254780426

254780426

hemolysin protein

GeneID in NCBI database:8209412Locus tag:CLIBASIA_01555
Protein GI in NCBI database:254780426Protein Accession:YP_003064839.1
Gene range:-(333266, 334228)Protein Length:320aa
Gene description:hemolysin protein
COG prediction:[R] Hemolysins and related proteins containing CBS domains
KEGG prediction:hemolysin protein
SEED prediction:Magnesium and cobalt efflux protein CorC
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Phosphate metabolism;
Copper homeostasis: copper tolerance
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320
MMSDFKINSSEHPKEKNEGIDLSPSISKTSVPAFWTRTIRALCKTWKLMKLSHHKGIRLPRIDASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRIRRLVHFKN
ccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHcccEEEEEEEEEHHEEEEEcccccHHHHHHHHHHccccEEEEEccccccEEEEEEHHHHHHHHHHcccccccccccccccHHHHccccEEEcccccHHHHHHHHHHccccEEEEEEccccEEEEEEHHHHHHHHHcccccccccccHHEEEEcccEEEEEccccHHHHHHHHcccccccccccccccHHHHHHHHHccccccccEEEEEccEEEEEEEEcccEEEEEEEEEcccccc
ccccccccEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHccccccHHHEEcccccEEEEcccccHHHHHHHHHHccccccEEcccccccEEEEEEHHHHHHHHHHcccccccccccccccHHHHcccccEccccccHHHHHHHHHHccccEEEEEEccccccccEEHHHHHHHHHcccccccccccccEEEcccccEEEEcEEcHHHHHHHcccccccccccccccHHHHHHHHHcccccccccEEEEEccEEEEEEEccccEEEEEEEEEcccccc
mmsdfkinssehpkeknegidlspsisktsvpaFWTRTIRALCKTWKLMKlshhkgirlpridaslegiFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGrswmpvyknsldnprgmvhMRDVISYISHMYAKtnninlniqlsesnliknilfvpssmlVSDLLTNIQESRIRMALVIDehggtdglvSYEDIVSVLMRDItsehhskksMISAVSDNTFIVDARTDLEELAKIIGtdcnclkgeqdvdslgGLIFSVLDripargevvleipgfeIVILDADVRCVRRVRIRRLVHFKN
mmsdfkinssehpkeknegidlspsisktsvpafWTRTIRALCKTWKLMKlshhkgirlpridASLEGIFSETEKEIFNNILRfrkiriddimisrvsinavedkaTVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSehhskksmisavsdnTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVleipgfeivildadvrcvRRVRIRRLVHFKN
MMSDFKINSSEHPKEKNEGIDLSPSISKTSVPAFWTRTIRALCKTWKLMKLSHHKGIRLPRIDASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADvrcvrrvrirrlvHFKN
**********************************WTRTIRAL******************************TEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVR**RL*****
*******************IDLSPSISKTSVPAFWTRTIRALCKTWKLMKLSHHKGIRLPRIDASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRIRRLVHFKN
************PKEKNEGIDLSPSISKTSVPAFWTRTIRALCKTWKLMKLSHHKGIRLPRIDASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRIRRLV****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMSDFKINSSEHPKEKNEGIDLSPSISKTSVPAFWTRTIRALCKTWKLMKLSHHKGIRLPRIDASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRIRRLVHFKN
MMSDFKINSSEHPKEKNEGIDLSPSISKTSVPAFWTRTIRALCKTWKLMKLSHHKGIRLPRIDASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRIRRLVHFKN
MMSDFKINSSEHPKEKNEGIDLSPSISKTSVPAFWTRTIRALCKTWKLMKLSHHKGIRLPRIDASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVILDADVRCVRRVRIRRLVHFKN

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target320 hemolysin protein [Candidatus Liberibacter asiaticus st
255764470523 integral membrane protein TerC [Candidatus Liberib 4e-09
254780889 493 inosine 5'-monophosphate dehydrogenase [Candidatus 0.001
>gi|255764470|ref|YP_003064828.2| integral membrane protein TerC [Candidatus Liberibacter asiaticus str. psy62] Length = 523 Back     alignment
 Score = 53.9 bits (128), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 59/248 (23%), Positives = 110/248 (44%), Gaps = 16/248 (6%)

Query: 69  IFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGRSWMPVYKN 128
           I S+ EK++  ++L         IM  R  I  ++      +      + G S  PV + 
Sbjct: 286 IISDQEKDMVQSVLTLADRPAKSIMTPRTEIVWLDVNCVDEDLQWKILELGHSRFPVAQG 345

Query: 129 SLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLVSDLLTNIQ 188
           SLD+  G+V  RD++  +          ++N + S    I+  L V  ++ V  L+  ++
Sbjct: 346 SLDSFIGIVSARDLLRDL------LEEGSMNFKRS----IRKPLVVHENISVLKLMERLR 395

Query: 189 ESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDL 248
           +S     +V+DE+G  +G+++  +I+  +  D   E   K   I+   D +  VD   D+
Sbjct: 396 KSSQTFVMVLDEYGVLEGMITPANILEAIAGDFPDEDDQKLD-ITVGDDGSLTVDGWIDV 454

Query: 249 EELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIP-GFEIVILDADVRCV 307
              +K+ G   N +  +    +L G I   L  +P   E+  E+   FEI+ L+     +
Sbjct: 455 RYASKLFG--VNLVDEDDRYSTLAGFILWRLGHLPQEKEIFTEMNLKFEIIRLEG--HNI 510

