254780427

254780427

hypothetical protein CLIBASIA_01560

GeneID in NCBI database:8209413Locus tag:CLIBASIA_01560
Protein GI in NCBI database:254780427Protein Accession:YP_003064840.1
Gene range:-(334246, 334761)Protein Length:171aa
Gene description:hypothetical protein
COG prediction:[R] Predicted metal-dependent hydrolase
KEGG prediction:hypothetical protein; K07042
SEED prediction:FIG000233: metal-dependent hydrolase
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Phosphate metabolism
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-
MSVKKVNLPRLDLQIAVENALWGDEIHLRTLCEVVFAKAVSNLISKGYFVKENIVELSLVFTDSHRIETLNFEYRGIDKPTNVLSFPTAFASSDGCSSLMLGDIVLAYEIIEIEANVLGKEFENHLVHLIIHGFLHLLGYDHVDDKDACVMEGLERSILEDLGINDPYEVD
cccccccccEEEEEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEEcHHHHHHHHHHHcccccccEEEEEccccccccccccccccEEEEEHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHcccccccccc
cccccccccccccEEEEcccccccHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEEEEcHHHHHHHHHHHHcccccccEEEEEccccccccccccEEEEEEEEHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHcccccccccc
msvkkvnlprldLQIAVENALWGDEIHLRTLCEVVFAKAVSNLISKGYFVKENIVELSLVFTDshrietlnfeyrgidkptnvlsfptafassdgcsslmLGDIVLAYEIIEIEANVLGKEFENHLVHLIIHGFLhllgydhvddkdacVMEGLERSiledlgindpyevd
msvkkvnlprldLQIAVENALWGDEIHLRTLCEVVFAKAVSNLISKGYFVKENIVELSLVFTDSHRIETLNfeyrgidkptNVLSFPTAFASSDGCSSLMLGDIVLAYEIIEIEANVLGKEFENHLVHLIIHGFLHLLGYDHVDDKDACVMEGLErsiledlgindpyevd
MSVKKVNLPRLDLQIAVENALWGDEIHLRTLCEVVFAKAVSNLISKGYFVKENIVELSLVFTDSHRIETLNFEYRGIDKPTNVLSFPTAFASSDGCSSLMLGDIVLAYEIIEIEANVLGKEFENhlvhliihgflhllgYDHVDDKDACVMEGLERSILEDLGINDPYEVD
***********DLQIAVENALWGDEIHLRTLCEVVFAKAVSNLISKGYFVKENIVELSLVFTDSHRIETLNFEYRGIDKPTNVLSFPTAFASSDGCSSLMLGDIVLAYEIIEIEANVLGKEFENHLVHLIIHGFLHLLGYDHVDDKDACVMEGLERSILEDLGINDPY***
MSVKKVNLPRLDLQIAVENALWGDEIHLRTLCEVVFAKAVSNLISKGYFVKENIVELSLVFTDSHRIETLNFEYRGIDKPTNVLSFPTAFASSDGCSSLMLGDIVLAYEIIEIEANVLGKEFENHLVHLIIHGFLHLLGYDHVDDKDACVMEGLERSILEDLGINDPYEVD
****KVNLPRLDLQIAVENALWGDEIHLRTLCEVVFAKAVSNLISKGYFVKENIVELSLVFTDSHRIETLNFEYRGIDKPTNVLSFPTAFASSDGCSSLMLGDIVLAYEIIEIEANVLGKEFENHLVHLIIHGFLHLLGYDHVDDKDACVMEGLERSILEDLGINDPYE**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSVKKVNLPRLDLQIAVENALWGDEIHLRTLCEVVFAKAVSNLISKGYFVKENIVELSLVFTDSHRIETLNFEYRGIDKPTNVLSFPTAFASSDGCSSLMLGDIVLAYEIIEIEANVLGKEFENHLVHLIIHGFLHLLGYDHVDDKDACVMEGLERSILEDLGINDPYEVD
MSVKKVNLPRLDLQIAVENALWGDEIHLRTLCEVVFAKAVSNLISKGYFVKENIVELSLVFTDSHRIETLNFEYRGIDKPTNVLSFPTAFASSDGCSSLMLGDIVLAYEIIEIEANVLGKEFENHLVHLIIHGFLHLLGYDHVDDKDACVMEGLERSILEDLGINDPYEVD
MSVKKVNLPRLDLQIAVENALWGDEIHLRTLCEVVFAKAVSNLISKGYFVKENIVELSLVFTDSHRIETLNFEYRGIDKPTNVLSFPTAFASSDGCSSLMLGDIVLAYEIIEIEANVLGKEFENHLVHLIIHGFLHLLGYDHVDDKDACVMEGLERSILEDLGINDPYEVD

