 elongation factor Tu; Reviewed 99.56
cd04173222 Rnd2_Rho7 Rnd2/Rho7 subfamily. Rnd2/Rho7 is a member of 99.56
CHL00071 409 tufA elongation factor Tu 99.56
TIGR00491 1145 aIF-2 translation initiation factor aIF-2; InterPro: IP 99.55
KOG0458 603 consensus 99.55
cd04174232 Rnd1_Rho6 Rnd1/Rho6 subfamily. Rnd1/Rho6 is a member of 99.54
PRK04000 410 translation initiation factor IF-2 subunit gamma; Valid 99.52
cd04172182 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily. Rnd3/RhoE/Rho8 99.52
cd04103158 Centaurin_gamma Centaurin gamma. The centaurins (alpha, 99.51
TIGR00436278 era GTP-binding protein Era; InterPro: IPR005662 Era is 99.5
PRK10512 615 selenocysteinyl-tRNA-specific translation factor; Provi 99.49
COG0481 603 LepA Membrane GTPase LepA [Cell envelope biogenesis, ou 99.47
KOG0092200 consensus 99.46
COG5256 428 TEF1 Translation elongation factor EF-1alpha (GTPase) [ 99.45
cd04109215 Rab28 Rab28 subfamily. First identified in maize, Rab28 99.45
KOG0094221 consensus 99.43
cd01873195 RhoBTB RhoBTB subfamily. Members of the RhoBTB subfamil 99.42
cd04162164 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9 (Arf- 99.42
cd04161167 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 (Arl2- 99.41
cd04104197 p47_IIGP_like p47 (47-kDa) family. The p47 GTPase famil 99.39
PTZ00327 460 eukaryotic translation initiation factor 2 gamma subuni 99.37
KOG1144 1064 consensus 99.33
COG3276 447 SelB Selenocysteine-specific translation elongation fac 99.33
COG2895 431 CysN GTPases - Sulfate adenylate transferase subunit 1 99.33
cd04102202 RabL3 RabL3 (Rab-like3) subfamily. RabL3s are novel pro 99.33
KOG0394210 consensus 99.32
KOG0078207 consensus 99.3
COG1100219 GTPase SAR1 and related small G proteins [General funct 99.29
KOG0084205 consensus 99.29
COG2229187 Predicted GTPase [General function prediction only] 99.27
KOG0087222 consensus 99.25
TIGR02528144 EutP ethanolamine utilization protein, EutP; InterPro: 99.24
KOG0098216 consensus 99.22
pfam03308267 ArgK ArgK protein. The ArgK protein acts as an ATPase e 99.18
KOG0395196 consensus 99.16
PRK00089296 era GTP-binding protein Era; Reviewed 100.0
cd01894157 EngA1 EngA1 subfamily. This CD represents the first GTP 100.0
COG1159298 Era GTPase [General function prediction only] 100.0
TIGR03594429 GTPase_EngA ribosome-associated GTPase EngA. EngA (YfgK 100.0
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) is a 100.0
PRK00093438 engA GTP-binding protein EngA; Reviewed 100.0
cd01895174 EngA2 EngA2 subfamily. This CD represents the second GT 100.0
pfam02421188 FeoB_N Ferrous iron transport protein B. Escherichia co 100.0
PRK05291445 trmE tRNA modification GTPase TrmE; Reviewed 100.0
cd04164157 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein foun 100.0
COG1160444 Predicted GTPases [General function prediction only] 100.0
COG0486454 ThdF Predicted GTPase [General function prediction only 100.0
cd01897168 NOG NOG1 is a nucleolar GTP-binding protein present in 100.0
PRK00454196 engB GTPase EngB; Reviewed 100.0
PRK04213195 GTP-binding protein; Provisional 100.0
cd01878204 HflX HflX subfamily. A distinct conserved domain with a 100.0
cd01879158 FeoB Ferrous iron transport protein B (FeoB) subfamily. 100.0
TIGR03598179 GTPase_YsxC ribosome biogenesis GTP-binding protein Ysx 100.0
cd00880163 Era_like Era (E. coli Ras-like protein)-like. This fami 100.0
cd01876170 YihA_EngB The YihA (EngB) subfamily. This subfamily of 100.0
TIGR00450473 thdF tRNA modification GTPase TrmE; InterPro: IPR004520 100.0
cd01898170 Obg Obg subfamily. The Obg nucleotide binding protein s 100.0
cd01881176 Obg_like The Obg-like subfamily consists of five well-d 99.97
KOG1191531 consensus 99.97
TIGR00437 733 feoB ferrous iron transport protein B; InterPro: IPR003 99.96
cd01887168 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic i 99.96
PRK09554 772 feoB ferrous iron transport protein B; Reviewed 99.96
pfam10662143 PduV-EutP Ethanolamine utilisation - propanediol utilis 99.96
pfam00009185 GTP_EFTU Elongation factor Tu GTP binding domain. This 99.96
COG0370 653 FeoB Fe2+ transport system protein B [Inorganic ion tra 99.96
cd04171164 SelB SelB subfamily. SelB is an elongation factor neede 99.95
cd00881189 GTP_translation_factor GTP translation factor family. T 99.95
COG0218200 Predicted GTPase [General function prediction only] 99.93
PRK12312610 infB translation initiation factor IF-2; Provisional 99.91
TIGR03156351 GTP_HflX GTP-binding protein HflX. This protein family 99.91
cd01890179 LepA LepA subfamily. LepA belongs to the GTPase family 99.89
PRK12299334 obgE GTPase ObgE; Reviewed 99.89
KOG1423379 consensus 99.89