Query: 308 RRVRIRRL 315
            RV++  L
Sbjct: 511 DRVKVSGL 518

>gi|254780889|ref|YP_003065302.1| inosine 5'-monophosphate dehydrogenase [Candidatus Liberibacter asiaticus str. psy62] Length = 493 Back     alignment
 Score = 35.4 bits (80), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/140 (25%), Positives = 67/140 (47%), Gaps = 14/140 (10%)

Query: 106 ATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSES 165
           AT+ +A+ + +KY  S +PV ++ +    G++  RDV                N Q +  
Sbjct: 109 ATLADALALMKKYSISGIPVVESDVGKLVGILTNRDV------------RFASNAQQAVG 156

Query: 166 NLI-KNILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIV-SVLMRDITS 223
            L+ +N++ V  ++ + +    + + RI   LV+D+ G   GL++ +DI  S L  + T 
Sbjct: 157 ELMTRNLITVKKTVNLENAKALLHQHRIEKLLVVDDDGCCIGLITVKDIERSQLNPNATK 216

Query: 224 EHHSKKSMISAVSDNTFIVD 243
           +   +  + +AVS    I D
Sbjct: 217 DSKGRLRVAAAVSVAKDIAD 236

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target320 hemolysin protein [Candidatus Liberibacter asiaticus st
315122128319 hemolysin protein [Candidatus Liberibacter solanacearum 1 1e-123
227820631386 putative hemolysin-related protein [Sinorhizobium fredi 1 6e-66
15964161387 hypothetical protein SMc01112 [Sinorhizobium meliloti 1 1 2e-65
222084696388 hemolysin protein [Agrobacterium radiobacter K84] Lengt 1 3e-65
116250161381 hemolysin-like protein [Rhizobium leguminosarum bv. vic 1 4e-64
325291793381 hemolysin [Agrobacterium sp. H13-3] Length = 381 1 7e-64
159184275380 hemolysin [Agrobacterium tumefaciens str. C58] Length = 1 8e-64
241202782377 CBS domain containing protein [Rhizobium leguminosarum 1 1e-63
222147354345 hemolysin [Agrobacterium vitis S4] Length = 345 1 5e-63
209547628383 transporter [Rhizobium leguminosarum bv. trifolii WSM23 1 1e-62
>gi|315122128|ref|YP_004062617.1| hemolysin protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 319 Back     alignment and organism information
 Score =  445 bits (1144), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 222/303 (73%), Positives = 254/303 (83%), Gaps = 1/303 (0%)

Query: 1   MMSDFKINSSEHPKEKNEGIDLSPSISKTSVPAFWTRTIRALCKTWKLMKLSHHKGIRLP 60
           MM DFK NSSE+PKEKNE IDLS SISK  + +FW R +RA  K WK  +L+H + +R  
Sbjct: 1   MMGDFKTNSSEYPKEKNENIDLSYSISKIPLDSFWNRFLRAWYKIWK-PRLNHQRDVRSL 59

Query: 61  RIDASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVEDKATVYEAMLMFEKYGR 120
             D +L+ + S  EKEIF N+L+FR+IRI DIMI RVSI+AVE+KAT+ E M+MFEKYG+
Sbjct: 60  WTDCALDDMLSAVEKEIFENVLQFREIRIGDIMIPRVSISAVEEKATISEVMMMFEKYGK 119

Query: 121 SWMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLIKNILFVPSSMLV 180
           SWMPVY NSLDNPRGMVHMRD++SYI+ +Y    NINLN  LSESNLIK+ILFVPSSML 
Sbjct: 120 SWMPVYSNSLDNPRGMVHMRDLLSYIARIYLDIENINLNTTLSESNLIKDILFVPSSMLA 179

Query: 181 SDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTF 240
           SDLL  IQES + MALVIDEHGGTDGLVS+ DIVSVL+ DITSEH+S K MISAVSDNTF
Sbjct: 180 SDLLRKIQESGVHMALVIDEHGGTDGLVSHRDIVSVLVGDITSEHNSIKEMISAVSDNTF 239

Query: 241 IVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDRIPARGEVVLEIPGFEIVIL 300
           IVDARTDLEELAKIIG DC+ LKGEQDVDSLGGLIFSVLDRIPARGEV+L+IPGFEIVIL
Sbjct: 240 IVDARTDLEELAKIIGADCDSLKGEQDVDSLGGLIFSVLDRIPARGEVILDIPGFEIVIL 299

