254780425

254780425

apolipoprotein N-acyltransferase

GeneID in NCBI database:8209411Locus tag:CLIBASIA_01550
Protein GI in NCBI database:254780425Protein Accession:YP_003064838.1
Gene range:-(331628, 333184)Protein Length:518aa
Gene description:apolipoprotein N-acyltransferase
COG prediction:[M] Apolipoprotein N-acyltransferase
KEGG prediction:lnt; apolipoprotein N-acyltransferase; K03820 apolipoprotein N-acyltransferase [EC:2.3.1.-]
SEED prediction:Apolipoprotein N-acyltransferase (EC 2.3.1.-) / Copper homeostasis protein CutE
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Lipoprotein Biosynthesis;
Phosphate metabolism;
Copper homeostasis: copper tolerance
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM7 TM-Helix
TOPPRED9 TM-Helix
HMMTOP10 TM-Helix
MEMSAT7 TM-Helix
MEMSAT_SVM7 TM-Helix
PHOBIUS9 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------52
MGNIAGKVMLLSGFRRCFIAILAGVIGSFSMPSSDLFLSSFVSFTLLIWLLDGISSNLGRMSAISRVGSSFFVGWLFGVGYFLAGLWWVREGIVDQIGSRFPFWGVVLFFVMISFLLAIFYGVATSLASLLWSTGMGRICVFACAVGFCEWLRSVLGIGTWNAIGYAAMPIPVMMQSVHWIGLFGMNALSVFCFASPALFGTRRDVNIGIILSSTLLILHIAYGWWILTEDSKSSLKFEKISPVIRIVQPGINPAIKEDREKILERYLSLTALPVSAGELEPVIIVWAYLPFPFSIVDQPSILKKIASVLKINQLLIVGSMRKELVDGRSHFYKSIYIINSKGEILASSNAKHLVPFAEYLPYRNILKKLNLDFYMFPLDYSSSDISPLLGLSEKLRLYPLLFSDALFHQDINNLENVSAILNIIDDSGFMGSGTDHSFRYAQIQAVEIGLPLIRATNNGVSAFLDERGQIISSVYADRGASIDMHFQPKVRDSFRSSIQMRVFWIIEFILLILAVIV
cccHHHHHHHHHcHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHcccccccccccccccccEEEEEEccccccccccHHHHHHHHHHHHHHHHHcccccccEEEcccccccccccccHHHHHHHHHHHHcccEEEEEEEEccccccccEEEEEEEEEcccccEEEEEccccccccccccccHHHHHHccccccccccccccccccccEEccccEEEEEEEEcccccHHHHHHHcccccEEEEEccccccccHHHHHHHHHHHHHHHHccEEEEEEcccccEEEcccccEEEEccccccEEEEEEEcHHHcccHHHHHHHHHHHHHHHHHHHHHHHc
ccHHHHHHHHccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHcHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHcccHHHccccccccHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccEEEEEEEccccccccccHHHHHHHHHHHHHcccccccccccEEEEcHHHcHHHHHHHHHHHHHHHHHHccccEEEEEEEEcccccccccEEEEEEEEcccccccccccccccccccccccHHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHcHHHHHccccccEEEEEEcccccccccHHHHHHHHHHHHHHHcccEEEEccccEEEEEcccccEEEEcccccEEEEEEEEccccccccccccccHHHHHHHHHHHHHHHHc
MGNIAGKVMLLSGFRRCFIAILAGVigsfsmpssdlflSSFVSFTLLIWLLDGISSNLGRMSAISRVGSSFFVGWLFGVGYFLAGLWWVREGIVdqigsrfpfWGVVLFFVMISFLLAIFYGVATSLASLLWSTGMGRICVFACAVGFCEWLRSVLGIGTwnaigyaampipVMMQSVHWIGLFGMNalsvfcfaspalfgtrrdvNIGIILSSTLLILHIAYGWwiltedsksslkfekispvirivqpginpaiKEDREKILERYLSLtalpvsagelePVIIVWAylpfpfsivdqpSILKKIASVLKINQLLIVGSMRKELVDGRSHFYKSIYIINSKgeilassnakhlvpfaeylpYRNILKKLNldfymfpldysssdispllglseklrlypllfsdalfhqdINNLENVSAILNIiddsgfmgsgtdhsfRYAQIQAVEIGLPLIRATNNGVSAFLDERGQIISSVYadrgasidmhfqpkvrdSFRSSIQMRVFWIIEFILLILAVIV
MGNIAGKVMLLSGFRRCFIAILAGVIGSFSMPSSDLFLSSFVSFTLLIWLLDGISSNLGRMSAISRVGSSFFVGWLFGVGYFLAGLWWVREGIVDQIGSRFPFWGVVLFFVMISFLLAIFYGVATSLASLLWSTGMGRICVFACAVGFCEWLRSVLGIGTWNAIGYAAMPIPVMMQSVHWIGLFGMNALSVFCFASPALFGTRRDVNIGIILSSTLLILHIAYGWWILTEDSKSSLkfekispvirivqpginpaIKEDREKILERYLSLTALPVSAGELEPVIIVWAYLPFPFSIVDQPSILKKIASVLKINQLLIVGSMRKELVDGRSHFYKSIYIINSKGEILASSNAKHLVPFAEYLPYRNILKKLNLDFYMFPLDYSSSDISPLLGLSEKLRLYPLLFSDALFHQDINNLENVSAILNIIDDSGFMGSGTDHSFRYAQIQAVEIGLPLIRATNNGVSAFLDERGQIISSVYadrgasidmhFQPKVRDSFRSSIQMRVFWIIEFILLILAVIV
MGNIAGKVMLLSGFRRCFIAILAGVIGSFSMPssdlflssfvsftllIWLLDGISSNLGRMSAISRVGSSFFVGWLFGVGYFLAGLWWVREGIVDQIGSRFPFWGVVLFFVMISFLLAIFYGVATSLASLLWSTGMGRICVFACAVGFCEWLRSVLGIGTWNAIGYAAMPIPVMMQSVHWIGLFGMNALSVFCFASPALFGTRRDVNigiilsstllilhiAYGWWILTEDSKSSLKFEKISPVIRIVQPGINPAIKEDREKILERYLSLTALPVSAGELEPVIIVWAYLPFPFSIVDQPSILKKIASVLKINQLLIVGSMRKELVDGRSHFYKSIYIINSKGEILASSNAKHLVPFAEYLPYRNILKKLNLDFYMFPLDYSSSDISPLLGLSEKLRLYPLLFSDALFHQDINNLENVSAILNIIDDSGFMGSGTDHSFRYAQIQAVEIGLPLIRATNNGVSAFLDERGQIISSVYADRGASIDMHFQPKVRDSFRSSIQMRVFWIIEFILLILAVIV
****AGKVMLLSGFRRCFIAILAGVIGSFSMPSSDLFLSSFVSFTLLIWLLDGISSNLGRMSAISRVGSSFFVGWLFGVGYFLAGLWWVREGIVDQIGSRFPFWGVVLFFVMISFLLAIFYGVATSLASLLWSTGMGRICVFACAVGFCEWLRSVLGIGTWNAIGYAAMPIPVMMQSVHWIGLFGMNALSVFCFASPALFGTRRDVNIGIILSSTLLILHIAYGWWILTEDSKSSLKFEKISPVIRIVQPGINPAIKEDREKILERYLSLTALPVSAGELEPVIIVWAYLPFPFSIVDQPSILKKIASVLKINQLLIVGSMRKELVDGRSHFYKSIYIINSKGEILASSNAKHLVPFAEYLPYRNILKKLNLDFYM**************GLSEKLRLYPLLFSDALFHQDINNLENVSAILNIIDDSGFMGSGTDHSFRYAQIQAVEIGLPLIRATNNGVSAFLDERGQIISSVYADRGASIDMHFQPKVRDSFRSSIQMRVFWIIEFILLILAVIV
MGNIAGKVMLLSGFRRCFIAILAGVIGSFSMPSSDLFLSSFVSFTLLIWLLDGISSNLGRMSAISRVGSSFFVGWLFGVGYFLAGLWWVREGIVDQIGSRFPFWGVVLFFVMISFLLAIFYGVATSLASLLWSTGMGRICVFACAVGFCEWLRSVLGIGTWNAIGYAAMPIPVMMQSVHWIGLFGMNALSVFCFASPALFGTRRDVNIGIILSSTLLILHIAYGWWILTEDSKSSLKFEKISPVIRIVQPGINPAIKEDREKILERYLSLTALPVSAGELEPVIIVWAYLPFPFSIVDQPSILKKIASVLKINQLLIVGSMRKELVDGRSHFYKSIYIINSKGEILASSNAKHLVPFAEYLPYRNILKKLNLDFYMFPLDYSSSDISPLLGLSEKLRLYPLLFSDALFHQDINNLENVSAILNIIDDSGFMGSGTDHSFRYAQIQAVEIGLPLIRATNNGVSAFLDERGQIISSVYADRGASIDMHFQPKVRDSFRSSIQMRVFWIIEFILLILAVIV
MGNIAGKVMLLSGFRRCFIAILAGVIGSFSMPSSDLFLSSFVSFTLLIWLLDGISSNLGRMSAISRVGSSFFVGWLFGVGYFLAGLWWVREGIVDQIGSRFPFWGVVLFFVMISFLLAIFYGVATSLASLLWSTGMGRICVFACAVGFCEWLRSVLGIGTWNAIGYAAMPIPVMMQSVHWIGLFGMNALSVFCFASPALFGTRRDVNIGIILSSTLLILHIAYGWWILTEDSKSSLKFEKISPVIRIVQPGINPAIKEDREKILERYLSLTALPVSAGELEPVIIVWAYLPFPFSIVDQPSILKKIASVLKINQLLIVGSMRKELVDGRSHFYKSIYIINSKGEILASSNAKHLVPFAEYLPYRNILKKLNLDFYMFPLDYSSSDISPLLGLSEKLRLYPLLFSDALFHQDINNLENVSAILNIIDDSGFMGSGTDHSFRYAQIQAVEIGLPLIRATNNGVSAFLDERGQIISSVYADRGASIDMHFQPKVRDSFRSSIQMRVFWIIEFILLILAVIV
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHx
iiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHooooooHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHi
iiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooo
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGNIAGKVMLLSGFRRCFIAILAGVIGSFSMPSSDLFLSSFVSFTLLIWLLDGISSNLGRMSAISRVGSSFFVGWLFGVGYFLAGLWWVREGIVDQIGSRFPFWGVVLFFVMISFLLAIFYGVATSLASLLWSTGMGRICVFACAVGFCEWLRSVLGIGTWNAIGYAAMPIPVMMQSVHWIGLFGMNALSVFCFASPALFGTRRDVNIGIILSSTLLILHIAYGWWILTEDSKSSLKFEKISPVIRIVQPGINPAIKEDREKILERYLSLTALPVSAGELEPVIIVWAYLPFPFSIVDQPSILKKIASVLKINQLLIVGSMRKELVDGRSHFYKSIYIINSKGEILASSNAKHLVPFAEYLPYRNILKKLNLDFYMFPLDYSSSDISPLLGLSEKLRLYPLLFSDALFHQDINNLENVSAILNIIDDSGFMGSGTDHSFRYAQIQAVEIGLPLIRATNNGVSAFLDERGQIISSVYADRGASIDMHFQPKVRDSFRSSIQMRVFWIIEFILLILAVIV
MGNIAGKVMLLSGFRRCFIAILAGVIGSFSMPSSDLFLSSFVSFTLLIWLLDGISSNLGRMSAISRVGSSFFVGWLFGVGYFLAGLWWVREGIVDQIGSRFPFWGVVLFFVMISFLLAIFYGVATSLASLLWSTGMGRICVFACAVGFCEWLRSVLGIGTWNAIGYAAMPIPVMMQSVHWIGLFGMNALSVFCFASPALFGTRRDVNIGIILSSTLLILHIAYGWWILTEDSKSSLKFEKISPVIRIVQPGINPAIKEDREKILERYLSLTALPVSAGELEPVIIVWAYLPFPFSIVDQPSILKKIASVLKINQLLIVGSMRKELVDGRSHFYKSIYIINSKGEILASSNAKHLVPFAEYLPYRNILKKLNLDFYMFPLDYSSSDISPLLGLSEKLRLYPLLFSDALFHQDINNLENVSAILNIIDDSGFMGSGTDHSFRYAQIQAVEIGLPLIRATNNGVSAFLDERGQIISSVYADRGASIDMHFQPKVRDSFRSSIQMRVFWIIEFILLILAVIV
MGNIAGKVMLLSGFRRCFIAILAGVIGSFSMPSSDLFLSSFVSFTLLIWLLDGISSNLGRMSAISRVGSSFFVGWLFGVGYFLAGLWWVREGIVDQIGSRFPFWGVVLFFVMISFLLAIFYGVATSLASLLWSTGMGRICVFACAVGFCEWLRSVLGIGTWNAIGYAAMPIPVMMQSVHWIGLFGMNALSVFCFASPALFGTRRDVNIGIILSSTLLILHIAYGWWILTEDSKSSLKFEKISPVIRIVQPGINPAIKEDREKILERYLSLTALPVSAGELEPVIIVWAYLPFPFSIVDQPSILKKIASVLKINQLLIVGSMRKELVDGRSHFYKSIYIINSKGEILASSNAKHLVPFAEYLPYRNILKKLNLDFYMFPLDYSSSDISPLLGLSEKLRLYPLLFSDALFHQDINNLENVSAILNIIDDSGFMGSGTDHSFRYAQIQAVEIGLPLIRATNNGVSAFLDERGQIISSVYADRGASIDMHFQPKVRDSFRSSIQMRVFWIIEFILLILAVIV