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target171 hypothetical protein CLIBASIA_01560 [Candidatus Liberib
315122127163 hypothetical protein CKC_01885 [Candidatus Liberibacter 1 4e-56
227820630173 hypothetical protein NGR_c00430 [Sinorhizobium fredii N 1 9e-35
153008092162 hypothetical protein Oant_0756 [Ochrobactrum anthropi A 1 9e-35
150395270168 hypothetical protein Smed_0042 [Sinorhizobium medicae W 1 1e-34
86356031171 hypothetical protein RHE_CH00374 [Rhizobium etli CFN 42 1 2e-34
15964160168 hypothetical protein SMc01113 [Sinorhizobium meliloti 1 1 3e-34
189025205190 Diacyglycerol kinase [Brucella abortus S19] Length = 19 1 6e-34
306843573195 conserved hypothetical protein [Brucella sp. BO1] Lengt 1 7e-34
241202783171 hypothetical protein Rleg_0029 [Rhizobium leguminosarum 1 8e-34
239833204162 conserved hypothetical protein [Ochrobactrum intermediu 1 8e-34
>gi|315122127|ref|YP_004062616.1| hypothetical protein CKC_01885 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 163 Back     alignment and organism information
 Score =  221 bits (562), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 113/166 (68%), Positives = 136/166 (81%), Gaps = 3/166 (1%)

Query: 6   VNLPRLDLQIAVENALWGDEIHLRTLCEVVFAKAVSNLISKGYFVKENIVELSLVFTDSH 65
           +N P+L+L IAVE+ LWG++  L  LCEVV AKA+S L SK  F  E+I E+S VFTDS+
Sbjct: 1   MNPPKLNLHIAVESELWGEDFDLSVLCEVVLAKAISFLTSKKDFSLEDI-EVSFVFTDSN 59

Query: 66  RIETLNFEYRGIDKPTNVLSFPTAFASSDGCSSLMLGDIVLAYEIIEIEANVLGKEFENH 125
           RI+ LN +YRGIDKPTNVLSFP+  +S    S  MLGDIVLAYE++E EANVLGK+F++H
Sbjct: 60  RIKELNAQYRGIDKPTNVLSFPSVLSSE--YSGAMLGDIVLAYEVMEAEANVLGKKFKDH 117

Query: 126 LVHLIIHGFLHLLGYDHVDDKDACVMEGLERSILEDLGINDPYEVD 171
           LVHLIIHGFLHLL YDHVDD+DA +MEGLERSIL DLGI+DPYE+D
Sbjct: 118 LVHLIIHGFLHLLRYDHVDDEDARLMEGLERSILADLGIDDPYELD 163


