255764472

255764472

2-methylthioadenine synthetase (miaB-like) protein

GeneID in NCBI database:8209414Locus tag:CLIBASIA_01565
Protein GI in NCBI database:255764472Protein Accession:YP_003064841.2
Gene range:-(335013, 336422)Protein Length:469aa
Gene description:2-methylthioadenine synthetase (miaB-like) protein
COG prediction:[J] 2-methylthioadenine synthetase
KEGG prediction:miaB; 2-methylthioadenine synthetase (MiaB-like) protein; K06168 bifunctional enzyme involved in thiolation and methylation of tRNA
SEED prediction:tRNA-i(6)A37 methylthiotransferase
Pathway involved in KEGG:not defined
Subsystem involved in SEED:tRNA processing;
tRNA modification Archaea;
Methylthiotransferases
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------47
MGLFIKLIGVAHMVSQIVDQCIVPQRFFVKSYGCQMNVYDSLRMEDMFFSQGYERVNSMDDADLIVLNTCHIREKAAEKVYSFLGRIRNLKNSRIKEGGDLLVVVAGCVAQAEGEEILRRSPIVNVVVGPQTYYRLPELLERARFGKRVVDTDYSVEDKFERLSIVDGGYNRKRGVTAFLTIQEGCDKFCTFCVVPYTRGIEISRSLSQVVDEARKLIDNGVCEITLLGQNVNAWRGKGLDGEKCTFSDLLYSLSEIKGLVRLRYTTSHPRDMSDCLIKAHGDLDVLMPYLHLPVQSGSDRILKSMNRRHTAYEYRQIIDRIRSVRPDIAISSDFIVGFPGETDDDFRATMDLVDKIGYAQAFSFKYSPRLGTPGSNMLEQVDENVKAERLLCLQKKLREQQVSFNDACVGQIIEVLIEKHGKEKGKLVGRSPWLQSVVLNSKNHNIGDIIKVRITDVKISTLYGELVV
ccHHHHHHHHcccccccccccccccEEEEEEccccccHHHHHHHHHHHHHcccccccccccccEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHcccccEEEccccHHHHHHHHHHHHccccccccccccccccccccccccccccccccEEEEEEcccccccccEEEEccccccEEEccHHHHHHHHHHHHHccccEEEEEEccccccccccccccHHHHHHHHHHHHHcccccEEEEEEcccccccHHHHHHHHHccccccEEEEEcccccHHHHHHHcccccHHHHHHHHHHHHHHccccEEEEEEEEEcccccHHHHHHHHHHHHHccccEEEEEEEcccccccHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEcccccccEEEEEcccccEEEEcccccccccEEEEEEEEEEccEEEEEEEc
cccHHHHHHHHccccHHccccccccEEEEEEcccccccccHHHHHHHHHHccccccccHHHccEEEEccHHHHHHHHHHHHHHccHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHccccEEEEEccccHcHHHHHHHHHHccccEEEEEcccHccccccccccccHHccccccEEEEEEcccccccEEEEEEccccccccccHHHHHHHHHHHHHcccEEEEEcccccccccccccccccccHHHHHHHHHccccccEEEEcccccHcccHHHHHHHHHcccHHccccccccccHHHHHHHHHccccHHHHHHHHHHHHHHcccEEEEccEEEccccccHHHHHHHHHHHHHcccccEEEEEEccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEccccccccccccccccEEEEcccccHHccEEEEEEEEEcccccccEEEEc
MGLFIKLIGVAHMVSQIVDQcivpqrffvksygcqmnvydslRMEDMFFSQGyervnsmddadlIVLNTCHIREKAAEKVYSFLGRIRNLknsrikegGDLLVVVAGCVAqaegeeilrrspivnvvvgpqtyyrlpELLERArfgkrvvdtdysvedkferlsivdggynrkrgVTAFLTIQEGCDKFCTFCVVPYTRGIEISRSLSQVVDEARKLIDNGVCEITLLgqnvnawrgkgldgekctfsDLLYSLSEIKGLVrlryttshprdmsdclikahgdldvlmpylhlpvqsgsDRILKSMNRRHTAYEYRQIIDRIRsvrpdiaissdfivgfpgetdddfRATMDLVDKIGYAqafsfkysprlgtpgsnmleqVDENVKAERLLCLQKKLREQQVSFNDACVGQIIEVLIEKHgkekgklvgrspwlQSVVLNsknhnigdiIKVRITDVKISTLYGELVV
MGLFIKLIGVAHMVSQIVDQCIVPQRFFVKSYGCQMNVYDSLRMEDMFFSQGYERVNSMDDADLIVLNTCHIREKAAEKVYSFLGRIRNLKnsrikeggdLLVVVAGCVAQAegeeilrrspivnvvvgpqTYYRlpellerarfgkrvvdtdysvedkferlsivdggynrKRGVTAFLTIQEGCDKFCTFCVVPYTRGIEISRSLSQVVDEARKLIDNGVCEITLLGQNVNAWRGKGLDGEKCTFSDLLYSLSEIKGLVRLRYTTSHPRDMSDCLIKAHGDLDVLMPYLHLPVQSGSDRILKSMNRRHTAYEYRQIIDRIRSVRPDIAISSDFIVGFPGETDDDFRATMDLVDKIGYAQAFSFKYSPRLGTPGSNMLEQVDENVKAERLLCLQKKLREQQVSFNDACVGQIIEVLIEKHGKEKGKLVGRSPWLQSVVLnsknhnigdiikvritdvkistlygelvv
MGLFIKLIGVAHMVSQIVDQCIVPQRFFVKSYGCQMNVYDSLRMEDMFFSQGYERVNSMDDADLIVLNTCHIREKAAEKVYSFLGRIRNLKNSRIKEGGDLLVVVAGCVAQAEGEEILRRSPIVNVVVGPQTYYRLPELLERARFGKRVVDTDYSVEDKFERLSIVDGGYNRKRGVTAFLTIQEGCDKFCTFCVVPYTRGIEISRSLSQVVDEARKLIDNGVCEITLLGQNVNAWRGKGLDGEKCTFSDLLYSLSEIKGLVRLRYTTSHPRDMSDCLIKAHGDLDVLMPYLHLPVQSGSDRILKSMNRRHTAYEYRQIIDRIRSVRPDIAISSDFIVGFPGETDDDFRATMDLVDKIGYAQAFSFKYSPRLGTPGSNMLEQVDENVKAERLLCLQKKLREQQVSFNDACVGQIIEVLIEKHGKEKGKLVGRSPWLQSVVLNSKNHNIGDIIKVRITDVKISTLYGELVV
*GLFIK*IG*****************FFVKSYGCQMNVYDSLRMEDMFFSQGYERVNSMDDADLIVLNTCHIREKAAEKVYSFLGRIRNLKNSRIKEGGDLLVVVAGCVAQAEGEEILRRSPIVNVVVGPQTYYRLPELLERARFGKRVVDTDYSVEDKFERLSIVDG**NRKRGVTAFLTIQEGCDKFCTFCVVPYTRGIEISRSLSQVVDEARKLIDNGVCEITLLGQNVNAWRGKGLDGEKCTFSDLLYSLSEIKGLVRLRYTTSHPRDMSDCLIKAHGDLDVLMPYLHLPVQSGSDRILKSMNRRHTAYEYRQIIDRIRSVRPDIAISSDFIVGFPGETDDDFRATMDLVDKIGYAQAFSFKYSPRLGTPGSNMLEQVDENVKAERLLCLQKKLREQQVSFNDACVGQIIEVLIEKHGKEKGKLVGRSPWLQSVVLNSKNHNIGDIIKVRITDVKISTLYGELVV
MGLFIKLIGVAHMVSQIVDQCIVPQRFFVKSYGCQMNVYDSLRMEDMFFSQGYERVNSMDDADLIVLNTCHIREKAAEKVYSFLGRIRNLKNSRIKEGGDLLVVVAGCVAQAEGEEILRRSPIVNVVVGPQTYYRLPELLERARFGKRVVDTDYSVEDKFERLSIVDGGYNRKRGVTAFLTIQEGCDKFCTFCVVPYTRGIEISRSLSQVVDEARKLIDNGVCEITLLGQNVNAWRGKGLDGEKCTFSDLLYSLSEIKGLVRLRYTTSHPRDMSDCLIKAHGDLDVLMPYLHLPVQSGSDRILKSMNRRHTAYEYRQIIDRIRSVRPDIAISSDFIVGFPGETDDDFRATMDLVDKIGYAQAFSFKYSPRLGTPGSNMLEQVDENVKAERLLCLQKKLREQQVSFNDACVGQIIEVLIEKHGKEKGKLVGRSPWLQSVVLNSKNHNIGDIIKVRITDVKISTLYGELVV
MGLFIKLIGVAHMVSQIVDQCIVPQRFFVKSYGCQMNVYDSLRMEDMFFSQGYERVNSMDDADLIVLNTCHIREKAAEKVYSFLGRIRNLKNSRIKEGGDLLVVVAGCVAQAEGEEILRRSPIVNVVVGPQTYYRLPELLERARFGKRVVDTDYSVEDKFERLSIVDGGYNRKRGVTAFLTIQEGCDKFCTFCVVPYTRGIEISRSLSQVVDEARKLIDNGVCEITLLGQNVNAWRGKGLDGEKCTFSDLLYSLSEIKGLVRLRYTTSHPRDMSDCLIKAHGDLDVLMPYLHLPVQSGSDRILKSMNRRHTAYEYRQIIDRIRSVRPDIAISSDFIVGFPGETDDDFRATMDLVDKIGYAQAFSFKYSPRLGTPGSNMLEQVDENVKAERLLCLQKKLREQQVSFNDACVGQIIEVLIEKHGKEKGKLVGRSPWLQSVVLNSKNHNIGDIIKVRITDVKISTLYGELVV
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGLFIKLIGVAHMVSQIVDQCIVPQRFFVKSYGCQMNVYDSLRMEDMFFSQGYERVNSMDDADLIVLNTCHIREKAAEKVYSFLGRIRNLKNSRIKEGGDLLVVVAGCVAQAEGEEILRRSPIVNVVVGPQTYYRLPELLERARFGKRVVDTDYSVEDKFERLSIVDGGYNRKRGVTAFLTIQEGCDKFCTFCVVPYTRGIEISRSLSQVVDEARKLIDNGVCEITLLGQNVNAWRGKGLDGEKCTFSDLLYSLSEIKGLVRLRYTTSHPRDMSDCLIKAHGDLDVLMPYLHLPVQSGSDRILKSMNRRHTAYEYRQIIDRIRSVRPDIAISSDFIVGFPGETDDDFRATMDLVDKIGYAQAFSFKYSPRLGTPGSNMLEQVDENVKAERLLCLQKKLREQQVSFNDACVGQIIEVLIEKHGKEKGKLVGRSPWLQSVVLNSKNHNIGDIIKVRITDVKISTLYGELVV
MGLFIKLIGVAHMVSQIVDQCIVPQRFFVKSYGCQMNVYDSLRMEDMFFSQGYERVNSMDDADLIVLNTCHIREKAAEKVYSFLGRIRNLKNSRIKEGGDLLVVVAGCVAQAEGEEILRRSPIVNVVVGPQTYYRLPELLERARFGKRVVDTDYSVEDKFERLSIVDGGYNRKRGVTAFLTIQEGCDKFCTFCVVPYTRGIEISRSLSQVVDEARKLIDNGVCEITLLGQNVNAWRGKGLDGEKCTFSDLLYSLSEIKGLVRLRYTTSHPRDMSDCLIKAHGDLDVLMPYLHLPVQSGSDRILKSMNRRHTAYEYRQIIDRIRSVRPDIAISSDFIVGFPGETDDDFRATMDLVDKIGYAQAFSFKYSPRLGTPGSNMLEQVDENVKAERLLCLQKKLREQQVSFNDACVGQIIEVLIEKHGKEKGKLVGRSPWLQSVVLNSKNHNIGDIIKVRITDVKISTLYGELVV
MGLFIKLIGVAHMVSQIVDQCIVPQRFFVKSYGCQMNVYDSLRMEDMFFSQGYERVNSMDDADLIVLNTCHIREKAAEKVYSFLGRIRNLKNSRIKEGGDLLVVVAGCVAQAEGEEILRRSPIVNVVVGPQTYYRLPELLERARFGKRVVDTDYSVEDKFERLSIVDGGYNRKRGVTAFLTIQEGCDKFCTFCVVPYTRGIEISRSLSQVVDEARKLIDNGVCEITLLGQNVNAWRGKGLDGEKCTFSDLLYSLSEIKGLVRLRYTTSHPRDMSDCLIKAHGDLDVLMPYLHLPVQSGSDRILKSMNRRHTAYEYRQIIDRIRSVRPDIAISSDFIVGFPGETDDDFRATMDLVDKIGYAQAFSFKYSPRLGTPGSNMLEQVDENVKAERLLCLQKKLREQQVSFNDACVGQIIEVLIEKHGKEKGKLVGRSPWLQSVVLNSKNHNIGDIIKVRITDVKISTLYGELVV