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target518 apolipoprotein N-acyltransferase [Candidatus Liberibact
315122129521 apolipoprotein N-acyltransferase [Candidatus Liberibact 1 0.0
222084697533 apolipoprotein N-acyltransferase [Agrobacterium radioba 1 1e-100
222147355528 apolipoprotein N-acyltransferase [Agrobacterium vitis S 1 3e-98
241202772534 apolipoprotein N-acyltransferase [Rhizobium leguminosar 1 6e-98
209547627534 apolipoprotein N-acyltransferase [Rhizobium leguminosar 1 2e-97
116250160543 apolipoprotein N-acyltransferase [Rhizobium leguminosar 1 3e-95
227820633531 apolipoprotein N-acyltransferase [Sinorhizobium fredii 1 3e-92
190890042534 apolipoprotein N-acyltransferase [Rhizobium etli CIAT 6 1 4e-91
294679541 ActA [Sinorhizobium medicae WSM419] Length = 541 1 1e-90
150395272543 apolipoprotein N-acyltransferase [Sinorhizobium medicae 1 1e-90
>gi|315122129|ref|YP_004062618.1| apolipoprotein N-acyltransferase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 521 Back     alignment and organism information
 Score =  709 bits (1830), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/520 (68%), Positives = 414/520 (79%), Gaps = 3/520 (0%)

Query: 1   MGNIAGKVMLLSGFRRCFIAILAGVIGSFSMPSSDLFLSSFVSFTLLIWLLDGISSNLGR 60
           M NIA KVML +G RR F+AILAG+IGSFSMPS D  +++FVSFTLL+WLLDGISS  GR
Sbjct: 1   MDNIASKVMLSAGIRRYFLAILAGIIGSFSMPSGDFLIAAFVSFTLLVWLLDGISSIRGR 60

Query: 61  MSAISRVGSSFFVGWLFGVGYFLAGLWWVREGIVDQIGSRFPFWGVVLFFVMISFLLAIF 120
             +I+ VGSSF VGWLFGVGYFL G WW+R GI++   +  PFWG VLFFV     LAIF
Sbjct: 61  AVSINGVGSSFLVGWLFGVGYFLTGFWWIRAGIIELSSTFLPFWGEVLFFVSFPIFLAIF 120