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|227820630|ref|YP_002824600.1| hypothetical protein NGR_c00430 [Sinorhizobium fredii NGR234] Length = 173 Back     alignment and organism information
>gi|153008092|ref|YP_001369307.1| hypothetical protein Oant_0756 [Ochrobactrum anthropi ATCC 49188] Length = 162 Back     alignment and organism information
>gi|150395270|ref|YP_001325737.1| hypothetical protein Smed_0042 [Sinorhizobium medicae WSM419] Length = 168 Back     alignment and organism information
>gi|86356031|ref|YP_467923.1| hypothetical protein RHE_CH00374 [Rhizobium etli CFN 42] Length = 171 Back     alignment and organism information
>gi|15964160|ref|NP_384513.1| hypothetical protein SMc01113 [Sinorhizobium meliloti 1021] Length = 168 Back     alignment and organism information
>gi|189025205|ref|YP_001935973.1| Diacyglycerol kinase [Brucella abortus S19] Length = 190 Back     alignment and organism information
>gi|306843573|ref|ZP_07476174.1| conserved hypothetical protein [Brucella sp. BO1] Length = 195 Back     alignment and organism information
>gi|241202783|ref|YP_002973879.1| hypothetical protein Rleg_0029 [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 171 Back     alignment and organism information
>gi|239833204|ref|ZP_04681533.1| conserved hypothetical protein [Ochrobactrum intermedium LMG 3301] Length = 162 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target171 hypothetical protein CLIBASIA_01560 [Candidatus Liberib
PRK00016159 PRK00016, PRK00016, metal-binding heat shock protein; P 3e-37
COG0319153 COG0319, COG0319, Predicted metal-dependent hydrolase [ 2e-31
TIGR00043110 TIGR00043, TIGR00043, metalloprotein, YbeY/UPF0054 fami 5e-30
PRK13963258 PRK13963, PRK13963, unkown domain/putative metalloprote 7e-24
PLN02887 580 PLN02887, PLN02887, hydrolase family protein 5e-12
pfam02130141 pfam02130, UPF0054, Uncharacterized protein family UPF0 3e-33
>gnl|CDD|178796 PRK00016, PRK00016, metal-binding heat shock protein; Provisional Back     alignment and domain information
>gnl|CDD|30667 COG0319, COG0319, Predicted metal-dependent hydrolase [General function prediction only] Back     alignment and domain information
>gnl|CDD|161678 TIGR00043, TIGR00043, metalloprotein, YbeY/UPF0054 family Back     alignment and domain information
>gnl|CDD|184423 PRK13963, PRK13963, unkown domain/putative metalloprotease fusion protein; Provisional Back     alignment and domain information
>gnl|CDD|178475 PLN02887, PLN02887, hydrolase family protein Back     alignment and domain information
>gnl|CDD|145339 pfam02130, UPF0054, Uncharacterized protein family UPF0054 Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 171 hypothetical protein CLIBASIA_01560 [Candidatus Liberib
PRK00016159 putative metalloprotease; Provisional 100.0
COG0319153 Predicted metal-dependent hydrolase [General function p 100.0
PRK13963258 unkown domain/putative metalloprotease fusion protein; 100.0
TIGR00043123 TIGR00043 conserved hypothetical protein TIGR00043; Int 100.0
pfam02130141 UPF0054 Uncharacterized protein family UPF0054. 100.0
>PRK00016 putative metalloprotease; Provisional Back     alignment and domain information
>COG0319 Predicted metal-dependent hydrolase [General function prediction only] Back     alignment and domain information
>PRK13963 unkown domain/putative metalloprotease fusion protein; Provisional Back     alignment and domain information
>TIGR00043 TIGR00043 conserved hypothetical protein TIGR00043; InterPro: IPR002036 These, as yet, uncharacterised proteins are of 17 to 21 kDa Back     alignment and domain information
>pfam02130 UPF0054 Uncharacterized protein family UPF0054 Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target171 hypothetical protein CLIBASIA_01560 [Candidatus Liberib
1xax_A154 Nmr Structure Of Hi0004, A Putative Essential Gene 5e-28
1xm5_A155 Crystal Structure Of Metal-Dependent Hydrolase Ybey 2e-24
1oz9_A150 Crystal Structure Of Aq_1354, A Hypothetical Protei 2e-18
1tvi_A172 Solution Structure Of Tm1509 From Thermotoga Mariti 6e-15
gi|60593985|pdb|1XAX|A Chain A, Nmr Structure Of Hi0004, A Putative Essential Gene Product From Haemophilus Influenzae Length = 154 Back     alignment and structure
 Score =  127 bits (319), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 59/167 (35%), Positives = 84/167 (50%), Gaps = 15/167 (8%)

Query: 6   VNLPRLDLQIAVEN-ALWGDEIHLRTLCEVVFAKAVSNLISKGYFVKENIVELSLVFTDS 64
           +    +DLQIA EN      E  +                      + N VE+++   D 
Sbjct: 1   MGSVLVDLQIATENIEGLPTEEQIVQWATGAVQ------------PEGNEVEMTVRIVDE 48

Query: 65  HRIETLNFEYRGIDKPTNVLSFPTAFASSDGCSSLMLGDIVLAYEIIEIEANVLGKEFEN 124
                LN  YRG D+PTNVLSFP      D     +LGD+V+  +++E EA+   K    
Sbjct: 49  AESHELNLTYRGKDRPTNVLSFPFE--CPDEVELPLLGDLVICRQVVEREASEQEKPLMA 106

Query: 125 HLVHLIIHGFLHLLGYDHVDDKDACVMEGLERSILEDLGINDPYEVD 171
           H  H+++HG LHLLGYDH++D +A  ME LE  I++ LG +DPY  +
Sbjct: 107 HWAHMVVHGSLHLLGYDHIEDDEAEEMESLETQIMQGLGFDDPYLAE 153