Query: 301 DAD 303
           D+D
Sbjct: 300 DSD 302


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|227820631|ref|YP_002824601.1| putative hemolysin-related protein [Sinorhizobium fredii NGR234] Length = 386 Back     alignment and organism information
>gi|15964161|ref|NP_384514.1| hypothetical protein SMc01112 [Sinorhizobium meliloti 1021] Length = 387 Back     alignment and organism information
>gi|222084696|ref|YP_002543225.1| hemolysin protein [Agrobacterium radiobacter K84] Length = 388 Back     alignment and organism information
>gi|116250161|ref|YP_765999.1| hemolysin-like protein [Rhizobium leguminosarum bv. viciae 3841] Length = 381 Back     alignment and organism information
>gi|325291793|ref|YP_004277657.1| hemolysin [Agrobacterium sp. H13-3] Length = 381 Back     alignment and organism information
>gi|159184275|ref|NP_353391.2| hemolysin [Agrobacterium tumefaciens str. C58] Length = 380 Back     alignment and organism information
>gi|241202782|ref|YP_002973878.1| CBS domain containing protein [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 377 Back     alignment and organism information
>gi|222147354|ref|YP_002548311.1| hemolysin [Agrobacterium vitis S4] Length = 345 Back     alignment and organism information
>gi|209547628|ref|YP_002279545.1| transporter [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 383 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target320 hemolysin protein [Candidatus Liberibacter asiaticus st
COG4536423 COG4536, CorB, Putative Mg2+ and Co2+ transporter CorB 3e-29
COG4535293 COG4535, CorC, Putative Mg2+ and Co2+ transporter CorC 6e-29
TIGR03520408 TIGR03520, GldE, gliding motility-associated protein Gl 8e-28
PRK15094292 PRK15094, PRK15094, magnesium/cobalt efflux protein Cor 6e-19
PRK11573413 PRK11573, PRK11573, hypothetical protein; Provisional 5e-15
COG1253429 COG1253, TlyC, Hemolysins and related proteins containi 3e-47
cd04590111 cd04590, CBS_pair_CorC_HlyC_assoc, This cd contains two 1e-18
cd02205113 cd02205, CBS_pair, The CBS domain, named after human CB 2e-04
pfam0347180 pfam03471, CorC_HlyC, Transporter associated domain 2e-13
pfam0057157 pfam00571, CBS, CBS domain 0.002
cd02205113 cd02205, CBS_pair, The CBS domain, named after human CB 0.004
cd04613114 cd04613, CBS_pair_SpoIVFB_EriC_assoc2, This cd contains 0.004
>gnl|CDD|34183 COG4536, CorB, Putative Mg2+ and Co2+ transporter CorB [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|34182 COG4535, CorC, Putative Mg2+ and Co2+ transporter CorC [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|132559 TIGR03520, GldE, gliding motility-associated protein GldE Back     alignment and domain information
>gnl|CDD|185050 PRK15094, PRK15094, magnesium/cobalt efflux protein CorC; Provisional Back     alignment and domain information
>gnl|CDD|183209 PRK11573, PRK11573, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|31445 COG1253, TlyC, Hemolysins and related proteins containing CBS domains [General function prediction only] Back     alignment and domain information
>gnl|CDD|73090 cd04590, CBS_pair_CorC_HlyC_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain Back     alignment and domain information
>gnl|CDD|73081 cd02205, CBS_pair, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|146225 pfam03471, CorC_HlyC, Transporter associated domain Back     alignment and domain information
>gnl|CDD|144238 pfam00571, CBS, CBS domain Back     alignment and domain information
>gnl|CDD|73081 cd02205, CBS_pair, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|73113 cd04613, CBS_pair_SpoIVFB_EriC_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 320 hemolysin protein [Candidatus Liberibacter asiaticus st
TIGR03520408 GldE gliding motility-associated protein GldE. Members 100.0
PRK11573413 hypothetical protein; Provisional 100.0
COG1253429 TlyC Hemolysins and related proteins containing CBS dom 100.0
COG4536423 CorB Putative Mg2+ and Co2+ transporter CorB [Inorganic 100.0
COG4535293 CorC Putative Mg2+ and Co2+ transporter CorC [Inorganic 100.0
cd04590111 CBS_pair_CorC_HlyC_assoc This cd contains two tandem re 99.93
cd04596108 CBS_pair_DRTGG_assoc This cd contains two tandem repeat 99.7
cd04639111 CBS_pair_26 The CBS domain, named after human CBS, is a 99.67
cd04631125 CBS_pair_18 The CBS domain, named after human CBS, is a 99.66
cd04610107 CBS_pair_ParBc_assoc This cd contains two tandem repeat 99.58
cd04600124 CBS_pair_HPP_assoc This cd contains two tandem repeats 99.57
cd04611111 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two tand 99.56
cd04635122 CBS_pair_22 The CBS domain, named after human CBS, is a 99.55
cd04632128 CBS_pair_19 The CBS domain, named after human CBS, is a 99.55
cd04588110 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains two 99.55
cd04612111 CBS_pair_SpoIVFB_EriC_assoc This cd contains two tandem 99.55
cd04585122 CBS_pair_ACT_assoc2 This cd contains two tandem repeats 99.55
cd04643116 CBS_pair_30 The CBS domain, named after human CBS, is a 99.53
cd04803122 CBS_pair_15 The CBS domain, named after human CBS, is a 99.53
cd04613114 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two tande 99.52
cd04594104 CBS_pair_EriC_assoc_archaea This cd contains two tandem 99.52
COG4109432 Predicted transcriptional regulator containing CBS doma 99.51
cd04642126 CBS_pair_29 The CBS domain, named after human CBS, is a 99.51
cd04624112 CBS_pair_11 The CBS domain, named after human CBS, is a 99.49
cd04622113 CBS_pair_9 The CBS domain, named after human CBS, is a 99.49
cd04637122 CBS_pair_24 The CBS domain, named after human CBS, is a 99.48
cd04627123 CBS_pair_14 The CBS domain, named after human CBS, is a 99.48
cd04586135 CBS_pair_BON_assoc This cd contains two tandem repeats 99.47
cd04633121 CBS_pair_20 The CBS domain, named after human CBS, is a 99.47
cd04601110 CBS_pair_IMPDH This cd contains two tandem repeats of t 99.47
cd04621135 CBS_pair_8 The CBS domain, named after human CBS, is a 99.47
cd04604114 CBS_pair_KpsF_GutQ_assoc This cd contains two tandem re 99.46
cd04609110 CBS_pair_PALP_assoc2 This cd contains two tandem repeat 99.46
cd04584121 CBS_pair_ACT_assoc This cd contains two tandem repeats 99.44