Query: 121 YGVATSLASLLWSTGMGRICVFACAVGFCEWLRSVLGIGTWNAIGYAAMPIPVMMQSVHW 180
           YG+AT++ASLLWS GMGRIC+ ACA G CEWLRS LG  TWNAIGYAAMPIP+MMQSVHW
Sbjct: 121 YGIATAIASLLWSEGMGRICILACAFGLCEWLRSFLGASTWNAIGYAAMPIPIMMQSVHW 180

Query: 181 IGLFGMNALSVFCFASPALFGTRRDVNIGIILSSTLLILHIAYGWWILTEDSKSSLKFEK 240
           IGLFGMNALSVFCFASPALFGTRRDVNIG+ +SS LL+LHIAYG WI+ EDSK SL F +
Sbjct: 181 IGLFGMNALSVFCFASPALFGTRRDVNIGMTISSVLLVLHIAYGVWIIAEDSKPSLHFSQ 240

Query: 241 ISPVIRIVQPGINPAIKEDREKILERYLSLTALPVSAGELEPVIIVWAYLPFPFSIVDQP 300
             PV+RIVQPG+NP +KE  E IL RYLSLTALPVSAGE EP +I+W  L  PFSIV+QP
Sbjct: 241 EWPVVRIVQPGVNPTVKESDENILGRYLSLTALPVSAGEAEPSVIIWVGLAPPFSIVNQP 300

Query: 301 SILKKIASVLKINQLLIVGSMRKELVDGRSHFYKSIYIINSKGEILASSNAKHLVPFAEY 360
            ILK+IAS LK  Q+LI GS+ K+L      FY+ +Y+I+SKG IL SSNA HL PFAEY
Sbjct: 301 KILKRIASTLKEKQILIFGSIWKDLSVREDCFYRLVYVIDSKGSILTSSNATHLFPFAEY 360

Query: 361 LPYRNILKKLNLDFYMFPLDYSSSDISPLLGLSEKLRLYPLLFSDALFHQDIN-NLENVS 419
           LPYRNI KKL+ DF +FP DY  S  S +L LSEKLR YPL+FSD  F QDIN N+E+ +
Sbjct: 361 LPYRNIFKKLHFDFSLFPKDYVVSQSSSVLVLSEKLRFYPLIFSDVFFRQDINKNVESAN 420

Query: 420 AILNIIDDSGFMGS--GTDHSFRYAQIQAVEIGLPLIRATNNGVSAFLDERGQIISSVYA 477
           AILNIIDDS FM +  G D SFRYAQIQAVEIGLPLIR  NNG+SAFLD+RG+IISS+  
Sbjct: 421 AILNIIDDSWFMNNKRGFDQSFRYAQIQAVEIGLPLIRVANNGISAFLDKRGRIISSLQV 480

Query: 478 DRGASIDMHFQPKVRDSFRSSIQMRVFWIIEFILLILAVI 517
            R ASIDM+FQPK+++ F   IQM +FWIIE ILL+LA+I
Sbjct: 481 GRSASIDMYFQPKIQNKFHYEIQMIIFWIIELILLMLAII 520