TIGR01393 598 lepA GTP-binding protein LepA; InterPro: IPR006297 LepA 99.88
PRK11058426 putative GTPase HflX; Provisional 99.87
PRK04004592 translation initiation factor IF-2; Validated 99.86
PRK12298380 obgE GTPase ObgE; Reviewed 99.86
PRK12297429 obgE GTPase ObgE; Reviewed 99.85
PRK12296495 obgE GTPase ObgE; Reviewed 99.84
COG2262411 HflX GTPases [General function prediction only] 99.84
COG0532509 InfB Translation initiation factor 2 (IF-2; GTPase) [Tr 99.84
cd01891194 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA 99.84
PRK12317426 elongation factor 1-alpha; Reviewed 99.83
KOG1489366 consensus 99.83
PRK05433 601 GTP-binding protein LepA; Provisional 99.82
PTZ00141443 elongation factor 1 alpha; Provisional 99.81
PRK05506 613 bifunctional sulfate adenylyltransferase subunit 1/aden 99.81
COG1084346 Predicted GTPase [General function prediction only] 99.81
PRK05124475 cysN sulfate adenylyltransferase subunit 1; Provisional 99.8
PTZ00336449 elongation factor 1-alpha; Provisional 99.79
CHL00189770 infB translation initiation factor 2; Provisional 99.79
cd01889192 SelB_euk SelB subfamily. SelB is an elongation factor n 99.78
COG0536369 Obg Predicted GTPase [General function prediction only] 99.78
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf family 99.78
cd04154173 Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are memb 99.77
PRK04000410 translation initiation factor IF-2 subunit gamma; Valid 99.77
PRK10218 607 GTP-binding protein; Provisional 99.76
TIGR00475 627 selB selenocysteine-specific translation elongation fac 99.76
pfam00025174 Arf ADP-ribosylation factor family. Pfam combines a num 99.76
KOG0462 650 consensus 99.76
cd00878158 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) sm 99.74
cd01884195 EF_Tu EF-Tu subfamily. This subfamily includes ortholog 99.73
TIGR00436278 era GTP-binding protein Era; InterPro: IPR005662 Era is 99.73
COG2895431 CysN GTPases - Sulfate adenylate transferase subunit 1 99.72
cd01888203 eIF2_gamma eIF2-gamma (gamma subunit of initiation fact 99.71
PRK10512 615 selenocysteinyl-tRNA-specific translation factor; Provi 99.7
cd04160167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related protein 1) 99.7
COG0481 603 LepA Membrane GTPase LepA [Cell envelope biogenesis, ou 99.7
pfam00071162 Ras Ras family. Includes sub-families Ras, Rab, Rac, Ra 99.68
cd04159159 Arl10_like Arl10-like subfamily. Arl9/Arl10 was identif 99.68
cd01883219 EF1_alpha Eukaryotic elongation factor 1 (EF1) alpha su 99.68
cd04153174 Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) and Ar 99.67
cd04166208 CysN_ATPS CysN_ATPS subfamily. CysN, together with prot 99.67
COG5256428 TEF1 Translation elongation factor EF-1alpha (GTPase) [ 99.66
PTZ00133182 ADP-ribosylation factor; Provisional 99.66
cd00154159 Rab Rab family. Rab GTPases form the largest family wit 99.65
cd01885222 EF2 EF2 (for archaea and eukarya). Translocation requir 99.64
cd00876160 Ras Ras family. The Ras family of the Ras superfamily i 99.64
smart00177175 ARF ARF-like small GTPases; ARF, ADP-ribosylation facto 99.64
PTZ00327460 eukaryotic translation initiation factor 2 gamma subuni 99.64
cd04150159 Arf1_5_like Arf1-Arf5-like subfamily. This subfamily co 99.63
cd04156160 ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor suppres 99.62
cd04139164 RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) subfa 99.62
KOG1145683 consensus 99.62
cd04158169 ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor doma 99.62
cd04157162 Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a subfamil 99.62
cd04151158 Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes to the 99.61
COG1217 603 TypA Predicted membrane GTPase involved in stress respo 99.61
TIGR004911145 aIF-2 translation initiation factor aIF-2; InterPro: IP 99.61
cd00882157 Ras_like_GTPase Ras-like GTPase superfamily. The Ras-li 99.61
cd04149168 Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor 6) p 99.6
cd04152183 Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) is hig 99.59
cd01892169 Miro2 Miro2 subfamily. Miro (mitochondrial Rho) protein 99.59
smart00173164 RAS Ras subfamily of RAS small GTPases. Similar in fold 99.59
cd04167213 Snu114p Snu114p subfamily. Snu114p is one of several pr 99.58
cd04112191 Rab26 Rab26 subfamily. First identified in rat pancreat 99.58
cd04125188 RabA_like RabA-like subfamily. RabA was first identifie 99.58
cd00879190 Sar1 Sar1 subfamily. Sar1 is an essential component of 99.58
KOG1490620 consensus 99.58
cd01867167 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Ypt2 ar 99.57
TIGR00231186 small_GTP small GTP-binding protein domain; InterPro: I