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target469 2-methylthioadenine synthetase (miaB-like) protein [Can
315122124457 2-methylthioadenine synthetase (miaB-like) protein [Can 1 0.0
222084693470 2-methylthioadenine synthetase (miaB-like) protein [Agr 1 1e-173
116250164473 (dimethylallyl)adenosine tRNA methylthiotransferase [Rh 1 1e-171
222147351477 (dimethylallyl)adenosine tRNA methylthiotransferase [Ag 1 1e-171
159184272455 miaB protein [Agrobacterium tumefaciens str. C58] Lengt 1 1e-170
325291790467 miaB protein [Agrobacterium sp. H13-3] Length = 467 1 1e-170
241202785473 (dimethylallyl)adenosine tRNA methylthiotransferase [Rh 1 1e-170
327188593482 putative 2-methylthioadenine synthetase (miaB-like) pro 1 1e-170
86356033469 putative 2-methylthioadenine synthetase (miaB-like) pro 1 1e-170
190890046469 2-methylthioadenine synthetase (miaB-like) protein [Rhi 1 1e-169
>gi|315122124|ref|YP_004062613.1| 2-methylthioadenine synthetase (miaB-like) protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 457 Back     alignment and organism information
 Score =  808 bits (2088), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/457 (84%), Positives = 424/457 (92%)