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222084697|ref|YP_002543226.1| apolipoprotein N-acyltransferase [Agrobacterium radiobacter K84] Length = 533 Back     alignment and organism information
>gi|222147355|ref|YP_002548312.1| apolipoprotein N-acyltransferase [Agrobacterium vitis S4] Length = 528 Back     alignment and organism information
>gi|241202772|ref|YP_002973868.1| apolipoprotein N-acyltransferase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 534 Back     alignment and organism information
>gi|209547627|ref|YP_002279544.1| apolipoprotein N-acyltransferase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 534 Back     alignment and organism information
>gi|116250160|ref|YP_765998.1| apolipoprotein N-acyltransferase [Rhizobium leguminosarum bv. viciae 3841] Length = 543 Back     alignment and organism information
>gi|227820633|ref|YP_002824603.1| apolipoprotein N-acyltransferase [Sinorhizobium fredii NGR234] Length = 531 Back     alignment and organism information
>gi|190890042|ref|YP_001976584.1| apolipoprotein N-acyltransferase [Rhizobium etli CIAT 652] Length = 534 Back     alignment and organism information
>gi|294679|gb|AAB81867.1| ActA [Sinorhizobium medicae WSM419] Length = 541 Back     alignment and organism information
>gi|150395272|ref|YP_001325739.1| apolipoprotein N-acyltransferase [Sinorhizobium medicae WSM419] Length = 543 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target518 apolipoprotein N-acyltransferase [Candidatus Liberibact
PRK00302505 PRK00302, lnt, apolipoprotein N-acyltransferase; Review 4e-69
TIGR00546391 TIGR00546, lnt, apolipoprotein N-acyltransferase 4e-40
cd07571270 cd07571, ALP_N-acyl_transferase, Apolipoprotein N-acyl 9e-33
COG0815518 COG0815, Lnt, Apolipoprotein N-acyltransferase [Cell en 9e-59
>gnl|CDD|178970 PRK00302, lnt, apolipoprotein N-acyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|161921 TIGR00546, lnt, apolipoprotein N-acyltransferase Back     alignment and domain information
>gnl|CDD|143595 cd07571, ALP_N-acyl_transferase, Apolipoprotein N-acyl transferase (class 9 nitrilases) Back     alignment and domain information
>gnl|CDD|31157 COG0815, Lnt, Apolipoprotein N-acyltransferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 518 apolipoprotein N-acyltransferase [Candidatus Liberibact
PRK00302509 lnt apolipoprotein N-acyltransferase; Reviewed 100.0
COG0815518 Lnt Apolipoprotein N-acyltransferase [Cell envelope bio 100.0
TIGR00546441 lnt apolipoprotein N-acyltransferase; InterPro: IPR0045 100.0
PRK12291420 apolipoprotein N-acyltransferase; Reviewed 100.0
cd07571270 ALP_N-acyl_transferase Apolipoprotein N-acyl transferas 100.0
cd07565291 aliphatic_amidase aliphatic amidases (class 2 nitrilase 99.97
cd07197253 nitrilase Nitrilase superfamily, including nitrile- or 99.96
cd07581255 nitrilase_3 Uncharacterized subgroup of the nitrilase s 99.96
cd07583253 nitrilase_5 Uncharacterized subgroup of the nitrilase s 99.96
cd07572265 nit Nit1, Nit 2, and related proteins, and the Nit1-lik 99.96
cd07573284 CPA N-carbamoylputrescine amidohydrolase (CPA) (class 1 99.96
PRK10438256 hypothetical protein; Provisional 99.95
cd07582294 nitrilase_4 Uncharacterized subgroup of the nitrilase s 99.95
cd07575252 Xc-1258_like Xanthomonas campestris XC1258 and related 99.95
cd07568287 ML_beta-AS_like mammalian-like beta-alanine synthase (b 99.95
cd07564297 nitrilases_CHs Nitrilases, cyanide hydratase (CH)s, and 99.95
cd07576254 R-amidase_like Pseudomonas sp. MCI3434 R-amidase and re 99.95
cd07569302 DCase N-carbamyl-D-amino acid amidohydrolase (DCase, cl 99.95
cd07586269 nitrilase_8 Uncharacterized subgroup of the nitrilase s 99.95
cd07584258 nitrilase_6 Uncharacterized subgroup of the nitrilase s 99.95
TIGR03381279 agmatine_aguB N-carbamoylputrescine amidase. Members of 99.94
cd07578258 nitrilase_1_R1 First nitrilase domain of an uncharacter 99.94
cd07574280 nitrilase_Rim1_like Uncharacterized subgroup of the nit 99.94
cd07585261 nitrilase_7 Uncharacterized subgroup of the nitrilase s 99.94
cd07580268 nitrilase_2 Uncharacterized subgroup of the nitrilase s 99.94
cd07570261 GAT_Gln-NAD-synth Glutamine aminotransferase (GAT, glut 99.93
cd07577259 Ph0642_like Pyrococcus horikoshii Ph0642 and related pr 99.93
cd07579279 nitrilase_1_R2 Second nitrilase domain of an uncharacte 99.92
COG0388274 Predicted amidohydrolase [General function prediction o 99.91
KOG0807295 consensus 99.83
PRK13287333 amiF formamidase; Provisional 99.83
PRK13981 543 NAD synthetase; Provisional 99.79
PRK13286343 amiE acylamide amidohydrolase; Provisional 99.76
cd07587363 ML_beta-AS mammalian-like beta-alanine synthase (beta-A 99.7
KOG0806298 consensus 99.64
PRK02628 678 nadE NAD synthetase; Reviewed 99.59
cd07567299 biotinidase_like biotinidase and vanins (class 4 nitril 99.54
KOG0805337 consensus 99.06
KOG0808387 consensus 98.31
PRK13825389 conjugal transfer protein TraB; Provisional 99.86
pfam07186396 consensus 99.77
cd07566295 ScNTA1_like Saccharomyces cerevisiae N-terminal amidase 99.53
pfam00795172 CN_hydrolase Carbon-nitrogen hydrolase. This family con 99.85
>PRK00302 lnt apolipoprotein N-acyltransferase; Reviewed Back     alignment and domain information
>COG0815 Lnt Apolipoprotein N-acyltransferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR00546 lnt apolipoprotein N-acyltransferase; InterPro: IPR004563 Apolipoprotein N-acyltransferase 2 Back     alignment and domain information
>PRK12291 apolipoprotein N-acyltransferase; Reviewed Back     alignment and domain information
>cd07571 ALP_N-acyl_transferase Apolipoprotein N-acyl transferase (class 9 nitrilases) Back     alignment and domain information
>cd07565 aliphatic_amidase aliphatic amidases (class 2 nitrilases) Back     alignment and domain information
>cd07197 nitrilase Nitrilase superfamily, including nitrile- or amide-hydrolyzing enzymes and amide-condensing enzymes Back     alignment and domain information
>cd07581 nitrilase_3 Uncharacterized subgroup of the nitrilase superfamily (putative class 13 nitrilases) Back     alignment and domain information
>cd07583 nitrilase_5 Uncharacterized subgroup of the nitrilase superfamily (putative class 13 nitrilases) Back     alignment and domain information
>cd07572 nit Nit1, Nit 2, and related proteins, and the Nit1-like domain of NitFhit (class 10 nitrilases) Back     alignment and domain information
>cd07573 CPA N-carbamoylputrescine amidohydrolase (CPA) (class 11 nitrilases) Back     alignment and domain information
>PRK10438 hypothetical protein; Provisional Back     alignment and domain information
>cd07582 nitrilase_4 Uncharacterized subgroup of the nitrilase superfamily (putative class 13 nitrilases) Back     alignment and domain information
>cd07575 Xc-1258_like Xanthomonas campestris XC1258 and related proteins, members of the nitrilase superfamily (putative class 13 nitrilases) Back     alignment and domain information
>cd07568 ML_beta-AS_like mammalian-like beta-alanine synthase (beta-AS) and similar proteins (class 5 nitrilases) Back     alignment and domain information
>cd07564 nitrilases_CHs Nitrilases, cyanide hydratase (CH)s, and similar proteins (class 1 nitrilases) Back     alignment and domain information
>cd07576 R-amidase_like Pseudomonas sp Back     alignment and domain information
>cd07569 DCase N-carbamyl-D-amino acid amidohydrolase (DCase, class 6 nitrilases) Back     alignment and domain information
>cd07586 nitrilase_8 Uncharacterized subgroup of the nitrilase superfamily (putative class 13 nitrilases) Back     alignment and domain information
>cd07584 nitrilase_6 Uncharacterized subgroup of the nitrilase superfamily (putative class 13 nitrilases) Back     alignment and domain information
>TIGR03381 agmatine_aguB N-carbamoylputrescine amidase Back     alignment and domain information
>cd07578 nitrilase_1_R1 First nitrilase domain of an uncharacterized subgroup of the nitrilase superfamily (putative class 13 nitrilases) Back     alignment and domain information
>cd07574 nitrilase_Rim1_like Uncharacterized subgroup of the nitrilase superfamily; some members of this subgroup have an N-terminal RimI domain (class 12 nitrilases) Back     alignment and domain information
>cd07585 nitrilase_7 Uncharacterized subgroup of the nitrilase superfamily (putative class 13 nitrilases) Back     alignment and domain information
>cd07580 nitrilase_2 Uncharacterized subgroup of the nitrilase superfamily (putative class 13 nitrilases) Back     alignment and domain information
>cd07570 GAT_Gln-NAD-synth Glutamine aminotransferase (GAT, glutaminase) domain of glutamine-dependent NAD synthetases (class 7 and 8 nitrilases) Back     alignment and domain information
>cd07577 Ph0642_like Pyrococcus horikoshii Ph0642 and related proteins, members of the nitrilase superfamily (putative class 13 nitrilases) Back     alignment and domain information
>cd07579 nitrilase_1_R2 Second nitrilase domain of an uncharacterized subgroup of the nitrilase superfamily (putative class 13 nitrilases) Back     alignment and domain information
>COG0388 Predicted amidohydrolase [General function prediction only] Back     alignment and domain information
>KOG0807 consensus Back     alignment and domain information
>PRK13287 amiF formamidase; Provisional Back     alignment and domain information
>PRK13981 NAD synthetase; Provisional Back     alignment and domain information
>PRK13286 amiE acylamide amidohydrolase; Provisional Back     alignment and domain information
>cd07587 ML_beta-AS mammalian-like beta-alanine synthase (beta-AS) and similar proteins (class 5 nitrilases) Back     alignment and domain information
>KOG0806 consensus Back     alignment and domain information
>PRK02628 nadE NAD synthetase; Reviewed Back     alignment and domain information
>cd07567 biotinidase_like biotinidase and vanins (class 4 nitrilases) Back     alignment and domain information
>KOG0805 consensus Back     alignment and domain information
>KOG0808 consensus Back     alignment and domain information
>PRK13825 conjugal transfer protein TraB; Provisional Back     alignment and domain information
>pfam07186 consensus Back     alignment and domain information
>cd07566 ScNTA1_like Saccharomyces cerevisiae N-terminal amidase NTA1, and related proteins (class 3 nitrilases) Back     alignment and domain information
>pfam00795 CN_hydrolase Carbon-nitrogen hydrolase Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target518 apolipoprotein N-acyltransferase [Candidatus Liberibact
1ems_A 440 Crystal Structure Of The C. Elegans Nitfhit Protein 8e-16
1f89_A291 Crystal Structure Of Saccharomyces Cerevisiae Nit3, 4e-14
2w1v_A276 Crystal Structure Of Mouse Nitrilase-2 At 1.4a Reso 2e-11
3hkx_A283 Crystal Structure Analysis Of An Amidase From Neste 0.001
2plq_A348 Crystal Structure Of The Amidase From Geobacillus P 0.001
2e11_A266 The Crystal Structure Of Xc1258 From Xanthomonas Ca 0.001
gi|9955180|pdb|1EMS|A Chain A, Crystal Structure Of The C. Elegans Nitfhit Protein Length = 440 Back     alignment and structure
 Score = 90.0 bits (221), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 34/213 (15%), Positives = 60/213 (28%), Gaps = 23/213 (10%)

Query: 295 SIVDQPSILKKIASVLKINQLLIVGSMRKELVDGRSHFYKSIYIINSKGEILASSNAKHL 354
              D   + K      K N  L +G +  +     +H + +  II+S G   A  N  HL
Sbjct: 71  MATDCEYMEKYRELARKHNIWLSLGGLHHKDPSDAAHPWNTHLIIDSDGVTRAEYNKLHL 130

Query: 355 VPFAEYLPYRNILKKLNLDFYMFPLDYSSSDISPLLGLSEKLRLYPLLFSDALFHQDINN 414
                    R +  + +           +      L +   +R   L           N 
Sbjct: 131 FDLEIPGKVRLMESEFSKAGTEMIPPVDTPIGRLGLSICYDVRFPELSLW--------NR 182

Query: 415 LENVSAILNIIDDSGFM-GSGTDHSFRYAQIQAVEIGLPLIRATNN----------GVSA 463
                 +      S F   +G  H     + +A+E    ++ A             G S 
Sbjct: 183 KRGAQLL---SFPSAFTLNTGLAHWETLLRARAIENQCYVVAAAQTGAHNPKRQSYGHSM 239