gi|56554600|pdb|1XM5|A Chain A, Crystal Structure Of Metal-Dependent Hydrolase Ybey From E. Coli, Pfam Upf0054 Length = 155 Back     alignment and structure
gi|37927359|pdb|1OZ9|A Chain A, Crystal Structure Of Aq_1354, A Hypothetical Protein From Aquifex Aeolicus Length = 150 Back     alignment and structure
>gi|220702590|pdb|1TVI|A Chain A, Solution Structure Of Tm1509 From Thermotoga Maritima: Vt1, A Nesgc Target Protein Length = 172 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target171 hypothetical protein CLIBASIA_01560 [Candidatus Liberib
1xax_A154 Hypothetical UPF0054 protein HI0004; structural genomic 2e-29
1xm5_A155 Hypothetical UPF0054 protein YBEY; structural genomics, 4e-29
1tvi_A172 Hypothetical UPF0054 protein TM1509; alpha + beta, mixe 7e-25
1oz9_A150 Hypothetical protein AQ_1354; matrix metalloproteinase 3e-24
>1xax_A Hypothetical UPF0054 protein HI0004; structural genomics, MMP, hydrolase, protein structure initiative, S2F, structure 2 function project; NMR {Haemophilus influenzae} Length = 154 Back     alignment and structure
 Score =  123 bits (310), Expect = 2e-29
 Identities = 60/162 (37%), Positives = 84/162 (51%), Gaps = 15/162 (9%)

Query: 11  LDLQIAVENALW-GDEIHLRTLCEVVFAKAVSNLISKGYFVKENIVELSLVFTDSHRIET 69
           +DLQIA EN      E  +                      + N VE+++   D      
Sbjct: 6   VDLQIATENIEGLPTEEQIVQWATGAVQP------------EGNEVEMTVRIVDEAESHE 53

Query: 70  LNFEYRGIDKPTNVLSFPTAFASSDGCSSLMLGDIVLAYEIIEIEANVLGKEFENHLVHL 129
           LN  YRG D+PTNVLSFP  F   D     +LGD+V+  +++E EA+   K    H  H+
Sbjct: 54  LNLTYRGKDRPTNVLSFP--FECPDEVELPLLGDLVICRQVVEREASEQEKPLMAHWAHM 111

Query: 130 IIHGFLHLLGYDHVDDKDACVMEGLERSILEDLGINDPYEVD 171
           ++HG LHLLGYDH++D +A  ME LE  I++ LG +DPY  +
Sbjct: 112 VVHGSLHLLGYDHIEDDEAEEMESLETQIMQGLGFDDPYLAE 153


>1xm5_A Hypothetical UPF0054 protein YBEY; structural genomics, protein structure initiative, nysgxrc target T842, PFAM family UPF0054, PSI; 2.70A {Escherichia coli} SCOP: d.92.1.15 Length = 155 Back     alignment and structure
>1tvi_A Hypothetical UPF0054 protein TM1509; alpha + beta, mixed 4-stranded beta sheet, four helix bundle, structural genomics; NMR {Thermotoga maritima} SCOP: d.92.1.15 Length = 172 Back     alignment and structure
>1oz9_A Hypothetical protein AQ_1354; matrix metalloproteinase type fold, structural genomics, BSGC structure funded by NIH; 1.89A {Aquifex aeolicus} SCOP: d.92.1.15 Length = 150 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target171 hypothetical protein CLIBASIA_01560 [Candidatus Liberib
1xm5_A155 Hypothetical UPF0054 protein YBEY; structural genomics, 100.0
1xax_A154 Hypothetical UPF0054 protein HI0004; structural genomic 100.0
1oz9_A150 Hypothetical protein AQ_1354; matrix metalloproteinase 100.0
1tvi_A172 Hypothetical UPF0054 protein TM1509; alpha + beta, mixe 100.0
>1xm5_A Hypothetical UPF0054 protein YBEY; structural genomics, protein structure initiative, nysgxrc target T842, PFAM family UPF0054, PSI; 2.70A {Escherichia coli} SCOP: d.92.1.15 Back     alignment and structure
Probab=100.00  E-value=0  Score=292.37  Aligned_cols=153  Identities=39%  Similarity=0.648  Sum_probs=128.7

Q ss_pred             CCCCCEEEEEEECCCCCHHHCCCHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEEEECHHHHHHHHHHHHHCCCCCCEEE
Q ss_conf             13543058888548521111352579999999999997432201466743899998577999999999850489851566
Q gi|254780427|r    6 VNLPRLDLQIAVENALWGDEIHLRTLCEVVFAKAVSNLISKGYFVKENIVELSLVFTDSHRIETLNFEYRGIDKPTNVLS   85 (171)
Q Consensus         6 ~~~~~i~I~i~ie~~~w~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~eisi~l~dd~~i~~LN~~yr~kd~~TDVLS   85 (171)
                      |+..++++++.|++..+   ++....    +.+|+..++...    .+.++|||.|||+++|++||++||++|+||||||
T Consensus         1 m~~~~i~iq~~~~~~~~---~P~~~~----i~~~~~~~l~~~----~~~~evsi~~v~~~~m~~LN~~yr~kd~~TDVLS   69 (155)
T 1xm5_A            1 MSQVILDLQLACEDNSG---LPEESQ----FQTWLNAVIPQF----QEESEVTIRVVDTAESHSLNLTYRGKDKPTNVLS   69 (155)
T ss_dssp             CCEEEEEEEECSSSCCS---CCCHHH----HHHHHHTTSHHH----HSEEEEEEEEECHHHHHHHHHHHHCCSSCCSEEE
T ss_pred             CCCEEEEEEEECCCCCC---CCCHHH----HHHHHHHHHHHC----CCCEEEEEEEECHHHHHHHHHHHHCCCCCCCEEE
T ss_conf             98359998764378768---889999----999999999846----9981799999897999999999948999985798