Query: 13  MVSQIVDQCIVPQRFFVKSYGCQMNVYDSLRMEDMFFSQGYERVNSMDDADLIVLNTCHI 72
           MV Q V+Q + PQ+FFVKSYGCQMNVYDSLR+ED+FFS+GYER +S+DDADLIVLNTCHI
Sbjct: 1   MVLQAVNQNLSPQKFFVKSYGCQMNVYDSLRIEDIFFSKGYERADSIDDADLIVLNTCHI 60

Query: 73  REKAAEKVYSFLGRIRNLKNSRIKEGGDLLVVVAGCVAQAEGEEILRRSPIVNVVVGPQT 132
           REKAAEKVYS LGRIRNLKNSRIKEG + +VVVAGCVAQAEGEEILRRSPIVNVVVGPQT
Sbjct: 61  REKAAEKVYSSLGRIRNLKNSRIKEGRETIVVVAGCVAQAEGEEILRRSPIVNVVVGPQT 120

Query: 133 YYRLPELLERARFGKRVVDTDYSVEDKFERLSIVDGGYNRKRGVTAFLTIQEGCDKFCTF 192
           YYRLPELLERARFGKRVVDTDYS EDKFERLSIVDGGY R+R V AFLTIQEGCDKFCTF
Sbjct: 121 YYRLPELLERARFGKRVVDTDYSAEDKFERLSIVDGGYKRRRSVAAFLTIQEGCDKFCTF 180

Query: 193 CVVPYTRGIEISRSLSQVVDEARKLIDNGVCEITLLGQNVNAWRGKGLDGEKCTFSDLLY 252
           CVVPYTRG EISRSLSQ+V+EARKL+ +GV EITLLGQNVNAW GKGL+G+KC FSDLLY
Sbjct: 181 CVVPYTRGAEISRSLSQIVEEARKLVASGVREITLLGQNVNAWCGKGLNGQKCNFSDLLY 240

Query: 253 SLSEIKGLVRLRYTTSHPRDMSDCLIKAHGDLDVLMPYLHLPVQSGSDRILKSMNRRHTA 312
           SL++IK L+RLRYTTSHPRDMSDCLIKAHG+LD+LMPYLHLPVQSGSDRILKSMNRRHT 
Sbjct: 241 SLADIKSLIRLRYTTSHPRDMSDCLIKAHGELDILMPYLHLPVQSGSDRILKSMNRRHTV 300

Query: 313 YEYRQIIDRIRSVRPDIAISSDFIVGFPGETDDDFRATMDLVDKIGYAQAFSFKYSPRLG 372
           YEY+QIIDRIRS+RP+IAISSDFIVGFPGE D DF  TM+LV+ IGYAQAFSFKYSPR G
Sbjct: 301 YEYQQIIDRIRSIRPNIAISSDFIVGFPGERDSDFEGTMNLVENIGYAQAFSFKYSPRPG 360

Query: 373 TPGSNMLEQVDENVKAERLLCLQKKLREQQVSFNDACVGQIIEVLIEKHGKEKGKLVGRS 432
           TPG+NML QV+E+VK ERLLCLQKKLREQQVSFN+ C+GQI+EVLIEK GKE+G+LVGRS
Sbjct: 361 TPGANMLGQVEESVKTERLLCLQKKLREQQVSFNNDCIGQIVEVLIEKEGKERGQLVGRS 420

Query: 433 PWLQSVVLNSKNHNIGDIIKVRITDVKISTLYGELVV 469
           PWLQSVVL+ ++HNIGD++KVRITDVK  TLYGE VV
Sbjct: 421 PWLQSVVLDGRDHNIGDVVKVRITDVKTITLYGEFVV 457