Query: 464 FLDERGQIISSVYADRGASIDMHFQPKVRDSFR 496
            +D  G +++     R             D+ R
Sbjct: 240 VVDPWGAVVAQCSE-RVDMCFAEIDLSYVDTLR 271


gi|16975399|pdb|1F89|A Chain A, Crystal Structure Of Saccharomyces Cerevisiae Nit3, A Member Of Branch 10 Of The Nitrilase Superfamily Length = 291 Back     alignment and structure
gi|218681558|pdb|2W1V|A Chain A, Crystal Structure Of Mouse Nitrilase-2 At 1.4a Resolution Length = 276 Back     alignment and structure
>gi|239782142|pdb|3HKX|A Chain A, Crystal Structure Analysis Of An Amidase From Nesterenkonia Sp Length = 283 Back     alignment and structure
gi|146386717|pdb|2PLQ|A Chain A, Crystal Structure Of The Amidase From Geobacillus Pallidus Rapc8 Length = 348 Back     alignment and structure
gi|157834834|pdb|2E11|A Chain A, The Crystal Structure Of Xc1258 From Xanthomonas Campestris: A Cn-Hydrolase Superfamily Protein With An Arsenic Adduct In The Active Site Length = 266 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target518 apolipoprotein N-acyltransferase [Candidatus Liberibact
1ems_A 440 Nitfhit, NIT-fragIle histidine triad fusion protein; WO 1e-07
>1ems_A Nitfhit, NIT-fragIle histidine triad fusion protein; WORM, nitrilase, nucleotide-binding protein, cancer; 2.80A {Caenorhabditis elegans} SCOP: d.13.1.1 d.160.1.1 Length = 440 Back     alignment and structure
 Score = 53.5 bits (128), Expect = 1e-07
 Identities = 43/267 (16%), Positives = 80/267 (29%), Gaps = 41/267 (15%)

Query: 255 AIKEDREKILERYLSLTALPVSAGELEPVIIVW------AYLPFPFSI-----VDQPSI- 302
               D EK  +   ++      AGE +  ++          L     I      D   + 
Sbjct: 23  TSDNDLEKNFQAAKNMIE---RAGEKKCEMVFLPECFDFIGLNKNEQIDLAMATDCEYME 79

Query: 303 -LKKIASVLKINQLLIVGSMRKELVDGRSHFYKSIYIINSKGEILASSNAKHLVPFAEYL 361
             +++A    I   L +G +  +     +H + +  II+S G   A  N  HL       
Sbjct: 80  KYRELARKHNIW--LSLGGLHHKDPSDAAHPWNTHLIIDSDGVTRAEYNKLHLFDLEIPG 137

Query: 362 PYRNILKKLNLDFYMFPLDYSSSDISPLLGLSEKLRLYPLLFSDALFHQDINNLENVSAI 421
             R           M      +         +   RL   +  D  F +         A 
Sbjct: 138 KVR----------LMESEFSKAGTEMIPPVDTPIGRLGLSICYDVRFPELSLWNRKRGAQ 187

Query: 422 LNIIDDSGFMGSGTDHSFRYAQIQAVEIGLPLIRATNNGV----------SAFLDERGQI 471
           L     +  + +G  H     + +A+E    ++ A   G           S  +D  G +
Sbjct: 188 LLSFPSAFTLNTGLAHWETLLRARAIENQCYVVAAAQTGAHNPKRQSYGHSMVVDPWGAV 247

Query: 472 ISSVYADRG---ASIDMHFQPKVRDSF 495
           ++          A ID+ +   +R+  
Sbjct: 248 VAQCSERVDMCFAEIDLSYVDTLREMQ 274


Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target518 apolipoprotein N-acyltransferase [Candidatus Liberibact
2dyu_A334 Formamidase; AMIF, CEK, catalytic triad, aliphatic amid 100.0
1uf5_A303 N-carbamyl-D-amino acid amidohydrolase; HET: CDT; 1.60A 100.0
2uxy_A341 Aliphatic amidase; nitrilase superfamily, hydrolase, ac 100.0
3hkx_A283 Amidase; alpha-beta-BETA-alpha:alpha-beta-BETA-alpha di 100.0
2vhh_A405 CG3027-PA; hydrolase; 2.8A {Drosophila melanogaster} PD 99.97
3ivz_A262 Nitrilase; alpha-beta sandwich, hydrolase; 1.57A {Pyroc 99.97
2e11_A266 Hydrolase; dimethylarsenic inhibitor complex, cacodylat 99.96
1ems_A 440 Nitfhit, NIT-fragIle histidine triad fusion protein; WO 99.96
2w1v_A276 Nitrilase-2, nitrilase homolog 2; hydrolase; 1.49A {Mus 99.96
1f89_A291 32.5 kDa protein YLR351C; nitrilase, dimer, structural 99.95
3n05_A 590 NH(3)-dependent NAD(+) synthetase; ligase, structural g 99.91
3dla_A 680 Glutamine-dependent NAD(+) synthetase; glutaminase, amm 99.86
3ilv_A 634 Glutamine-dependent NAD(+) synthetase; protein structur 99.84
>2dyu_A Formamidase; AMIF, CEK, catalytic triad, aliphatic amidase, hydrolase; 1.75A {Helicobacter pylori 26695} PDB: 2dyv_A 2e2l_A 2e2k_A Back     alignment and structure
Probab=100.00  E-value=3.2e-35  Score=246.60  Aligned_cols=227  Identities=13%  Similarity=0.065  Sum_probs=169.9

Q ss_pred             CCCCCCCCCCCCCCHH-HHHHHHHHHHHHHHHHHHCCCCCCCCCCEEEECCCCCCCCHHHH-----------HHHHHHHH
Q ss_conf             5553210012442035-55433335789987543101334668618983121011000112-----------34667765
Q gi|254780425|r  240 KISPVIRIVQPGINPA-IKEDREKILERYLSLTALPVSAGELEPVIIVWAYLPFPFSIVDQ-----------PSILKKIA  307 (518)
Q Consensus       240 ~~~~~V~iVQpni~~~-~k~~~~~~~~~~~~l~~~~~~~~~~~~dLiVWPEsa~p~~~~~~-----------~~~~~~l~  307 (518)
                      ..+++|++||.++++. .+.+.++..++..++.+.+ +++.+++|||||||.+++-+..+.           ....+.+.
T Consensus        11 ~~~~~Va~vQ~~v~~~~~~~d~~~n~~~i~~~i~~~-~A~~~gadLvVfPE~~~~Gy~~~~~~~~~~~~~~~~~~~~~l~   89 (334)
T 2dyu_A           11 IEGFLVAAIQFPVPIVNSRKDIDHNIESIIRTLHAT-KAGYPGVELIIFPEYSTQGLNTAKWLSEEFLLDVPGKETELYA   89 (334)
T ss_dssp             --CEEEEEECCBCCCCCSHHHHHHHHHHHHHHHHHH-HHHCTTEEEEECCTTTTTCCCTTTTTSGGGCBCSSSHHHHHHH
T ss_pred             CCCCEEEEEECCCCCCCCHHHHHHHHHHHHHHHHHH-HCCCCCCEEEECCCCCCCCCCCHHHHHHHHHHHCCCHHHHHHH
T ss_conf             743389999578677878899999999999999998-6056999899968786345883355658887768859999999


Q ss_pred             HHHCCCCEEEECCCCCCCCCCCCCEEEEEECCCCCCCCCCCCCCEEEEEHHHHHCCCCHHHHHHHHCCCCCCCCCCC-CC
Q ss_conf             64107982420110012345575121000036732122111256334221331001000012111001222210135-87
Q gi|254780425|r  308 SVLKINQLLIVGSMRKELVDGRSHFYKSIYIINSKGEILASSNAKHLVPFAEYLPYRNILKKLNLDFYMFPLDYSSS-DI  386 (518)
Q Consensus       308 ~~~~~~~~li~G~~~~~~~~~~~~~yNs~~~~~~~g~~~~~Y~K~~LVPFGEyiP~~~~~~~l~~~~~~~~~~~~~g-~~  386 (518)
                      +.++++...++++......+++.++|||+++++++|++..+|+|+|  ||+|+.|+                  .+| ..
T Consensus        90 ~~a~~~~~~iv~g~~e~~~~~~~~~yNsa~vi~~~G~i~~~yrK~~--p~~~~~~~------------------~~g~~~  149 (334)
T 2dyu_A           90 KACKEAKVYGVFSIMERNPDSNKNPYNTAIIIDPQGEIILKYRKLF--PWNPIEPW------------------YPGDLG  149 (334)
T ss_dssp             HHHHHHTCEEEEEEEECCSSTTSCCEEEEEEECTTSCEEEEEECSS--CCTTTCCC------------------CCCCSC
T ss_pred             HHHHHCCEEEEEECCEECCCCCCCEEEEEEEECCCCEEEEEEECCC--CCCHHHCC------------------CCCCCC
T ss_conf             9998779799963516414889837989999879973999994046--77601034------------------577788