cd04623113 CBS_pair_10 The CBS domain, named after human CBS, is a 99.44
cd04636132 CBS_pair_23 The CBS domain, named after human CBS, is a 99.44
cd04619114 CBS_pair_6 The CBS domain, named after human CBS, is a 99.44
cd04634143 CBS_pair_21 The CBS domain, named after human CBS, is a 99.44
cd04629114 CBS_pair_16 The CBS domain, named after human CBS, is a 99.43
cd04630114 CBS_pair_17 The CBS domain, named after human CBS, is a 99.43
cd04638106 CBS_pair_25 The CBS domain, named after human CBS, is a 99.43
cd04605110 CBS_pair_MET2_assoc This cd contains two tandem repeats 99.43
cd04626111 CBS_pair_13 The CBS domain, named after human CBS, is a 99.43
cd04641120 CBS_pair_28 The CBS domain, named after human CBS, is a 99.43
cd04615113 CBS_pair_2 The CBS domain, named after human CBS, is a 99.42
cd04625112 CBS_pair_12 The CBS domain, named after human CBS, is a 99.42
COG2524294 Predicted transcriptional regulator, contains C-termina 99.39
cd04593115 CBS_pair_EriC_assoc_bac_arch This cd contains two tande 99.38
cd04595110 CBS_pair_DHH_polyA_Pol_assoc This cd contains two tande 99.38
cd04587113 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains two t 99.38
cd04583109 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tandem r 99.38
cd04599105 CBS_pair_GGDEF_assoc2 This cd contains two tandem repea 99.37
cd04801114 CBS_pair_M50_like This cd contains two tandem repeats o 99.37
cd04602114 CBS_pair_IMPDH_2 This cd contains two tandem repeats of 99.36
cd04582106 CBS_pair_ABC_OpuCA_assoc This cd contains two tandem re 99.36
cd04620115 CBS_pair_7 The CBS domain, named after human CBS, is a 99.36
cd04589111 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains two t 99.34
cd04802112 CBS_pair_3 The CBS domain, named after human CBS, is a 99.33
cd04607113 CBS_pair_NTP_transferase_assoc This cd contains two tan 99.32
cd04800111 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains two 99.3
cd04606109 CBS_pair_Mg_transporter This cd contains two tandem rep 99.29
PRK01862583 putative voltage-gated ClC-type chloride channel ClcB; 99.26
cd04617118 CBS_pair_4 The CBS domain, named after human CBS, is a 99.25
cd04603111 CBS_pair_KefB_assoc This cd contains two tandem repeats 99.24
cd0461496 CBS_pair_1 The CBS domain, named after human CBS, is a 99.22
cd04591105 CBS_pair_EriC_assoc_euk_bac This cd contains two tandem 99.18
cd04598119 CBS_pair_GGDEF_assoc This cd contains two tandem repeat 99.13
PRK11543321 gutQ D-arabinose 5-phosphate isomerase; Provisional 99.11
cd04640126 CBS_pair_27 The CBS domain, named after human CBS, is a 99.11
cd02205113 CBS_pair The CBS domain, named after human CBS, is a sm 99.1
cd04608124 CBS_pair_PALP_assoc This cd contains two tandem repeats 99.0
PRK05567 486 inositol-5'-monophosphate dehydrogenase; Reviewed 98.99
PRK10892326 D-arabinose 5-phosphate isomerase; Provisional 98.99
KOG1764381 consensus 98.78
COG0517117 FOG: CBS domain [General function prediction only] 98.72
COG2905 610 Predicted signal-transduction protein containing cAMP-b 98.71
PRK10070400 glycine betaine transporter ATP-binding subunit; Provis 98.7
KOG0474762 consensus 98.52
cd04592133 CBS_pair_EriC_assoc_euk This cd contains two tandem rep 98.37
TIGR01137527 cysta_beta cystathionine beta-synthase; InterPro: IPR00 98.2
TIGR01186372 proV glycine betaine/L-proline transport ATP binding su 98.08
KOG0475696 consensus 97.94
cd0461898 CBS_pair_5 The CBS domain, named after human CBS, is a 97.88
KOG2550 503 consensus 97.72
COG4175386 ProV ABC-type proline/glycine betaine transport system, 96.7
TIGR01303 476 IMP_DH_rel_1 IMP dehydrogenase family protein; InterPro 95.58
KOG2118498 consensus 99.77
pfam0347180 CorC_HlyC Transporter associated domain. This small dom 99.7
COG3263574 NhaP-type Na+/H+ and K+/H+ antiporters with a unique C- 96.53
COG3448382 CBS-domain-containing membrane protein [Signal transduc 99.57
COG2239451 MgtE Mg/Co/Ni transporter MgtE (contains CBS domain) [I 99.18
COG3620187 Predicted transcriptional regulator with C-terminal CBS 98.93
TIGR00393272 kpsF sugar isomerase, KpsF/GutQ family; InterPro: IPR00 98.2
TIGR00400 460 mgtE magnesium transporter; InterPro: IPR006669 This is 97.1
TIGR01302 476 IMP_dehydrog inosine-5'-monophosphate dehydrogenase; In 99.5
PRK07107 497 inositol-5-monophosphate dehydrogenase; Validated 99.22
PRK07807 479 inositol-5-monophosphate dehydrogenase; Validated 99.07
PTZ00314 499 inosine-5'-monophosphate dehydrogenase; Provisional 99.01
pfam00478 467 IMPDH IMP dehydrogenase / GMP reductase domain. This fa 98.57
KOG1764381 consensus 97.95
TIGR01302476 IMP_dehydrog inosine-5'-monophosphate dehydrogenase; In 98.42
cd04617118 CBS_pair_4 The CBS domain, named after human CBS, is a 98.24
cd04593115 CBS_pair_EriC_assoc_bac_arch This cd contains two tande 98.17
cd04640126 CBS_pair_27 The CBS domain, named after human CBS, is a 98.14
cd04633121 CBS_pair_20 The CBS domain, named after human CBS, is a 98.14
cd04623113 CBS_pair_10 The CBS domain, named after human CBS, is a 98.11
cd04586135 CBS_pair_BON_assoc This cd contains two tandem repeats 98.09
cd04637122 CBS_pair_24 The CBS domain, named after human CBS, is a 98.07
cd04621135 CBS_pair_8 The CBS domain, named after human CBS, is a 98.07
cd04600124 CBS_pair_HPP_assoc This cd contains two tandem repeats 98.07
cd04803122 CBS_pair_15 The CBS domain, named after human CBS, is a 98.05
cd04615113 CBS_pair_2 The CBS domain, named after human CBS, is a 98.04
cd04641120 CBS_pair_28 The CBS domain, named after human CBS, is a 98.04
cd04643116 CBS_pair_30 The CBS domain, named after human CBS, is a 97.99
cd04627123 CBS_pair_14 The CBS domain, named after human CBS, is a 97.99
cd04584121 CBS_pair_ACT_assoc This cd contains two tandem repeats 97.97
cd04595110 CBS_pair_DHH_polyA_Pol_assoc This cd contains two tande 97.94
cd04632128 CBS_pair_19 The CBS domain, named after human CBS, is a 97.94
pfam0057157 CBS CBS domain. CBS domains are small intracellular mod 97.93
cd04638106 CBS_pair_25 The CBS domain, named after human CBS, is a 97.92
cd04597113 CBS_pair_DRTGG_assoc2 This cd contains two tandem repea 97.92
smart0011649 CBS Domain in cystathionine beta-synthase and other pro 97.86