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222084693|ref|YP_002543222.1| 2-methylthioadenine synthetase (miaB-like) protein [Agrobacterium radiobacter K84] Length = 470 Back     alignment and organism information
>gi|116250164|ref|YP_766002.1| (dimethylallyl)adenosine tRNA methylthiotransferase [Rhizobium leguminosarum bv. viciae 3841] Length = 473 Back     alignment and organism information
>gi|222147351|ref|YP_002548308.1| (dimethylallyl)adenosine tRNA methylthiotransferase [Agrobacterium vitis S4] Length = 477 Back     alignment and organism information
>gi|159184272|ref|NP_353388.2| miaB protein [Agrobacterium tumefaciens str. C58] Length = 455 Back     alignment and organism information
>gi|325291790|ref|YP_004277654.1| miaB protein [Agrobacterium sp. H13-3] Length = 467 Back     alignment and organism information
>gi|241202785|ref|YP_002973881.1| (dimethylallyl)adenosine tRNA methylthiotransferase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 473 Back     alignment and organism information
>gi|327188593|gb|EGE55803.1| putative 2-methylthioadenine synthetase (miaB-like) protein [Rhizobium etli CNPAF512] Length = 482 Back     alignment and organism information
>gi|86356033|ref|YP_467925.1| putative 2-methylthioadenine synthetase (miaB-like) protein [Rhizobium etli CFN 42] Length = 469 Back     alignment and organism information
>gi|190890046|ref|YP_001976588.1| 2-methylthioadenine synthetase (miaB-like) protein [Rhizobium etli CIAT 652] Length = 469 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target469 2-methylthioadenine synthetase (miaB-like) protein [Can
PRK14325444 PRK14325, PRK14325, (dimethylallyl)adenosine tRNA methy 0.0
TIGR00089429 TIGR00089, TIGR00089, RNA modification enzyme, MiaB fam 1e-136
PRK14328439 PRK14328, PRK14328, (dimethylallyl)adenosine tRNA methy 1e-123
TIGR01574438 TIGR01574, miaB-methiolase, tRNA-N(6)-(isopentenyl)aden 1e-123
PRK14337446 PRK14337, PRK14337, (dimethylallyl)adenosine tRNA methy 1e-113
PRK14331437 PRK14331, PRK14331, (dimethylallyl)adenosine tRNA methy 1e-109
PRK14329467 PRK14329, PRK14329, (dimethylallyl)adenosine tRNA methy 1e-108
PRK14327509 PRK14327, PRK14327, (dimethylallyl)adenosine tRNA methy 1e-103
PRK14333448 PRK14333, PRK14333, (dimethylallyl)adenosine tRNA methy 1e-101
PRK14326502 PRK14326, PRK14326, (dimethylallyl)adenosine tRNA methy 3e-99
PRK14340445 PRK14340, PRK14340, (dimethylallyl)adenosine tRNA methy 1e-98
PRK14330434 PRK14330, PRK14330, (dimethylallyl)adenosine tRNA methy 1e-94
PRK14338459 PRK14338, PRK14338, (dimethylallyl)adenosine tRNA methy 6e-90
PRK14339420 PRK14339, PRK14339, (dimethylallyl)adenosine tRNA methy 7e-90
PRK14335455 PRK14335, PRK14335, (dimethylallyl)adenosine tRNA methy 2e-89
PRK14334440 PRK14334, PRK14334, (dimethylallyl)adenosine tRNA methy 4e-87
PRK14332449 PRK14332, PRK14332, (dimethylallyl)adenosine tRNA methy 3e-82
PRK14336418 PRK14336, PRK14336, (dimethylallyl)adenosine tRNA methy 2e-81
KOG2492552 KOG2492, KOG2492, KOG2492, CDK5 activator-binding prote 1e-80
TIGR01579414 TIGR01579, MiaB-like-C, MiaB-like tRNA modifying enzyme 1e-75
TIGR01125430 TIGR01125, TIGR01125, MiaB-like tRNA modifying enzyme Y 3e-71
TIGR01578420 TIGR01578, MiaB-like-B, MiaB-like tRNA modifying enzyme 2e-62
PRK14862440 PRK14862, rimO, ribosomal protein S12 methylthiotransfe 2e-51
KOG4355547 KOG4355, KOG4355, KOG4355, Predicted Fe-S oxidoreductas 1e-43
COG0621437 COG0621, MiaB, 2-methylthioadenine synthetase [Translat 1e-143
smart00729216 smart00729, Elp3, Elongator protein 3, MiaB family, Rad 2e-39
cd01335204 cd01335, Radical_SAM, Radical SAM superfamily 0.003
pfam0091998 pfam00919, UPF0004, Uncharacterized protein family UPF0 3e-30
pfam04055165 pfam04055, Radical_SAM, Radical SAM superfamily 4e-18
TIGR03471472 TIGR03471, HpnJ, hopanoid biosynthesis associated radic 4e-05
COG1032490 COG1032, COG1032, Fe-S oxidoreductase [Energy productio 7e-15
COG0635416 COG0635, HemN, Coproporphyrinogen III oxidase and relat 3e-07
PRK08207488 PRK08207, PRK08207, coproporphyrinogen III oxidase; Pro 2e-05
COG1242312 COG1242, COG1242, Predicted Fe-S oxidoreductase [Genera 3e-05
TIGR01212302 TIGR01212, TIGR01212, radical SAM protein, TIGR01212 fa 6e-05
PRK05628375 PRK05628, PRK05628, coproporphyrinogen III oxidase; Val 5e-04
PRK08629433 PRK08629, PRK08629, coproporphyrinogen III oxidase; Pro 0.001
PRK09058449 PRK09058, PRK09058, coproporphyrinogen III oxidase; Pro 0.001
pfam0193859 pfam01938, TRAM, TRAM domain 1e-04
COG1031560 COG1031, COG1031, Uncharacterized Fe-S oxidoreductase [ 0.001
>gnl|CDD|184622 PRK14325, PRK14325, (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional Back     alignment and domain information
>gnl|CDD|161701 TIGR00089, TIGR00089, RNA modification enzyme, MiaB family Back     alignment and domain information
>gnl|CDD|184625 PRK14328, PRK14328, (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional Back     alignment and domain information
>gnl|CDD|162429 TIGR01574, miaB-methiolase, tRNA-N(6)-(isopentenyl)adenosine-37 thiotransferase enzyme MiaB Back     alignment and domain information
>gnl|CDD|172813 PRK14337, PRK14337, (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional Back     alignment and domain information
>gnl|CDD|184628 PRK14331, PRK14331, (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional Back     alignment and domain information
>gnl|CDD|184626 PRK14329, PRK14329, (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional Back     alignment and domain information
>gnl|CDD|184624 PRK14327, PRK14327, (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional Back     alignment and domain information
>gnl|CDD|184629 PRK14333, PRK14333, (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional Back     alignment and domain information
>gnl|CDD|184623 PRK14326, PRK14326, (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional Back     alignment and domain information
>gnl|CDD|172816 PRK14340, PRK14340, (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional Back     alignment and domain information
>gnl|CDD|184627 PRK14330, PRK14330, (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional Back     alignment and domain information
>gnl|CDD|184633 PRK14338, PRK14338, (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional Back     alignment and domain information
>gnl|CDD|184634 PRK14339, PRK14339, (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional Back     alignment and domain information
>gnl|CDD|184631 PRK14335, PRK14335, (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional Back     alignment and domain information
>gnl|CDD|184630 PRK14334, PRK14334, (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional Back     alignment and domain information
>gnl|CDD|172808 PRK14332, PRK14332, (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional Back     alignment and domain information
>gnl|CDD|184632 PRK14336, PRK14336, (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional Back     alignment and domain information
>gnl|CDD|37703 KOG2492, KOG2492, KOG2492, CDK5 activator-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|162433 TIGR01579, MiaB-like-C, MiaB-like tRNA modifying enzyme Back     alignment and domain information
>gnl|CDD|162211 TIGR01125, TIGR01125, MiaB-like tRNA modifying enzyme YliG, TIGR01125 Back     alignment and domain information
>gnl|CDD|162432 TIGR01578, MiaB-like-B, MiaB-like tRNA modifying enzyme, archaeal-type Back     alignment and domain information
>gnl|CDD|184864 PRK14862, rimO, ribosomal protein S12 methylthiotransferase; Provisional Back     alignment and domain information
>gnl|CDD|39556 KOG4355, KOG4355, KOG4355, Predicted Fe-S oxidoreductase [General function prediction only] Back     alignment and domain information
>gnl|CDD|30966 COG0621, MiaB, 2-methylthioadenine synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|128968 smart00729, Elp3, Elongator protein 3, MiaB family, Radical SAM Back     alignment and domain information
>gnl|CDD|100105 cd01335, Radical_SAM, Radical SAM superfamily Back     alignment and domain information
>gnl|CDD|144496 pfam00919, UPF0004, Uncharacterized protein family UPF0004 Back     alignment and domain information
>gnl|CDD|146602 pfam04055, Radical_SAM, Radical SAM superfamily Back     alignment and domain information
>gnl|CDD|132511 TIGR03471, HpnJ, hopanoid biosynthesis associated radical SAM protein HpnJ Back     alignment and domain information
>gnl|CDD|31235 COG1032, COG1032, Fe-S oxidoreductase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|30980 COG0635, HemN, Coproporphyrinogen III oxidase and related Fe-S oxidoreductases [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|181291 PRK08207, PRK08207, coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>gnl|CDD|31435 COG1242, COG1242, Predicted Fe-S oxidoreductase [General function prediction only] Back     alignment and domain information
>gnl|CDD|130279 TIGR01212, TIGR01212, radical SAM protein, TIGR01212 family Back     alignment and domain information
>gnl|CDD|180172 PRK05628, PRK05628, coproporphyrinogen III oxidase; Validated Back     alignment and domain information
>gnl|CDD|181509 PRK08629, PRK08629, coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>gnl|CDD|181630 PRK09058, PRK09058, coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>gnl|CDD|110897 pfam01938, TRAM, TRAM domain Back     alignment and domain information
>gnl|CDD|31234 COG1031, COG1031, Uncharacterized Fe-S oxidoreductase [Energy production and conversion] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 469 2-methylthioadenine synthetase (miaB-like) protein [Can
TIGR00089455 TIGR00089 RNA modification enzyme, MiaB family; InterPr 100.0
COG0621437 MiaB 2-methylthioadenine synthetase [Translation, ribos 100.0
TIGR01579492 MiaB-like-C MiaB-like tRNA modifying enzyme; InterPro: 100.0
TIGR01574456 miaB-methiolase tRNA-i(6)A37 thiotransferase enzyme Mia 100.0
TIGR01125475 TIGR01125 MiaB-like tRNA modifying enzyme YliG, TIGR011 100.0
TIGR01578487 MiaB-like-B MiaB-like tRNA modifying enzyme, archaeal-t 100.0
KOG2492552 consensus 100.0
KOG4355547 consensus 100.0
TIGR03471472 HpnJ hopanoid biosynthesis associated radical SAM prote 100.0
COG1032490 Fe-S oxidoreductase [Energy production and conversion] 99.95
TIGR02026506 BchE magnesium-protoporphyrin IX monomethyl ester anaer 99.87
smart00729216 Elp3 Elongator protein 3, MiaB family, Radical SAM. Thi 99.96
cd01335204 Radical_SAM Radical SAM superfamily. Enzymes of this fa 99.91
PRK08208436 coproporphyrinogen III oxidase; Validated 99.75
PRK08599377 coproporphyrinogen III oxidase; Provisional 99.75
PRK05799374 coproporphyrinogen III oxidase; Provisional 99.73
PRK05904353 coproporphyrinogen III oxidase; Provisional 99.73
PRK08207497 coproporphyrinogen III oxidase; Provisional 99.72
PRK09057381 coproporphyrinogen III oxidase; Provisional 99.7
PRK07379399 coproporphyrinogen III oxidase; Provisional 99.7
PRK08807385 consensus 99.7
PRK06582390 coproporphyrinogen III oxidase; Provisional 99.7
PRK05660378 coproporphyrinogen III oxidase; Provisional 99.69
PRK08446351 coproporphyrinogen III oxidase; Provisional 99.69
PRK05628376 coproporphyrinogen III oxidase; Validated 99.69
PRK08898393 coproporphyrinogen III oxidase; Provisional 99.68
PRK08949378 consensus 99.67
PRK06294374 coproporphyrinogen III oxidase; Provisional 99.67
PRK09058447 coproporphyrinogen III oxidase; Provisional 99.67
PRK13347 453 coproporphyrinogen III oxidase; Provisional 99.67
PRK07094323 biotin synthase; Provisional 99.64