Q ss_pred             ECCCCCCCCCCCCCCHHEEEEEHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             32556677765653002046518888744666189899999999999899863888998899999999999999986888
Q gi|254780427|r   86 FPTAFASSDGCSSLMLGDIVLAYEIIEIEANVLGKEFENHLVHLIIHGFLHLLGYDHVDDKDACVMEGLERSILEDLGIN  165 (171)
Q Consensus        86 FP~~~~~~~~~~~~~LGDIvIs~~~i~~eA~~~~~~~~~e~~~l~iHG~LHLlGydH~~~~~~~~M~~~E~~iL~~l~i~  165 (171)
                      ||+...  +..+...||||+||+++|.+||+++++++.+|++||+|||+|||+||||+++++++.|+++|+++|+++|++
T Consensus        70 Fp~~~~--~~~~~~~lGDI~I~~~~i~~~A~~~~~s~~~el~~l~iHG~LHLlGyDH~~~~~~~~M~~~E~~~L~~lg~~  147 (155)
T 1xm5_A           70 FPFEVP--PGMEMSLLGDLVICRQVVEKEAQEQGKPLEAHWAHMVVHGSLHLLGYDHIEDDEAEEMEALETEIMLALGYE  147 (155)
T ss_dssp             EECCCC--SSCCCCEEEEEEEEHHHHHHHHHHTTCCHHHHHHHHHHHHHHHHTTCCCSSHHHHHHHHHHHHHHHHHTTCC
T ss_pred             EECCCC--CCCCCCCCCCEEEEHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHCCCC
T ss_conf             742025--676644445556649999999999199799999999999999973788898389999999999999986999


Q ss_pred             CCCCCC
Q ss_conf             864479
Q gi|254780427|r  166 DPYEVD  171 (171)
Q Consensus       166 ~PY~~~  171 (171)
                      |||-.+
T Consensus       148 nPY~~~  153 (155)
T 1xm5_A          148 DPYIAE  153 (155)
T ss_dssp             CSCCC-
T ss_pred             CCCCCC
T ss_conf             987655



>1xax_A Hypothetical UPF0054 protein HI0004; structural genomics, MMP, hydrolase, protein structure initiative, S2F, structure 2 function project; NMR {Haemophilus influenzae} Back     alignment and structure
>1oz9_A Hypothetical protein AQ_1354; matrix metalloproteinase type fold, structural genomics, BSGC structure funded by NIH; 1.89A {Aquifex aeolicus} SCOP: d.92.1.15 Back     alignment and structure
>1tvi_A Hypothetical UPF0054 protein TM1509; alpha + beta, mixed 4-stranded beta sheet, four helix bundle, structural genomics; NMR {Thermotoga maritima} SCOP: d.92.1.15 Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 171 hypothetical protein CLIBASIA_01560 [Candidatus Liberib
d1xm5a_152 d.92.1.15 (A:) Hypothetical protein YbeY {Escherichia c 2e-28
d1oz9a_141 d.92.1.15 (A:) Hypothetical protein Aq_1354 {Aquifex ae 5e-23
d1tvia_150 d.92.1.15 (A:) Hypothetical protein TM1509 {Thermotoga 1e-22
>d1xm5a_ d.92.1.15 (A:) Hypothetical protein YbeY {Escherichia coli [TaxId: 562]} Length = 152 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Zincin-like
superfamily: Metalloproteases ("zincins"), catalytic domain
family: Predicted metal-dependent hydrolase
domain: Hypothetical protein YbeY
species: Escherichia coli [TaxId: 562]
 Score =  118 bits (298), Expect = 2e-28
 Identities = 62/159 (38%), Positives = 86/159 (54%), Gaps = 15/159 (9%)

Query: 11  LDLQIAVENALW-GDEIHLRTLCEVVFAKAVSNLISKGYFVKENIVELSLVFTDSHRIET 69
           LDLQ+A E+     +E   +T    V  +             +   E+++   D+    +
Sbjct: 6   LDLQLACEDNSGLPEESQFQTWLNAVIPQ------------FQEESEVTIRVVDTAESHS 53