Q ss_pred             CCCEEECCCCEEECCCCHHHHHHHHHHCC--CCCCEEEEECCCCCCCCCHHHHHHHHHHHHHHHCCCEEEEEECCCC---
Q ss_conf             76200012200102221666558888512--6997799962775576762899999999999972991999855970---
Q gi|254780425|r  387 SPLLGLSEKLRLYPLLFSDALFHQDINNL--ENVSAILNIIDDSGFMGSGTDHSFRYAQIQAVEIGLPLIRATNNGV---  461 (518)
Q Consensus       387 ~~~~~~~~~~~~~~~ICyE~~f~~~~r~~--~~a~~lvn~tNd~Wf~~s~~~qH~~~a~~RAiE~~r~~vra~ntGi---  461 (518)
                      .+++....+.++|.+||||..||+..|.+  +||++|+++||  |... ...||..++|.||+||+.++|.|.++|.   
T Consensus       150 ~~v~~~~~G~kiG~~IC~D~~fpe~~r~~a~~GAdlil~~sa--~~~~-~~~~~~~~~rarA~en~~~vv~aN~~G~~~~  226 (334)
T 2dyu_A          150 MPVCEGPGGSKLAVCICHDGMIPELAREAAYKGCNVYIRISG--YSTQ-VNDQWILTNRSNAWHNLMYTVSVNLAGYDNV  226 (334)
T ss_dssp             CCCEECGGGCEEEEEEGGGGGCHHHHHHHHHTTCSEEEEEES--SCTT-SHHHHHHHHHHHHHHHTCEEEEEECSBSSSS
T ss_pred             CCEEECCCCCEEEEEEECCCCCHHHHHHHHHCCCCEEEECCC--CCCC-CHHHHHHHHHHHHHHCCCEEEEECCCCCCCC
T ss_conf             735863688589999972643779999999889969996467--8997-3478999999999976975999877525799


Q ss_pred             ------CEEECCCCEEEEECCCCCCEEEEEEECCC
Q ss_conf             ------46998998087773899827999996067
Q gi|254780425|r  462 ------SAFLDERGQIISSVYADRGASIDMHFQPK  490 (518)
Q Consensus       462 ------S~~id~~G~i~~~~~~~~~~~l~~~v~~~  490 (518)
                            |++|||+|+++.+.+.++++++.+++-+.
T Consensus       227 ~~~~G~S~Ii~p~G~vla~~~~~~e~i~~aeiDl~  261 (334)
T 2dyu_A          227 FYYFGEGQICNFDGTTLVQGHRNPWEIVTGEIYPK  261 (334)
T ss_dssp             CCCCCEEEEECTTSCEEEECCCCTTCEEEEEECHH
T ss_pred             CEEEEEEEEECCCCCEEEECCCCCCEEEEEEEEHH
T ss_conf             27841039998998899980799988999998789



>1uf5_A N-carbamyl-D-amino acid amidohydrolase; HET: CDT; 1.60A {Agrobacterium SP} SCOP: d.160.1.2 PDB: 1uf4_A* 1uf7_A* 1uf8_A* 1erz_A 1fo6_A 2ggl_A 2ggk_A Back     alignment and structure
>2uxy_A Aliphatic amidase; nitrilase superfamily, hydrolase, acyl transfer, thiol enzymes, hydroxamic acid; HET: C3Y; 1.25A {Pseudomonas aeruginosa} PDB: 2plq_A Back     alignment and structure
>3hkx_A Amidase; alpha-beta-BETA-alpha:alpha-beta-BETA-alpha dimeric sandwich, hydrolase; 1.66A {Nesterenkonia SP} Back     alignment and structure
>2vhh_A CG3027-PA; hydrolase; 2.8A {Drosophila melanogaster} PDB: 2vhi_A Back     alignment and structure
>3ivz_A Nitrilase; alpha-beta sandwich, hydrolase; 1.57A {Pyrococcus abyssi GE5} PDB: 3iw3_A 1j31_A Back     alignment and structure
>2e11_A Hydrolase; dimethylarsenic inhibitor complex, cacodylate; 1.73A {Xanthomonas campestris PV} Back     alignment and structure
>1ems_A Nitfhit, NIT-fragIle histidine triad fusion protein; WORM, nitrilase, nucleotide-binding protein, cancer; 2.80A {Caenorhabditis elegans} SCOP: d.13.1.1 d.160.1.1 Back     alignment and structure
>2w1v_A Nitrilase-2, nitrilase homolog 2; hydrolase; 1.49A {Mus musculus} Back     alignment and structure
>1f89_A 32.5 kDa protein YLR351C; nitrilase, dimer, structural genomics, four layer sandwich, PSI, protein structure initiative; 2.40A {Saccharomyces cerevisiae} SCOP: d.160.1.1 Back     alignment and structure
>3n05_A NH(3)-dependent NAD(+) synthetase; ligase, structural genomics, protein structure initiative, P nysgrc; 2.35A {Streptomyces avermitilis} Back     alignment and structure
>3dla_A Glutamine-dependent NAD(+) synthetase; glutaminase, ammonia tunneling, enzyme, glutamine-amido transferase, ATP-binding, ligase; HET: NXX ONL; 2.35A {Mycobacterium tuberculosis} Back     alignment and structure
>3ilv_A Glutamine-dependent NAD(+) synthetase; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 1.79A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target518 apolipoprotein N-acyltransferase [Candidatus Liberibact
d1uf5a_303 N-carbamoyl-D-aminoacid amidohydrolase {Agrobacterium s 100.0
d1f89a_281 hypothetical protein yl85 {Baker's yeast (Saccharomyces 99.96
d1j31a_262 Hypothetical protein PH0642 {Archaeon Pyrococcus horiko 99.96
d1emsa2271 NIT-FHIT fusion protein, N-terminal domain {Nematode (C 99.95
>d1uf5a_ d.160.1.2 (A:) N-carbamoyl-D-aminoacid amidohydrolase {Agrobacterium sp. [TaxId: 361]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Carbon-nitrogen hydrolase
superfamily: Carbon-nitrogen hydrolase
family: Carbamilase
domain: N-carbamoyl-D-aminoacid amidohydrolase
species: Agrobacterium sp. [TaxId: 361]
Probab=100.00  E-value=4.5e-34  Score=237.55  Aligned_cols=244  Identities=15%  Similarity=0.160  Sum_probs=178.5

Q ss_pred             CCCCCCCCCCC-CCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCEEEECCCCCCCCHH-----H------------HHHH
Q ss_conf             55321001244-2035554333357899875431013346686189831210110001-----1------------2346
Q gi|254780425|r  241 ISPVIRIVQPG-INPAIKEDREKILERYLSLTALPVSAGELEPVIIVWAYLPFPFSIV-----D------------QPSI  302 (518)
Q Consensus       241 ~~~~V~iVQpn-i~~~~k~~~~~~~~~~~~l~~~~~~~~~~~~dLiVWPEsa~p~~~~-----~------------~~~~  302 (518)
                      .+++|+++|.+ +...  .+++..++++.++.+.   +.+.++|||||||.+++-+..     +            ....
T Consensus         2 ~~~~ia~~Q~~Pi~~~--~~~~~~l~r~~~li~~---A~~~gadlvvfPE~~l~Gy~~~~~~~~~~~~~~~~~~~~~~~~   76 (303)
T d1uf5a_           2 RQMILAVGQQGPIARA--ETREQVVVRLLDMLTK---AASRGANFIVFPELALTTFFPRWHFTDEAELDSFYETEMPGPV   76 (303)
T ss_dssp             CEEEEEEEEBCCCCTT--CCHHHHHHHHHHHHHH---HHHTTCSEEECCTTTTSCCGGGSCCCCHHHHHTTSBSSSSCTT
T ss_pred             CEEEEEEECCCCCCCC--CCHHHHHHHHHHHHHH---HHHCCCCEEECCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCHH
T ss_conf             4799999936776888--5899999999999999---9988893999277852358721001366677666655158789