COG0635416 HemN Coproporphyrinogen III oxidase and related Fe-S ox 99.63
PRK00955599 hypothetical protein; Provisional 99.63
PRK09249 456 coproporphyrinogen III oxidase; Provisional 99.63
TIGR01212307 TIGR01212 radical SAM protein, TIGR01212 family; InterP 99.63
PRK08629424 coproporphyrinogen III oxidase; Provisional 99.61
COG1242312 Predicted Fe-S oxidoreductase [General function predict 99.56
PRK06256325 biotin synthase; Validated 99.36
PRK06267324 hypothetical protein; Provisional 99.36
COG1243 515 ELP3 Histone acetyltransferase [Transcription / Chromat 99.24
PRK08508279 biotin synthase; Provisional 99.2
TIGR00538 462 hemN oxygen-independent coproporphyrinogen III oxidase; 99.15
COG0502335 BioB Biotin synthase and related enzymes [Coenzyme meta 99.07
TIGR00539371 hemN_rel putative oxygen-independent coproporphyrinogen 98.99
) of Arabidopsis thaliana (Mouse-ear cress), mammalian Gephryin (e.g. Q9NQX3 from SWISSPROT) and Drosophila melanogaster (Fruit fly) Cinnamon (P39205 from SWISSPROT) . This entry represents the bacterial form of MoaA (molybdenum cofactor biosynthesis protein A). The MoaA protein is a member of the wider S-adenosylmethionine(SAM)-dependent enzyme family which catalyze the formation of protein and/or substrate radicals by reductive cleavage of SAM via a [4Fe-4S] cluster. Monomeric and homodimeric forms of MoaA have been observed in vivo, and it is not clear what the physiologically relevant form of the enzyme is . The core of each monomer consists of an incomplete TIM barrel, formed by the N-terminal region of the protein, containing a [4Fe-4S] cluster. The C-terminal region of the protein, which also contains a [4Fe-4S] cluster consists of a beta-sheet covering the lateral opening of the barrel, an extended loop and three alpha helices. The N-terminal [4Fe-4S] cluster is coordinated with 3 cysteines and an exchangeable SAM molecule, while the C-terminal [4Fe-4S], also coordinated with 3 cysteines, is the binding and activation site for GTP .; GO: 0046872 metal ion binding, 0006777 Mo-molybdopterin cofactor biosynthetic process." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR02666">TIGR02666346 moaA molybdenum cofactor biosynthesis protein A; InterP 98.86
PRK00164334 moaA molybdenum cofactor biosynthesis protein A; Review 98.86
PRK06245336 cofG FO synthase subunit 1; Reviewed 98.85
PRK13361329 molybdenum cofactor biosynthesis protein A; Provisional 98.84
COG0320306 LipA Lipoate synthase [Coenzyme metabolism] 98.82
TIGR03551343 F420_cofH 7,8-didemethyl-8-hydroxy-5-deazariboflavin sy 98.81
PRK05481289 lipoyl synthase; Provisional 98.78
PRK12928290 lipoyl synthase; Provisional 98.77
COG2896322 MoaA Molybdenum cofactor biosynthesis enzyme [Coenzyme 98.72
COG0731296 Fe-S oxidoreductases [Energy production and conversion] 98.71
TIGR03550322 F420_cofG 7,8-didemethyl-8-hydroxy-5-deazariboflavin sy 98.7
PRK07360375 FO synthase subunit 2; Reviewed 98.69
PRK05301375 pyrroloquinoline quinone biosynthesis protein PqqE; Pro 98.6
COG1060370 ThiH Thiamine biosynthesis enzyme ThiH and related unch 98.6
PRK05927350 hypothetical protein; Provisional 98.51
PRK08444353 hypothetical protein; Provisional 98.45
COG1509369 KamA Lysine 2,3-aminomutase [Amino acid transport and m 98.44
PRK09234846 fbiC FO synthase; Reviewed 98.42
PRK08445348 hypothetical protein; Provisional 98.39
PRK11194372 hypothetical protein; Provisional 98.33
PRK09234 846 fbiC FO synthase; Reviewed 98.24
COG1856275 Uncharacterized homolog of biotin synthetase [Function 98.16
PRK05926371 hypothetical protein; Provisional 98.16
PRK11145246 pflA pyruvate formate lyase-activating enzyme 1; Provis 98.12
KOG2672360 consensus 98.1
TIGR00510310 lipA lipoic acid synthetase; InterPro: IPR003698 Lipoic 98.03
TIGR00433350 bioB biotin synthase; InterPro: IPR002684 Biotin syntha 98.02
COG0820349 Predicted Fe-S-cluster redox enzyme [General function p 97.98
COG0535347 Predicted Fe-S oxidoreductases [General function predic 97.96
TIGR00423331 TIGR00423 conserved hypothetical protein TIGR00423; Int 97.91
TIGR03470318 HpnH hopanoid biosynthesis associated radical SAM prote 97.89
PRK13758370 anaerobic sulfatase-maturase; Provisional 97.86
COG1533297 SplB DNA repair photolyase [DNA replication, recombinat 97.62
TIGR01211 573 ELP3 histone acetyltransferase, ELP3 family; InterPro: 97.59
COG1625 414 Fe-S oxidoreductase, related to NifB/MoaA family [Energ 97.54
COG4277404 Predicted DNA-binding protein with the Helix-hairpin-he 97.49
KOG2900380 consensus 97.39
COG1180260 PflA Pyruvate-formate lyase-activating enzyme [Posttran 97.28
COG0641378 AslB Arylsulfatase regulator (Fe-S oxidoreductase) [Gen 97.06
PRK13762321 tRNA-modifying enzyme; Provisional 97.02
TIGR00048378 TIGR00048 radical SAM enzyme, Cfr family; InterPro: IPR 96.81
TIGR02493243 PFLA pyruvate formate-lyase 1-activating enzyme; InterP 96.73
TIGR03278404 methan_mark_10 putative methanogenesis marker protein 1 96.53
COG1313335 PflX Uncharacterized Fe-S protein PflX, homolog of pyru 96.37
TIGR02668324 moaA_archaeal probable molybdenum cofactor biosynthesis 96.12
TIGR01290 461 nifB nitrogenase cofactor biosynthesis protein NifB; In 90.77
pfam0091998 UPF0004 Uncharacterized protein family UPF0004. This fa 99.94
cd02065125 B12-binding_like B12 binding domain (B12-BD). Most of t 93.99
cd02071122 MM_CoA_mut_B12_BD methylmalonyl CoA mutase B12 binding 92.04
PRK02261137 methylaspartate mutase subunit S; Provisional 90.79
COG1031560 Uncharacterized Fe-S oxidoreductase [Energy production 99.87
COG2100414 Predicted Fe-S oxidoreductase [General function predict 99.25
pfam04055165 Radical_SAM Radical SAM superfamily. Radical SAM protei 99.68
COG1244358 Predicted Fe-S oxidoreductase [General function predict 98.27
TIGR02495220 NrdG2 anaerobic ribonucleoside-triphosphate reductase a 97.28
PRK09240371 thiH thiamine biosynthesis protein ThiH; Reviewed 96.66
PRK09613471 thiH thiamine biosynthesis protein ThiH; Reviewed 95.88
COG2108353 Uncharacterized conserved protein related to pyruvate f 95.73
TIGR00238357 TIGR00238 lysine 2,3-aminomutase YodO family protein; I 94.14
PRK10076213 pyruvate formate lyase II activase; Provisional 93.18
PRK01254742 hypothetical protein; Provisional 99.63
COG2516339 Biotin synthase-related enzyme [General function predic 98.31
PRK13745412 anaerobic sulfatase-maturase; Provisional 97.19
TIGR02109363 PQQ_syn_pqqE coenzyme PQQ biosynthesis protein E; Inter 90.32
pfam0193859 TRAM TRAM domain. This small domain has no known functi 98.18
PRK12336201 translation initiation factor IF-2 subunit beta; Provis 92.47
TIGR03365238 Bsubt_queE 7-cyano-7-deazaguanosine (preQ0) biosynthesi 97.51
COG0602212 NrdG Organic radical activating enzymes [Posttranslatio 96.25
KOG2876323 consensus 91.76
cd02068127 radical_SAM_B12_BD B12 binding domain_like associated w 97.34
pfam02310121 B12-binding B12 binding domain. This domain binds to B1 96.75
TIGR03279 433 cyano_FeS_chp putative FeS-containing Cyanobacterial-sp 96.7
TIGR02351378 thiH thiazole biosynthesis protein ThiH; InterPro: IPR0 94.27
TIGR02494305 PFLE_PFLC glycyl-radical enzyme activating protein fami 92.39
PRK09426715 methylmalonyl-CoA mutase; Reviewed 90.45
COG4956356 Integral membrane protein (PIN domain superfamily) [Gen 90.18
>TIGR00089 TIGR00089 RNA modification enzyme, MiaB family; InterPro: IPR005839 This entry represents a family defined on the basis of sequence similarity Back     alignment and domain information
>COG0621 MiaB 2-methylthioadenine synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01579 MiaB-like-C MiaB-like tRNA modifying enzyme; InterPro: IPR006467 This clade of sequences is closely related to MiaB, a modifier of isopentenylated adenosine-37 of certain eukaryotic and bacterial tRNAs (see IPR006463 from INTERPRO) Back     alignment and domain information
>TIGR01574 miaB-methiolase tRNA-i(6)A37 thiotransferase enzyme MiaB; InterPro: IPR006463 These sequences are homologs of the MiaB enzyme responsible for the modification of the isopentenylated adenine-37 base of most bacterial and eukaryotic tRNAs that read codons beginning with uracil (all except tRNA(I,V) Ser) Back     alignment and domain information
>TIGR01125 TIGR01125 MiaB-like tRNA modifying enzyme YliG, TIGR01125; InterPro: IPR005840 This is a family of mainly hypothetical proteins of unknown function Back     alignment and domain information
>TIGR01578 MiaB-like-B MiaB-like tRNA modifying enzyme, archaeal-type; InterPro: IPR006466 This clade of sequences is closely related to MiaB, a modifier of isopentenylated adenosine-37 of certain eukaryotic and bacterial tRNAs (see IPR006463 from INTERPRO) Back     alignment and domain information
>KOG2492 consensus Back     alignment and domain information
>KOG4355 consensus Back     alignment and domain information
>TIGR03471 HpnJ hopanoid biosynthesis associated radical SAM protein HpnJ Back     alignment and domain information
>COG1032 Fe-S oxidoreductase [Energy production and conversion] Back     alignment and domain information
>TIGR02026 BchE magnesium-protoporphyrin IX monomethyl ester anaerobic oxidative cyclase; InterPro: IPR011772 This entry respresents the cobalamin-dependent oxidative cyclase responsible for forming the distinctive E-ring of the chlorin ring system under anaerobic conditions Back     alignment and domain information
>smart00729 Elp3 Elongator protein 3, MiaB family, Radical SAM Back     alignment and domain information
>cd01335 Radical_SAM Radical SAM superfamily Back     alignment and domain information
>PRK08208 coproporphyrinogen III oxidase; Validated Back     alignment and domain information
>PRK08599 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK05799 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK05904 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK08207 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK09057 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK07379 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK08807 consensus Back     alignment and domain information
>PRK06582 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK05660 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK08446 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK05628 coproporphyrinogen III oxidase; Validated Back     alignment and domain information
>PRK08898 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK08949 consensus Back     alignment and domain information
>PRK06294 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK09058 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK13347 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK07094 biotin synthase; Provisional Back     alignment and domain information
>COG0635 HemN Coproporphyrinogen III oxidase and related Fe-S oxidoreductases [Coenzyme metabolism] Back     alignment and domain information
>PRK00955 hypothetical protein; Provisional Back     alignment and domain information
>PRK09249 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>TIGR01212 TIGR01212 radical SAM protein, TIGR01212 family; InterPro: IPR005911 This uncharacterised protein family shows significant similarity to IPR005910 from INTERPRO, a longer protein that is a histone acetyltransferase at its C-terminus and is a subunit of RNA polymerase II (in yeast) Back     alignment and domain information
>PRK08629 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>COG1242 Predicted Fe-S oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK06256 biotin synthase; Validated Back     alignment and domain information