Query: 70  LNFEYRGIDKPTNVLSFPTAFASSDGCSSLMLGDIVLAYEIIEIEANVLGKEFENHLVHL 129
           LN  YRG DKPTNVLSFP  F    G    +LGD+V+  +++E EA   GK  E H  H+
Sbjct: 54  LNLTYRGKDKPTNVLSFP--FEVPPGMEMSLLGDLVICRQVVEKEAQEQGKPLEAHWAHM 111

Query: 130 IIHGFLHLLGYDHVDDKDACVMEGLERSILEDLGINDPY 168
           ++HG LHLLGYDH++D +A  ME LE  I+  LG  DPY
Sbjct: 112 VVHGSLHLLGYDHIEDDEAEEMEALETEIMLALGYEDPY 150


>d1oz9a_ d.92.1.15 (A:) Hypothetical protein Aq_1354 {Aquifex aeolicus [TaxId: 63363]} Length = 141 Back     information, alignment and structure
>d1tvia_ d.92.1.15 (A:) Hypothetical protein TM1509 {Thermotoga maritima [TaxId: 2336]} Length = 150 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target171 hypothetical protein CLIBASIA_01560 [Candidatus Liberib
d1xm5a_152 Hypothetical protein YbeY {Escherichia coli [TaxId: 562 100.0
d1tvia_150 Hypothetical protein TM1509 {Thermotoga maritima [TaxId 100.0
d1oz9a_141 Hypothetical protein Aq_1354 {Aquifex aeolicus [TaxId: 100.0
>d1xm5a_ d.92.1.15 (A:) Hypothetical protein YbeY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Zincin-like
superfamily: Metalloproteases ("zincins"), catalytic domain
family: Predicted metal-dependent hydrolase
domain: Hypothetical protein YbeY
species: Escherichia coli [TaxId: 562]
Probab=100.00  E-value=0  Score=291.59  Aligned_cols=150  Identities=40%  Similarity=0.652  Sum_probs=126.4

Q ss_pred             CCCCEEEEEEECCCCCHHHCCCHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEEEECHHHHHHHHHHHHHCCCCCCEEEE
Q ss_conf             35430588885485211113525799999999999974322014667438999985779999999998504898515663
Q gi|254780427|r    7 NLPRLDLQIAVENALWGDEIHLRTLCEVVFAKAVSNLISKGYFVKENIVELSLVFTDSHRIETLNFEYRGIDKPTNVLSF   86 (171)
Q Consensus         7 ~~~~i~I~i~ie~~~w~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~eisi~l~dd~~i~~LN~~yr~kd~~TDVLSF   86 (171)
                      +..+++|++.+++..+   ++..+    .+.+|+..++...    .+..+|||.|||+++|++||++|||+|+|||||||
T Consensus         2 ~~~~idi~~~~~~~~~---lP~~~----~i~~~l~~~l~~~----~~~~evsi~~v~~~~m~~LN~~yr~~d~~TDVLSF   70 (152)
T d1xm5a_           2 SQVILDLQLACEDNSG---LPEES----QFQTWLNAVIPQF----QEESEVTIRVVDTAESHSLNLTYRGKDKPTNVLSF   70 (152)
T ss_dssp             CEEEEEEEECSSSCCS---CCCHH----HHHHHHHTTSHHH----HSEEEEEEEEECHHHHHHHHHHHHCCSSCCSEEEE
T ss_pred             CCEEEEEEEECCCCCC---CCCHH----HHHHHHHHHHHHC----CCCEEEEEEEECHHHHHHHHHHHHCCCCCCCEEEE
T ss_conf             8349999985378658---88999----9999999999836----89838999999989999999998545888645886