cd04585122 CBS_pair_ACT_assoc2 This cd contains two tandem repeats 97.86
cd04620115 CBS_pair_7 The CBS domain, named after human CBS, is a 97.85
cd04635122 CBS_pair_22 The CBS domain, named after human CBS, is a 97.85
cd04611111 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two tand 97.84
cd04631125 CBS_pair_18 The CBS domain, named after human CBS, is a 97.84
cd04583109 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tandem r 97.83
cd04610107 CBS_pair_ParBc_assoc This cd contains two tandem repeat 97.82
cd04634143 CBS_pair_21 The CBS domain, named after human CBS, is a 97.82
cd04605110 CBS_pair_MET2_assoc This cd contains two tandem repeats 97.79
cd04592133 CBS_pair_EriC_assoc_euk This cd contains two tandem rep 97.79
cd04596108 CBS_pair_DRTGG_assoc This cd contains two tandem repeat 97.77
cd04639111 CBS_pair_26 The CBS domain, named after human CBS, is a 97.77
cd04601110 CBS_pair_IMPDH This cd contains two tandem repeats of t 97.74
PRK10892326 D-arabinose 5-phosphate isomerase; Provisional 97.66
cd04603111 CBS_pair_KefB_assoc This cd contains two tandem repeats 97.59
cd04582106 CBS_pair_ABC_OpuCA_assoc This cd contains two tandem re 97.55
cd04642126 CBS_pair_29 The CBS domain, named after human CBS, is a 97.52
PRK11543321 gutQ D-arabinose 5-phosphate isomerase; Provisional 97.39
cd0461496 CBS_pair_1 The CBS domain, named after human CBS, is a 97.26
TIGR03415382 ABC_choXWV_ATP choline ABC transporter, ATP-binding pro 96.85
COG0517117 FOG: CBS domain [General function prediction only] 96.13
COG2239 451 MgtE Mg/Co/Ni transporter MgtE (contains CBS domain) [I 94.16
COG3620187 Predicted transcriptional regulator with C-terminal CBS 94.04
TIGR03520408 GldE gliding motility-associated protein GldE. Members 93.97
cd04629114 CBS_pair_16 The CBS domain, named after human CBS, is a 98.22
cd04624112 CBS_pair_11 The CBS domain, named after human CBS, is a 98.14
cd04613114 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two tande 98.11
cd04598119 CBS_pair_GGDEF_assoc This cd contains two tandem repeat 98.0
cd04604114 CBS_pair_KpsF_GutQ_assoc This cd contains two tandem re 97.94
cd04608124 CBS_pair_PALP_assoc This cd contains two tandem repeats 97.93
cd04800111 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains two 97.93
cd04801114 CBS_pair_M50_like This cd contains two tandem repeats o 97.9
cd04588110 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains two 97.9
cd04612111 CBS_pair_SpoIVFB_EriC_assoc This cd contains two tandem 97.84
cd04607113 CBS_pair_NTP_transferase_assoc This cd contains two tan 97.76
cd04609110 CBS_pair_PALP_assoc2 This cd contains two tandem repeat 97.72
PRK01862583 putative voltage-gated ClC-type chloride channel ClcB; 97.49
cd02205113 CBS_pair The CBS domain, named after human CBS, is a sm 97.41
cd04590111 CBS_pair_CorC_HlyC_assoc This cd contains two tandem re 96.73
COG2524294 Predicted transcriptional regulator, contains C-termina 96.2
TIGR01137527 cysta_beta cystathionine beta-synthase; InterPro: IPR00 93.11
TIGR00393272 kpsF sugar isomerase, KpsF/GutQ family; InterPro: IPR00 91.35
cd04625112 CBS_pair_12 The CBS domain, named after human CBS, is a 98.21
cd04622113 CBS_pair_9 The CBS domain, named after human CBS, is a 98.16
cd04587113 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains two t 98.16
cd04619114 CBS_pair_6 The CBS domain, named after human CBS, is a 98.15
cd04630114 CBS_pair_17 The CBS domain, named after human CBS, is a 98.14
cd04589111 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains two t 98.14
cd04626111 CBS_pair_13 The CBS domain, named after human CBS, is a 98.09
cd04602114 CBS_pair_IMPDH_2 This cd contains two tandem repeats of 98.08
cd04594104 CBS_pair_EriC_assoc_archaea This cd contains two tandem 98.01
PRK07107 497 inositol-5-monophosphate dehydrogenase; Validated 97.94
cd04802112 CBS_pair_3 The CBS domain, named after human CBS, is a 97.88
cd04599105 CBS_pair_GGDEF_assoc2 This cd contains two tandem repea 97.68
cd04597113 CBS_pair_DRTGG_assoc2 This cd contains two tandem repea 97.67
cd04606109 CBS_pair_Mg_transporter This cd contains two tandem rep 97.66
pfam0057157 CBS CBS domain. CBS domains are small intracellular mod 97.57
smart0011649 CBS Domain in cystathionine beta-synthase and other pro 97.54
COG2905 610 Predicted signal-transduction protein containing cAMP-b 97.3
PRK05567 486 inositol-5'-monophosphate dehydrogenase; Reviewed 97.07
PRK07807 479 inositol-5-monophosphate dehydrogenase; Validated 97.01
PTZ00314 499 inosine-5'-monophosphate dehydrogenase; Provisional 96.87
cd04591105 CBS_pair_EriC_assoc_euk_bac This cd contains two tandem 96.63
pfam00478467 IMPDH IMP dehydrogenase / GMP reductase domain. This fa 96.07
KOG2550 503 consensus 91.69
cd04636132 CBS_pair_23 The CBS domain, named after human CBS, is a 98.19
COG4109432 Predicted transcriptional regulator containing CBS doma 96.3
PRK11573413 hypothetical protein; Provisional 94.16
PRK05326563 potassium/proton antiporter; Reviewed 97.71
pfam01595182 DUF21 Domain of unknown function DUF21. This transmembr 96.9
COG3448382 CBS-domain-containing membrane protein [Signal transduc 96.87
PRK10070400 glycine betaine transporter ATP-binding subunit; Provis 95.74
TIGR01186372 proV glycine betaine/L-proline transport ATP binding su 90.48
>TIGR03520 GldE gliding motility-associated protein GldE Back     alignment and domain information
>PRK11573 hypothetical protein; Provisional Back     alignment and domain information
>COG1253 TlyC Hemolysins and related proteins containing CBS domains [General function prediction only] Back     alignment and domain information
>COG4536 CorB Putative Mg2+ and Co2+ transporter CorB [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4535 CorC Putative Mg2+ and Co2+ transporter CorC [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd04590 CBS_pair_CorC_HlyC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain Back     alignment and domain information
>cd04596 CBS_pair_DRTGG_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream Back     alignment and domain information