>PRK06267 hypothetical protein; Provisional Back     alignment and domain information
>COG1243 ELP3 Histone acetyltransferase [Transcription / Chromatin structure and dynamics] Back     alignment and domain information
>PRK08508 biotin synthase; Provisional Back     alignment and domain information
>TIGR00538 hemN oxygen-independent coproporphyrinogen III oxidase; InterPro: IPR004558 This family represents HemN, the oxygen-independent coproporphyrinogen III oxidase that replaces HemF function under anaerobic conditions Back     alignment and domain information
>COG0502 BioB Biotin synthase and related enzymes [Coenzyme metabolism] Back     alignment and domain information
>TIGR00539 hemN_rel putative oxygen-independent coproporphyrinogen III oxidase; InterPro: IPR004559 Experimentally determined examples of oxygen-independent coproporphyrinogen III oxidase, an enzyme that replaces HemF function under anaerobic conditions, belong to a family of proteins called HemN (IPR004558 from INTERPRO) Back     alignment and domain information
>TIGR02666 moaA molybdenum cofactor biosynthesis protein A; InterPro: IPR013483 The majority of molybdenum-containing enzymes utilise a molybdenum cofactor (MoCF or Moco) consisting of a Mo atom coordinated via a cisdithiolene moiety to molybdopterin (MPT) Back     alignment and domain information
>PRK00164 moaA molybdenum cofactor biosynthesis protein A; Reviewed Back     alignment and domain information
>PRK06245 cofG FO synthase subunit 1; Reviewed Back     alignment and domain information
>PRK13361 molybdenum cofactor biosynthesis protein A; Provisional Back     alignment and domain information
>COG0320 LipA Lipoate synthase [Coenzyme metabolism] Back     alignment and domain information
>TIGR03551 F420_cofH 7,8-didemethyl-8-hydroxy-5-deazariboflavin synthase, CofH subunit Back     alignment and domain information
>PRK05481 lipoyl synthase; Provisional Back     alignment and domain information
>PRK12928 lipoyl synthase; Provisional Back     alignment and domain information
>COG2896 MoaA Molybdenum cofactor biosynthesis enzyme [Coenzyme metabolism] Back     alignment and domain information
>COG0731 Fe-S oxidoreductases [Energy production and conversion] Back     alignment and domain information
>TIGR03550 F420_cofG 7,8-didemethyl-8-hydroxy-5-deazariboflavin synthase, CofG subunit Back     alignment and domain information
>PRK07360 FO synthase subunit 2; Reviewed Back     alignment and domain information
>PRK05301 pyrroloquinoline quinone biosynthesis protein PqqE; Provisional Back     alignment and domain information
>COG1060 ThiH Thiamine biosynthesis enzyme ThiH and related uncharacterized enzymes [Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>PRK05927 hypothetical protein; Provisional Back     alignment and domain information
>PRK08444 hypothetical protein; Provisional Back     alignment and domain information
>COG1509 KamA Lysine 2,3-aminomutase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09234 fbiC FO synthase; Reviewed Back     alignment and domain information
>PRK08445 hypothetical protein; Provisional Back     alignment and domain information
>PRK11194 hypothetical protein; Provisional Back     alignment and domain information
>PRK09234 fbiC FO synthase; Reviewed Back     alignment and domain information
>COG1856 Uncharacterized homolog of biotin synthetase [Function unknown] Back     alignment and domain information
>PRK05926 hypothetical protein; Provisional Back     alignment and domain information
>PRK11145 pflA pyruvate formate lyase-activating enzyme 1; Provisional Back     alignment and domain information
>KOG2672 consensus Back     alignment and domain information
>TIGR00510 lipA lipoic acid synthetase; InterPro: IPR003698 Lipoic acid is a covalently bound disulphide-containing cofactor required for function of the pyruvate dehydrogenase, alpha-ketoglutarate dehydrogenase, and glycine cleavage enzyme complexes of Escherichia coli Back     alignment and domain information
>TIGR00433 bioB biotin synthase; InterPro: IPR002684 Biotin synthase 2 Back     alignment and domain information
>COG0820 Predicted Fe-S-cluster redox enzyme [General function prediction only] Back     alignment and domain information
>COG0535 Predicted Fe-S oxidoreductases [General function prediction only] Back     alignment and domain information
>TIGR00423 TIGR00423 conserved hypothetical protein TIGR00423; InterPro: IPR005244 This entry describes a family of conserved hypothetical proteins with no known function Back     alignment and domain information
>TIGR03470 HpnH hopanoid biosynthesis associated radical SAM protein HpnH Back     alignment and domain information
>PRK13758 anaerobic sulfatase-maturase; Provisional Back     alignment and domain information
>COG1533 SplB DNA repair photolyase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01211 ELP3 histone acetyltransferase, ELP3 family; InterPro: IPR005910 Histone acetylation is carried out by a class of enzymes known as histone acetyltransferases (HATs), which catalyse the transfer of an acetyl group from acetyl-CoA to the lysine E-amino groups on the N-terminal tails of histones Back     alignment and domain information
>COG1625 Fe-S oxidoreductase, related to NifB/MoaA family [Energy production and conversion] Back     alignment and domain information
>COG4277 Predicted DNA-binding protein with the Helix-hairpin-helix motif [General function prediction only] Back     alignment and domain information
>KOG2900 consensus Back     alignment and domain information
>COG1180 PflA Pyruvate-formate lyase-activating enzyme [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0641 AslB Arylsulfatase regulator (Fe-S oxidoreductase) [General function prediction only] Back     alignment and domain information
>PRK13762 tRNA-modifying enzyme; Provisional Back     alignment and domain information
>TIGR00048 TIGR00048 radical SAM enzyme, Cfr family; InterPro: IPR004383 This family of conserved hypothetical proteins groups bacterial proteins of unknown function Back     alignment and domain information
>TIGR02493 PFLA pyruvate formate-lyase 1-activating enzyme; InterPro: IPR012838 Members of this family are iron-sulphur proteins with a radical-SAM domain Back     alignment and domain information
>TIGR03278 methan_mark_10 putative methanogenesis marker protein 10 Back     alignment and domain information
>COG1313 PflX Uncharacterized Fe-S protein PflX, homolog of pyruvate formate lyase activating proteins [General function prediction only] Back     alignment and domain information
>TIGR02668 moaA_archaeal probable molybdenum cofactor biosynthesis protein A; InterPro: IPR013485 This entry consists of archaeal proteins which are predicted to be functionally equivalent to MoaA (molybdenum cofactor biosynthesis protein A) from bacteria (see IPR013483 from INTERPRO) Back     alignment and domain information
>TIGR01290 nifB nitrogenase cofactor biosynthesis protein NifB; InterPro: IPR005980 NifB is a protein required for the biosynthesis of the iron-molybdenum (or iron-vanadium) cofactor used by the nitrogen-fixing enzyme nitrogenase Back     alignment and domain information
>pfam00919 UPF0004 Uncharacterized protein family UPF0004 Back     alignment and domain information
>cd02065 B12-binding_like B12 binding domain (B12-BD) Back     alignment and domain information
>cd02071 MM_CoA_mut_B12_BD methylmalonyl CoA mutase B12 binding domain Back     alignment and domain information
>PRK02261 methylaspartate mutase subunit S; Provisional Back     alignment and domain information
>COG1031 Uncharacterized Fe-S oxidoreductase [Energy production and conversion] Back     alignment and domain information
>COG2100 Predicted Fe-S oxidoreductase [General function prediction only] Back     alignment and domain information
>pfam04055 Radical_SAM Radical SAM superfamily Back     alignment and domain information
>COG1244 Predicted Fe-S oxidoreductase [General function prediction only] Back     alignment and domain information
>TIGR02495 NrdG2 anaerobic ribonucleoside-triphosphate reductase activating protein; InterPro: IPR012840 This enzyme is a member of the radical-SAM family Back     alignment and domain information
>PRK09240 thiH thiamine biosynthesis protein ThiH; Reviewed Back     alignment and domain information
>PRK09613 thiH thiamine biosynthesis protein ThiH; Reviewed Back     alignment and domain information
>COG2108 Uncharacterized conserved protein related to pyruvate formate-lyase activating enzyme [General function prediction only] Back     alignment and domain information
>TIGR00238 TIGR00238 lysine 2,3-aminomutase YodO family protein; InterPro: IPR003739 This family represents essentially the whole of the Escherichia coli YjeK family and of some of its apparent orthologs Back     alignment and domain information
>PRK10076 pyruvate formate lyase II activase; Provisional Back     alignment and domain information
>PRK01254 hypothetical protein; Provisional Back     alignment and domain information
>COG2516 Biotin synthase-related enzyme [General function prediction only] Back     alignment and domain information
>PRK13745 anaerobic sulfatase-maturase; Provisional Back     alignment and domain information
>TIGR02109 PQQ_syn_pqqE coenzyme PQQ biosynthesis protein E; InterPro: IPR011843 This entry describes coenzyme PQQ biosynthesis protein E, a gene required for the biosynthesis of pyrrolo-quinoline-quinone (coenzyme PQQ) Back     alignment and domain information
>pfam01938 TRAM TRAM domain Back     alignment and domain information
>PRK12336 translation initiation factor IF-2 subunit beta; Provisional Back     alignment and domain information
>TIGR03365 Bsubt_queE 7-cyano-7-deazaguanosine (preQ0) biosynthesis protein QueE Back     alignment and domain information
>COG0602 NrdG Organic radical activating enzymes [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2876 consensus Back     alignment and domain information
>cd02068 radical_SAM_B12_BD B12 binding domain_like associated with radical SAM domain Back     alignment and domain information
>pfam02310 B12-binding B12 binding domain Back     alignment and domain information
>TIGR03279 cyano_FeS_chp putative FeS-containing Cyanobacterial-specific oxidoreductase Back     alignment and domain information
>TIGR02351 thiH thiazole biosynthesis protein ThiH; InterPro: IPR012726 Members of this protein family are the ThiH proteins involved in thiamine biosynthesis Back     alignment and domain information
>TIGR02494 PFLE_PFLC glycyl-radical enzyme activating protein family; InterPro: IPR012839 This subset of the radical-SAM domain includes a number of probable activating proteins acting on different enzymes all requiring an amino-acid-centred radical Back     alignment and domain information
>PRK09426 methylmalonyl-CoA mutase; Reviewed Back     alignment and domain information
>COG4956 Integral membrane protein (PIN domain superfamily) [General function prediction only] Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target469 2-methylthioadenine synthetase (miaB-like) protein [Can
2qgq_A304 Crystal Structure Of Tm_1862 From Thermotoga Mariti 4e-30
>gi|152149498|pdb|2QGQ|A Chain A, Crystal Structure Of Tm_1862 From Thermotoga Maritima. Northeast Structural Genomics Consortium Target Vr77 Length = 304 Back     alignment and structure
 Score =  137 bits (345), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 95/301 (31%), Positives = 150/301 (49%), Gaps = 8/301 (2%)