Q ss_pred             CCCCCCCCCCCCCCHHEEEEEHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             25566777656530020465188887446661898999999999998998638889988999999999999999868888
Q gi|254780427|r   87 PTAFASSDGCSSLMLGDIVLAYEIIEIEANVLGKEFENHLVHLIIHGFLHLLGYDHVDDKDACVMEGLERSILEDLGIND  166 (171)
Q Consensus        87 P~~~~~~~~~~~~~LGDIvIs~~~i~~eA~~~~~~~~~e~~~l~iHG~LHLlGydH~~~~~~~~M~~~E~~iL~~l~i~~  166 (171)
                      |+...  +..+..+||||+||+++|.+||+++++++.+|++||+|||+|||+||||+++++++.|+++|+++|+++|++|
T Consensus        71 p~~~~--~~~~~~~lGdI~I~~~~i~~~A~~~~~~~~~e~~~l~iHG~LHLlGyDH~~~~~~~~M~~~E~~~L~~l~~~n  148 (152)
T d1xm5a_          71 PFEVP--PGMEMSLLGDLVICRQVVEKEAQEQGKPLEAHWAHMVVHGSLHLLGYDHIEDDEAEEMEALETEIMLALGYED  148 (152)
T ss_dssp             ECCCC--SSCCCCEEEEEEEEHHHHHHHHHHTTCCHHHHHHHHHHHHHHHHTTCCCSSHHHHHHHHHHHHHHHHHTTCCC
T ss_pred             ECCCC--CCCCCCCCCCEEEEHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHCCCCC
T ss_conf             24468--8777453353677599999899883840988888999999999737888984899999999999999869999


Q ss_pred             CCC
Q ss_conf             644
Q gi|254780427|r  167 PYE  169 (171)
Q Consensus       167 PY~  169 (171)
                      ||-
T Consensus       149 PY~  151 (152)
T d1xm5a_         149 PYI  151 (152)
T ss_dssp             SCC
T ss_pred             CCC
T ss_conf             867



>d1tvia_ d.92.1.15 (A:) Hypothetical protein TM1509 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1oz9a_ d.92.1.15 (A:) Hypothetical protein Aq_1354 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 171 hypothetical protein CLIBASIA_01560 [Candidatus Li
1xax_A_154 (A:) Hypothetical UPF0054 protein HI0004; structur 3e-30
1xm5_A_155 (A:) Hypothetical UPF0054 protein YBEY; structural 3e-29
1oz9_A_150 (A:) Hypothetical protein AQ_1354; matrix metallop 9e-28
1tvi_A_172 (A:) Hypothetical UPF0054 protein TM1509; alpha + 7e-27
>1xax_A (A:) Hypothetical UPF0054 protein HI0004; structural genomics, MMP, hydrolase, protein structure initiative, S2F, structure 2 function project; NMR {Haemophilus influenzae}Length = 154 Back     alignment and structure
 Score =  125 bits (315), Expect = 3e-30
 Identities = 50/163 (30%), Positives = 77/163 (47%), Gaps = 11/163 (6%)

Query: 9   PRLDLQIAVENALWGDEIHLRTLCEVVFAKAVSNLISKGYFVKENIVELSLVFTDSHRIE 68
             + + + +             + +                  E  VE+++   D     
Sbjct: 2   GSVLVDLQIATENIEGLPTEEQIVQWATGAV-------QPEGNE--VEMTVRIVDEAESH 52

Query: 69  TLNFEYRGIDKPTNVLSFPTAFASSDGCSSLMLGDIVLAYEIIEIEANVLGKEFENHLVH 128
            LN  YRG D+PTNVLSFP            +LGD+V+  +++E EA+   K    H  H
Sbjct: 53  ELNLTYRGKDRPTNVLSFPFECPDEVEL--PLLGDLVICRQVVEREASEQEKPLMAHWAH 110

Query: 129 LIIHGFLHLLGYDHVDDKDACVMEGLERSILEDLGINDPYEVD 171
           +++HG LHLLGYDH++D +A  ME LE  I++ LG +DPY  +
Sbjct: 111 MVVHGSLHLLGYDHIEDDEAEEMESLETQIMQGLGFDDPYLAE 153


>1xm5_A (A:) Hypothetical UPF0054 protein YBEY; structural genomics, protein structure initiative, nysgxrc target T842, PFAM family UPF0054, PSI; 2.70A {Escherichia coli}Length = 155 Back     alignment and structure
>1oz9_A (A:) Hypothetical protein AQ_1354; matrix metalloproteinase type fold, structural genomics, BSGC structure funded by NIH; 1.89A {Aquifex aeolicus}Length = 150 Back     alignment and structure
>1tvi_A (A:) Hypothetical UPF0054 protein TM1509; alpha + beta, mixed 4-stranded beta sheet, four helix bundle, structural genomics; NMR {Thermotoga maritima}Length = 172 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target171 hypothetical protein CLIBASIA_01560 [Candidatus Liberib
1xm5_A_155 Hypothetical UPF0054 protein YBEY; structural geno 100.0
1xax_A_154 Hypothetical UPF0054 protein HI0004; structural ge 100.0
1tvi_A_172 Hypothetical UPF0054 protein TM1509; alpha + beta, 100.0
1oz9_A_150 Hypothetical protein AQ_1354; matrix metalloprotei 100.0
>1xm5_A (A:) Hypothetical UPF0054 protein YBEY; structural genomics, protein structure initiative, nysgxrc target T842, PFAM family UPF0054, PSI; 2.70A {Escherichia coli} Back     alignment and structure
Probab=100.00  E-value=0  Score=295.18  Aligned_cols=150  Identities=36%  Similarity=0.594  Sum_probs=124.5