>cd04639 CBS_pair_26 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04631 CBS_pair_18 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04610 CBS_pair_ParBc_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a ParBc (ParB-like nuclease) domain downstream Back     alignment and domain information
>cd04600 CBS_pair_HPP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the HPP motif domain Back     alignment and domain information
>cd04611 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with a PAS domain, a GGDEF (DiGuanylate-Cyclase (DGC) domain, and a DUF1 domain downstream Back     alignment and domain information
>cd04635 CBS_pair_22 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04632 CBS_pair_19 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04588 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the archaeal CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain Back     alignment and domain information
>cd04612 CBS_pair_SpoIVFB_EriC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC Back     alignment and domain information
>cd04585 CBS_pair_ACT_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria Back     alignment and domain information
>cd04643 CBS_pair_30 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04803 CBS_pair_15 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04613 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC Back     alignment and domain information
>cd04594 CBS_pair_EriC_assoc_archaea This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the EriC CIC-type chloride channels in archaea Back     alignment and domain information
>COG4109 Predicted transcriptional regulator containing CBS domains [Transcription] Back     alignment and domain information
>cd04642 CBS_pair_29 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04624 CBS_pair_11 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04622 CBS_pair_9 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04637 CBS_pair_24 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04627 CBS_pair_14 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04586 CBS_pair_BON_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the BON (bacterial OsmY and nodulation domain) domain Back     alignment and domain information
>cd04633 CBS_pair_20 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04601 CBS_pair_IMPDH This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein Back     alignment and domain information
>cd04621 CBS_pair_8 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04604 CBS_pair_KpsF_GutQ_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with KpsF/GutQ domains in the API [A5P (D-arabinose 5-phosphate) isomerase] protein Back     alignment and domain information
>cd04609 CBS_pair_PALP_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream Back     alignment and domain information
>cd04584 CBS_pair_ACT_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria Back     alignment and domain information
>cd04623 CBS_pair_10 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04636 CBS_pair_23 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04619 CBS_pair_6 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04634 CBS_pair_21 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04629 CBS_pair_16 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04630 CBS_pair_17 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04638 CBS_pair_25 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04605 CBS_pair_MET2_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the MET2 domain Back     alignment and domain information
>cd04626 CBS_pair_13 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04641 CBS_pair_28 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04615 CBS_pair_2 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04625 CBS_pair_12 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>COG2524 Predicted transcriptional regulator, contains C-terminal CBS domains [Transcription] Back     alignment and domain information
>cd04593 CBS_pair_EriC_assoc_bac_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in bacteria and archaea Back     alignment and domain information
>cd04595 CBS_pair_DHH_polyA_Pol_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with an upstream DHH domain which performs a phosphoesterase function and a downstream polyA polymerase domain Back     alignment and domain information
>cd04587 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain Back     alignment and domain information
>cd04583 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA Back     alignment and domain information
>cd04599 CBS_pair_GGDEF_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain Back     alignment and domain information
>cd04801 CBS_pair_M50_like This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the metalloprotease peptidase M50 Back     alignment and domain information
>cd04602 CBS_pair_IMPDH_2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein Back     alignment and domain information
>cd04582 CBS_pair_ABC_OpuCA_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA Back     alignment and domain information
>cd04620 CBS_pair_7 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04589 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the bacterial CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain Back     alignment and domain information
>cd04802 CBS_pair_3 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04607 CBS_pair_NTP_transferase_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain associated with the NTP (Nucleotidyl transferase) domain downstream Back     alignment and domain information
>cd04800 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain Back     alignment and domain information
>cd04606 CBS_pair_Mg_transporter This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain in the magnesium transporter, MgtE Back     alignment and domain information
>PRK01862 putative voltage-gated ClC-type chloride channel ClcB; Provisional Back     alignment and domain information