Q ss_pred             HHHHHHHHCC-CCEEEECCCCCCCCCCCCCEEEEEECCCCCCCCCCCCCCEEEEEHHHHHCCCCHHHHHHHHCCCCCCCC
Q ss_conf             6776564107-982420110012345575121000036732122111256334221331001000012111001222210
Q gi|254780425|r  303 LKKIASVLKI-NQLLIVGSMRKELVDGRSHFYKSIYIINSKGEILASSNAKHLVPFAEYLPYRNILKKLNLDFYMFPLDY  381 (518)
Q Consensus       303 ~~~l~~~~~~-~~~li~G~~~~~~~~~~~~~yNs~~~~~~~g~~~~~Y~K~~LVPFGEyiP~~~~~~~l~~~~~~~~~~~  381 (518)
                      .+.+.+.+++ +..+++|.......++..++|||+++++++|++..+|+|+||+|++||.|++.+-..-.       ..+
T Consensus        77 ~~~~~~~A~~~~i~i~~G~~~~~~~~~~~~~yNs~~li~~~G~i~~~y~K~~L~~~~e~~~~~~~~~~e~-------~~~  149 (303)
T d1uf5a_          77 VRPLFEKAAELGIGFNLGYAELVVEGGVKRRFNTSILVDKSGKIVGKYRKIHLPGHKEYEAYRPFQHLEK-------RYF  149 (303)
T ss_dssp             THHHHHHHHHHTCEEEEEEEEEEEETTEEEEEEEEEEECTTSCEEEEEECCCCCSCSSCCTTCSSCCCHH-------HHC
T ss_pred             HHHHHHHHHHCCCEEEEEEEEEEEECCCCEEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-------CEE
T ss_conf             9999999986595699986543220589705899995156654323444202799765543332210134-------255


Q ss_pred             CCCCCCCCEEECCCCEEECCCCHHHHHHHHHHCC--CCCCEEEEECCCCCC-CC-----C-HHHHHHHHHHHHHHHCCCE
Q ss_conf             1358776200012200102221666558888512--699779996277557-67-----6-2899999999999972991
Q gi|254780425|r  382 SSSDISPLLGLSEKLRLYPLLFSDALFHQDINNL--ENVSAILNIIDDSGF-MG-----S-GTDHSFRYAQIQAVEIGLP  452 (518)
Q Consensus       382 ~~g~~~~~~~~~~~~~~~~~ICyE~~f~~~~r~~--~~a~~lvn~tNd~Wf-~~-----s-~~~qH~~~a~~RAiE~~r~  452 (518)
                      .+++........++.+++.+||||..||+..|.+  +|++++++++|..+. +.     . ...+|...++.||+||+.+
T Consensus       150 ~~~~~~~~~~~~~~~rig~~IC~D~~~pe~~~~la~~Ga~ii~~~~~~~~~~~~~~~~~~~~~~~~~~~~~arA~en~~~  229 (303)
T d1uf5a_         150 EPGDLGFPVYDVDAAKMGMFIANDRRWPEAWRVMGLRGAEIICGGYNTPTHNPPVPQHDHLTSFHHLLSMQAGSYQNGAW  229 (303)
T ss_dssp             CCCSSCSCEEEETTEEEEECCGGGGGCHHHHHHHHHTTCSEEEEEECCBSCCTTCGGGGGGHHHHHHHHHHHHHHHHTCE
T ss_pred             CCCCCCCEEEEECCCEEEEECCCCCHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCCHHHCCHHHHHHHHHHHCCCCE
T ss_conf             12577650588457278861122300257666676279889997035566677554420100101134555554305531


Q ss_pred             EEEEECC---------CCCEEECCCCEEEEECCCCCCEEEEEEECCCCCCCHH
Q ss_conf             9998559---------7046998998087773899827999996067687687
Q gi|254780425|r  453 LIRATNN---------GVSAFLDERGQIISSVYADRGASIDMHFQPKVRDSFR  496 (518)
Q Consensus       453 ~vra~nt---------GiS~~id~~G~i~~~~~~~~~~~l~~~v~~~~~~T~y  496 (518)
                      ++++.++         |.|+++||+|+++++.+.++++++.++|.+..-.+..
T Consensus       230 vv~~n~~g~~~~~~~~G~S~I~~p~G~vla~~~~~~e~vl~a~idl~~~~~~R  282 (303)
T d1uf5a_         230 SAAAGKAGMEENCMLLGHSCIVAPTGEIVALTTTLEDEVITAAVDLDRCRELR  282 (303)
T ss_dssp             EEEEEBCEEETTEEECCCCEEECTTSCEEEECCSSSSEEEEEEEEGGGGHHHH
T ss_pred             EEECCCCCCCCCCCCCCCCEEEECCCCEEEECCCCCCEEEEEEECHHHHHHHH
T ss_conf             43136422133531236758995999999877899887999998389999999



>d1f89a_ d.160.1.1 (A:) hypothetical protein yl85 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1j31a_ d.160.1.2 (A:) Hypothetical protein PH0642 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1emsa2 d.160.1.1 (A:10-280) NIT-FHIT fusion protein, N-terminal domain {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target518 apolipoprotein N-acyltransferase [Candidatus Liberibact
2vhh_A_36-359324 CG3027-PA; hydrolase; 2.8A {Drosophila melanogaste 100.0
1uf5_A_303 N-carbamyl-D-amino acid amidohydrolase; HET: CDT; 100.0
2dyu_A_1-283283 Formamidase; AMIF, CEK, catalytic triad, aliphatic 100.0
1f89_A_291 32.5 kDa protein YLR351C; nitrilase, dimer, struct 100.0
3hkx_A_283 Amidase; alpha-beta-BETA-alpha:alpha-beta-BETA-alp 100.0
2uxy_A_1-275275 Aliphatic amidase; nitrilase superfamily, hydrolas 100.0
1ems_A_1-285285 Nitfhit, NIT-fragIle histidine triad fusion protei 99.98
2w1v_A_276 Nitrilase-2, nitrilase homolog 2; hydrolase; 1.49A 99.97
3ilv_A_1-273273 Glutamine-dependent NAD(+) synthetase; protein str 99.97
3dla_A_1-322322 Glutamine-dependent NAD(+) synthetase; glutaminase 99.97
2e11_A_266 Hydrolase; dimethylarsenic inhibitor complex, caco 99.97
1j31_A_262 Hypothetical protein PH0642; alpha-beta-BETA-alpha 99.97
>2vhh_A (A:36-359) CG3027-PA; hydrolase; 2.8A {Drosophila melanogaster} PDB: 2vhi_A Back     alignment and structure
Probab=100.00  E-value=6.3e-40  Score=278.22  Aligned_cols=250  Identities=12%  Similarity=0.082  Sum_probs=196.3