Q ss_pred             EEEEEEECCCCCHHHCCCHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEEEECHHHHHHHHHHHHHCCCCCCEEEECCCC
Q ss_conf             05888854852111135257999999999999743220146674389999857799999999985048985156632556
Q gi|254780427|r   11 LDLQIAVENALWGDEIHLRTLCEVVFAKAVSNLISKGYFVKENIVELSLVFTDSHRIETLNFEYRGIDKPTNVLSFPTAF   90 (171)
Q Consensus        11 i~I~i~ie~~~w~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~eisi~l~dd~~i~~LN~~yr~kd~~TDVLSFP~~~   90 (171)
                      +.++|.+.+..|.... ...    .+.+++..++...    ...++|||.|||+++|++||++|||+|+||||||||+.+
T Consensus         4 ~~~~i~i~~~~~~~~~-~~~----~~~~~~~~~~~~~----~~~~eisi~~vdd~~i~~LN~~yr~~d~pTDVLSFp~~~   74 (155)
T 1xm5_A            4 VILDLQLACEDNSGLP-EES----QFQTWLNAVIPQF----QEESEVTIRVVDTAESHSLNLTYRGKDKPTNVLSFPFEV   74 (155)
T ss_dssp             EEEEEEECSSSCCSCC-CHH----HHHHHHHTTSHHH----HSEEEEEEEEECHHHHHHHHHHHHCCSSCCSEEEEECCC
T ss_pred             EEEEEEEECCCCCCCC-CHH----HHHHHHHHHHHHC----CCCEEEEEEEECHHHHHHHHHHHHCCCCCCCEEEEECCC
T ss_conf             5999887437855888-999----9999999999836----898489999999899999999985458886458763447


Q ss_pred             CCCCCCCCCCHHEEEEEHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCC
Q ss_conf             67776565300204651888874466618989999999999989986388899889999999999999998688886447
Q gi|254780427|r   91 ASSDGCSSLMLGDIVLAYEIIEIEANVLGKEFENHLVHLIIHGFLHLLGYDHVDDKDACVMEGLERSILEDLGINDPYEV  170 (171)
Q Consensus        91 ~~~~~~~~~~LGDIvIs~~~i~~eA~~~~~~~~~e~~~l~iHG~LHLlGydH~~~~~~~~M~~~E~~iL~~l~i~~PY~~  170 (171)
                      ...  ....+|||||||+++|.+||.++|+++.+|+++|+|||+|||+||||+++++++.|+.+|+++|+.+|+++||..
T Consensus        75 ~~~--~~~~~LGDI~Is~~~~~~qA~~~~~s~~~el~~l~vHG~LHLlGyDH~~~~e~~~M~~~E~~iL~~lg~~~py~~  152 (155)
T 1xm5_A           75 PPG--MEMSLLGDLVICRQVVEKEAQEQGKPLEAHWAHMVVHGSLHLLGYDHIEDDEAEEMEALETEIMLALGYEDPYIA  152 (155)
T ss_dssp             CSS--CCCCEEEEEEEEHHHHHHHHHHTTCCHHHHHHHHHHHHHHHHTTCCCSSHHHHHHHHHHHHHHHHHTTCCCSCCC
T ss_pred             CCC--CCCCCCCCEEEEHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCC
T ss_conf             887--664434425664999998998809978897678889999997378889817999999999999998699998766


Q ss_pred             C
Q ss_conf             9
Q gi|254780427|r  171 D  171 (171)
Q Consensus       171 ~  171 (171)
                      +
T Consensus       153 ~  153 (155)
T 1xm5_A          153 E  153 (155)
T ss_dssp             -
T ss_pred             C
T ss_conf             6



>1xax_A (A:) Hypothetical UPF0054 protein HI0004; structural genomics, MMP, hydrolase, protein structure initiative, S2F, structure 2 function project; NMR {Haemophilus influenzae} Back     alignment and structure
>1tvi_A (A:) Hypothetical UPF0054 protein TM1509; alpha + beta, mixed 4-stranded beta sheet, four helix bundle, structural genomics; NMR {Thermotoga maritima} Back     alignment and structure
>1oz9_A (A:) Hypothetical protein AQ_1354; matrix metalloproteinase type fold, structural genomics, BSGC structure funded by NIH; 1.89A {Aquifex aeolicus} Back     alignment and structure