Query: 173 KRGVTAFLTIQEGCDKFCTFCVVPYTRGIEISRSLSQVVDEARKLIDNGVCEITLLGQNV 232
           +    A++ I +GCD+ CTFC +P  +G   SRS+  +  E   L+  G  EI L+ Q+ 
Sbjct: 1   EERPYAYVKISDGCDRGCTFCSIPSFKGSLRSRSIEDITREVEDLLKEGKKEIILVAQDT 60

Query: 233 NAWRGKGLDGEKCTFSDLLYSLSEIKGLVRLRYTTSHPRDMSDCLIKAHGDLDVLMPYLH 292
            ++        K    DLL  L+ + G   +R    HP  +++ +I A  +LD ++ Y  
Sbjct: 61  TSYGIDLY--RKQALPDLLRRLNSLNGEFWIRVXYLHPDHLTEEIISAXLELDKVVKYFD 118

Query: 293 LPVQSGSDRILKSMNRRHTAYEYRQIIDRIRSVRPDIAISSDFIVGFPGETDDDFRATMD 352
           +PVQ GSD+ILK   R  ++ E ++ +  IR   PD  + +  IVGFPGET++DF     
Sbjct: 119 VPVQHGSDKILKLXGRTKSSEELKKXLSSIRERFPDAVLRTSIIVGFPGETEEDFEELKQ 178