>cd04617 CBS_pair_4 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04603 CBS_pair_KefB_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the KefB (Kef-type K+ transport systems) domain which is involved in inorganic ion transport and metabolism Back     alignment and domain information
>cd04614 CBS_pair_1 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04591 CBS_pair_EriC_assoc_euk_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes and bacteria Back     alignment and domain information
>cd04598 CBS_pair_GGDEF_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain Back     alignment and domain information
>PRK11543 gutQ D-arabinose 5-phosphate isomerase; Provisional Back     alignment and domain information
>cd04640 CBS_pair_27 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd02205 CBS_pair The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04608 CBS_pair_PALP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream Back     alignment and domain information
>PRK05567 inositol-5'-monophosphate dehydrogenase; Reviewed Back     alignment and domain information
>PRK10892 D-arabinose 5-phosphate isomerase; Provisional Back     alignment and domain information
>KOG1764 consensus Back     alignment and domain information
>COG0517 FOG: CBS domain [General function prediction only] Back     alignment and domain information
>COG2905 Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms] Back     alignment and domain information
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>KOG0474 consensus Back     alignment and domain information
>cd04592 CBS_pair_EriC_assoc_euk This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes Back     alignment and domain information
>TIGR01137 cysta_beta cystathionine beta-synthase; InterPro: IPR005857 This model discriminates cystathionine beta-synthase, a protein found primarily in eukaryotes and carrying a C-terminal CBS domain from cysteine synthases Back     alignment and domain information
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit; InterPro: IPR005892 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>KOG0475 consensus Back     alignment and domain information
>cd04618 CBS_pair_5 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>KOG2550 consensus Back     alignment and domain information
>COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein; InterPro: IPR005991 This family of proteins, often annotated as a putative IMP dehydrogenase, are related to IMP dehydrogenase and GMP reductase and restricted to the high GC Gram-positive bacteria Back     alignment and domain information
>KOG2118 consensus Back     alignment and domain information
>pfam03471 CorC_HlyC Transporter associated domain Back     alignment and domain information
>COG3263 NhaP-type Na+/H+ and K+/H+ antiporters with a unique C-terminal domain [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG3448 CBS-domain-containing membrane protein [Signal transduction mechanisms] Back     alignment and domain information
>COG2239 MgtE Mg/Co/Ni transporter MgtE (contains CBS domain) [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG3620 Predicted transcriptional regulator with C-terminal CBS domains [Transcription] Back     alignment and domain information
>TIGR00393 kpsF sugar isomerase, KpsF/GutQ family; InterPro: IPR004800 This is a family of closely related proteins with the phosphosugar-binding domain SIS (Sugar ISomerase) followed by two copies of the CBS (named after Cystathionine Beta Synthase) domain Back     alignment and domain information
>TIGR00400 mgtE magnesium transporter; InterPro: IPR006669 This is the MgtE family of magnesium transporters Back     alignment and domain information
>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase; InterPro: IPR005990 Synonyms: Inosine-5'-monophosphate dehydrogenase, Inosinic acid dehydrogenase IMP dehydrogenase (1 Back     alignment and domain information
>PRK07107 inositol-5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>PRK07807 inositol-5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional Back     alignment and domain information
>pfam00478 IMPDH IMP dehydrogenase / GMP reductase domain Back     alignment and domain information
>KOG1764 consensus Back     alignment and domain information
>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase; InterPro: IPR005990 Synonyms: Inosine-5'-monophosphate dehydrogenase, Inosinic acid dehydrogenase IMP dehydrogenase (1 Back     alignment and domain information
>cd04617 CBS_pair_4 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04593 CBS_pair_EriC_assoc_bac_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in bacteria and archaea Back     alignment and domain information
>cd04640 CBS_pair_27 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04633 CBS_pair_20 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04623 CBS_pair_10 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04586 CBS_pair_BON_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the BON (bacterial OsmY and nodulation domain) domain Back     alignment and domain information
>cd04637 CBS_pair_24 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04621 CBS_pair_8 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04600 CBS_pair_HPP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the HPP motif domain Back     alignment and domain information
>cd04803 CBS_pair_15 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04615 CBS_pair_2 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04641 CBS_pair_28 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04643 CBS_pair_30 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04627 CBS_pair_14 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04584 CBS_pair_ACT_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria Back     alignment and domain information
>cd04595 CBS_pair_DHH_polyA_Pol_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with an upstream DHH domain which performs a phosphoesterase function and a downstream polyA polymerase domain Back     alignment and domain information
>cd04632 CBS_pair_19 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>pfam00571 CBS CBS domain Back     alignment and domain information