Q ss_pred             CCCCCCCCCCCCCCCCCCCCHHHHHH----HHHHHHHHHHHHHHCCCCCCCCCCEEEECCCCCCCCHHHH----------
Q ss_conf             45665555532100124420355543----3335789987543101334668618983121011000112----------
Q gi|254780425|r  234 SSLKFEKISPVIRIVQPGINPAIKED----REKILERYLSLTALPVSAGELEPVIIVWAYLPFPFSIVDQ----------  299 (518)
Q Consensus       234 ~~~~~~~~~~~V~iVQpni~~~~k~~----~~~~~~~~~~l~~~~~~~~~~~~dLiVWPEsa~p~~~~~~----------  299 (518)
                      ......+..++|++||+|+++..++.    .+..++++.++.+   ++.+.++|+|||||.+++.+..++          
T Consensus        29 ~~~~~~~~~i~va~vQ~~i~~~~~~~~~~~~~~n~~~~~~~i~---~A~~~gadlvV~PE~~~~g~~~~~~~~~~~~~~~  105 (324)
T 2vhh_A           29 EEQTRKRRIVRVGAIQNSIVIPTTAPIEKQREAIWNKVKTMIK---AAAEAGCNIVCTQEAWTMPFAFCTREKFPWCEFA  105 (324)
T ss_dssp             CCSSSCCCEEEEEEEECCCCSCSSSCHHHHHHHHHHHHHHHHH---HHHHTTCSEEECCTTTTSCSCC---------CCC
T ss_pred             HHHCCCCCEEEEEEEECCCCCCCCCCHHHCHHHHHHHHHHHHH---HHHHCCCCEEECCCCCCCCCCCCCCCCCHHHHHH
T ss_conf             2124788458999983367777768612369999999999999---9998699399846213668985201255588874


Q ss_pred             -----HHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCEEEEEECCCCCCCCCCCCCCEEEEEHHHHHCCCCHHHHHHHHC
Q ss_conf             -----346677656410798242011001234557512100003673212211125633422133100100001211100
Q gi|254780425|r  300 -----PSILKKIASVLKINQLLIVGSMRKELVDGRSHFYKSIYIINSKGEILASSNAKHLVPFAEYLPYRNILKKLNLDF  374 (518)
Q Consensus       300 -----~~~~~~l~~~~~~~~~li~G~~~~~~~~~~~~~yNs~~~~~~~g~~~~~Y~K~~LVPFGEyiP~~~~~~~l~~~~  374 (518)
                           ....+.+.+.++++...++.+......+++.++||++++++++|++..+|+|+||.+++|..|..          
T Consensus       106 ~~~~~~~~~~~l~~~a~~~~~~i~~g~~~~~~~~~~~~~n~~~~~~~~g~~~~~~~K~~l~~~~~~~~~~----------  175 (324)
T 2vhh_A          106 EEAENGPTTKMLAELAKAYNMVIIHSILERDMEHGETIWNTAVVISNSGRYLGKHRKNHIPRVGDFNEST----------  175 (324)
T ss_dssp             BCTTTSHHHHHHHHHHHHTTCEEEEEEEEEETTTTTEEEEEEEEECTTSCEEEEEECSCCCC------------------
T ss_pred             HHCCCCHHHHHHHHHHHHCCCEEEEEEEEEECCCCCEEEEEEEECCCCCCEEEEEEEECCCCCCCCCCEE----------
T ss_conf             4427998999999999983948994113752377972553221125675022022133022322344202----------


Q ss_pred             CCCCCCCCCCCCCCCEEECCCCEEECCCCHHHHHHHHHHCC--CCCCEEEEECCCCCCCCCHHHHHHHHHHHHHHHCCCE
Q ss_conf             12222101358776200012200102221666558888512--6997799962775576762899999999999972991
Q gi|254780425|r  375 YMFPLDYSSSDISPLLGLSEKLRLYPLLFSDALFHQDINNL--ENVSAILNIIDDSGFMGSGTDHSFRYAQIQAVEIGLP  452 (518)
Q Consensus       375 ~~~~~~~~~g~~~~~~~~~~~~~~~~~ICyE~~f~~~~r~~--~~a~~lvn~tNd~Wf~~s~~~qH~~~a~~RAiE~~r~  452 (518)
                          ..+.+|...+++. .++.+++++||||..||+..|.+  +|+++++|++++++  ..+++||..+++.||+||+++
T Consensus       176 ----~~~~~g~~~~v~~-~~~~~~g~~ICyD~~~~e~~r~~~~~ga~lil~~~~~~~--~~~~~~~~~~~~~rA~e~~~~  248 (324)
T 2vhh_A          176 ----YYMEGNTGHPVFE-TEFGKLAVNICYGRHHPQNWMMFGLNGAEIVFNPSATIG--RLSEPLWSIEARNAAIANSYF  248 (324)
T ss_dssp             ------CCCCSCCCEEE-ETTEEEEECCGGGGGCHHHHHHHHHTTCSEEEEEECCBC--TTTHHHHHHHHHHHHHHHTSE
T ss_pred             ----EEEEECCCCCEEE-CCCCEEEEEECCCCCCCHHHHHHHHCCCCCEEEECCCCC--CCHHHHHHHHHHHHHHHCCCE
T ss_conf             ----3664025653056-488458610134554301012333035441232024555--526888888999999982983


Q ss_pred             EEEEECCCC-------------------------CEEECCCCEEEEECCCCCCEEEEEEECCCCCCCHHHHHHHHH
Q ss_conf             999855970-------------------------469989980877738998279999960676876878655689
Q gi|254780425|r  453 LIRATNNGV-------------------------SAFLDERGQIISSVYADRGASIDMHFQPKVRDSFRSSIQMRV  503 (518)
Q Consensus       453 ~vra~ntGi-------------------------S~~id~~G~i~~~~~~~~~~~l~~~v~~~~~~T~y~~~g~~~  503 (518)
                      ++|++|+|.                         |+++||+|+++++.+.++++++.+++.++...|.|.+||+|+
T Consensus       249 ~v~a~~~g~~~~~~~~~~~~~~~~~~~~~~~~G~S~i~~p~G~vl~~~~~~~~~~~~~~id~~~~~~~r~~~~~~~  324 (324)
T 2vhh_A          249 TVPINRVGTEQFPNEYTSGDGNKAHKEFGPFYGSSYVAAPDGSRTPSLSRDKDGLLVVELDLNLCRQVKDFWGFRM  324 (324)
T ss_dssp             EEEEECEECCCCC-----------------EECCCCCBCTTSCBCCCCCSSSCEEEEEEEETTHHHHHHHHHCTTT
T ss_pred             EEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCEEEEEEEEHHHHHHHHHHCCCCC
T ss_conf             9999522226776522333333356778713340599839987876048999889999974799999997688621



>1uf5_A (A:) N-carbamyl-D-amino acid amidohydrolase; HET: CDT; 1.60A {Agrobacterium SP} Back     alignment and structure
>2dyu_A (A:1-283) Formamidase; AMIF, CEK, catalytic triad, aliphatic amidase, hydrolase; 1.75A {Helicobacter pylori 26695} PDB: 2dyv_A 2e2l_A 2e2k_A Back     alignment and structure
>1f89_A (A:) 32.5 kDa protein YLR351C; nitrilase, dimer, structural genomics, four layer sandwich, PSI, protein structure initiative; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3hkx_A (A:) Amidase; alpha-beta-BETA-alpha:alpha-beta-BETA-alpha dimeric sandwich, hydrolase; 1.66A {Nesterenkonia SP} Back     alignment and structure
>2uxy_A (A:1-275) Aliphatic amidase; nitrilase superfamily, hydrolase, acyl transfer, thiol enzymes, hydroxamic acid; HET: C3Y; 1.25A {Pseudomonas aeruginosa} PDB: 2plq_A Back     alignment and structure
>1ems_A (A:1-285) Nitfhit, NIT-fragIle histidine triad fusion protein; WORM, nitrilase, nucleotide-binding protein, cancer; 2.80A {Caenorhabditis elegans} Back     alignment and structure
>2w1v_A (A:) Nitrilase-2, nitrilase homolog 2; hydrolase; 1.49A {Mus musculus} Back     alignment and structure
>3ilv_A (A:1-273) Glutamine-dependent NAD(+) synthetase; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 1.79A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>3dla_A (A:1-322) Glutamine-dependent NAD(+) synthetase; glutaminase, ammonia tunneling, enzyme, glutamine-amido transferase, ATP-binding, ligase; HET: NXX ONL; 2.35A {Mycobacterium tuberculosis} Back     alignment and structure
>2e11_A (A:) Hydrolase; dimethylarsenic inhibitor complex, cacodylate; 1.73A {Xanthomonas campestris PV} Back     alignment and structure
>1j31_A (A:) Hypothetical protein PH0642; alpha-beta-BETA-alpha sandwich, structural genomics, unknown function; 1.60A {Pyrococcus horikoshii OT3} Back     alignment and structure