>cd04638 CBS_pair_25 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04597 CBS_pair_DRTGG_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream Back     alignment and domain information
>smart00116 CBS Domain in cystathionine beta-synthase and other proteins Back     alignment and domain information
>cd04585 CBS_pair_ACT_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria Back     alignment and domain information
>cd04620 CBS_pair_7 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04635 CBS_pair_22 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04611 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with a PAS domain, a GGDEF (DiGuanylate-Cyclase (DGC) domain, and a DUF1 domain downstream Back     alignment and domain information
>cd04631 CBS_pair_18 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04583 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA Back     alignment and domain information
>cd04610 CBS_pair_ParBc_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a ParBc (ParB-like nuclease) domain downstream Back     alignment and domain information
>cd04634 CBS_pair_21 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04605 CBS_pair_MET2_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the MET2 domain Back     alignment and domain information
>cd04592 CBS_pair_EriC_assoc_euk This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes Back     alignment and domain information
>cd04596 CBS_pair_DRTGG_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream Back     alignment and domain information
>cd04639 CBS_pair_26 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04601 CBS_pair_IMPDH This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein Back     alignment and domain information
>PRK10892 D-arabinose 5-phosphate isomerase; Provisional Back     alignment and domain information
>cd04603 CBS_pair_KefB_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the KefB (Kef-type K+ transport systems) domain which is involved in inorganic ion transport and metabolism Back     alignment and domain information
>cd04582 CBS_pair_ABC_OpuCA_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA Back     alignment and domain information
>cd04642 CBS_pair_29 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PRK11543 gutQ D-arabinose 5-phosphate isomerase; Provisional Back     alignment and domain information
>cd04614 CBS_pair_1 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein Back     alignment and domain information
>COG0517 FOG: CBS domain [General function prediction only] Back     alignment and domain information
>COG2239 MgtE Mg/Co/Ni transporter MgtE (contains CBS domain) [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG3620 Predicted transcriptional regulator with C-terminal CBS domains [Transcription] Back     alignment and domain information
>TIGR03520 GldE gliding motility-associated protein GldE Back     alignment and domain information
>cd04629 CBS_pair_16 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04624 CBS_pair_11 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04613 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC Back     alignment and domain information
>cd04598 CBS_pair_GGDEF_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain Back     alignment and domain information
>cd04604 CBS_pair_KpsF_GutQ_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with KpsF/GutQ domains in the API [A5P (D-arabinose 5-phosphate) isomerase] protein Back     alignment and domain information
>cd04608 CBS_pair_PALP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream Back     alignment and domain information
>cd04800 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain Back     alignment and domain information
>cd04801 CBS_pair_M50_like This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the metalloprotease peptidase M50 Back     alignment and domain information
>cd04588 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the archaeal CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain Back     alignment and domain information
>cd04612 CBS_pair_SpoIVFB_EriC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC Back     alignment and domain information
>cd04607 CBS_pair_NTP_transferase_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain associated with the NTP (Nucleotidyl transferase) domain downstream Back     alignment and domain information
>cd04609 CBS_pair_PALP_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream Back     alignment and domain information
>PRK01862 putative voltage-gated ClC-type chloride channel ClcB; Provisional Back     alignment and domain information
>cd02205 CBS_pair The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04590 CBS_pair_CorC_HlyC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain Back     alignment and domain information
>COG2524 Predicted transcriptional regulator, contains C-terminal CBS domains [Transcription] Back     alignment and domain information
>TIGR01137 cysta_beta cystathionine beta-synthase; InterPro: IPR005857 This model discriminates cystathionine beta-synthase, a protein found primarily in eukaryotes and carrying a C-terminal CBS domain from cysteine synthases Back     alignment and domain information
>TIGR00393 kpsF sugar isomerase, KpsF/GutQ family; InterPro: IPR004800 This is a family of closely related proteins with the phosphosugar-binding domain SIS (Sugar ISomerase) followed by two copies of the CBS (named after Cystathionine Beta Synthase) domain Back     alignment and domain information
>cd04625 CBS_pair_12 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04622 CBS_pair_9 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04587 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain Back     alignment and domain information
>cd04619 CBS_pair_6 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04630 CBS_pair_17 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04589 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the bacterial CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain Back     alignment and domain information