Query: 353 LVDKIGYAQAFSFKYSPRLGTPGSNMLEQVDENVKAERLLCLQKKLREQQVSFNDACVGQ 412
            V++I + +  +F YS   GT   N+ E+VD      R   L     E   S  D  VG+
Sbjct: 179 FVEEIQFDKLGAFVYSDEEGTVAFNLKEKVDPEXAKRRQEELLLLQAEISNSRLDRFVGK 238

Query: 413 IIEVLIEKHGKEKGKLVGRS----PWLQSVVLNSKNHNIGDIIKVRITDVKISTLYGELV 468
            ++ L+E   KE   LVGR+    P +  VV       IGD ++V I +      +G ++
Sbjct: 239 KLKFLVEG--KEGKFLVGRTWTEAPEVDGVVFVRGKGKIGDFLEVVIKEHDEYDXWGSVI 296

Query: 469 V 469
           +
Sbjct: 297 L 297


Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target469 2-methylthioadenine synthetase (miaB-like) protein [Can
2qgq_A304 Protein TM_1862; alpha-beta protein, structural genomic 1e-52
1olt_A 457 Oxygen-independent coproporphyrinogen III oxidase; heme 1e-10
3iix_A348 Biotin synthetase, putative; adoMet radical, SAM radica 3e-10
>2qgq_A Protein TM_1862; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; HET: CXS; 2.00A {Thermotoga maritima MSB8} Length = 304 Back     alignment and structure
 Score =  202 bits (513), Expect = 1e-52
 Identities = 97/296 (32%), Positives = 154/296 (52%), Gaps = 8/296 (2%)

Query: 178 AFLTIQEGCDKFCTFCVVPYTRGIEISRSLSQVVDEARKLIDNGVCEITLLGQNVNAWRG 237
           A++ I +GCD+ CTFC +P  +G   SRS+  +  E   L+  G  EI L+ Q+  ++  
Sbjct: 6   AYVKISDGCDRGCTFCSIPSFKGSLRSRSIEDITREVEDLLKEGKKEIILVAQDTTSYGI 65

Query: 238 KGLDGEKCTFSDLLYSLSEIKGLVRLRYTTSHPRDMSDCLIKAHGDLDVLMPYLHLPVQS 297
                 K    DLL  L+ + G   +R    HP  +++ +I A  +LD ++ Y  +PVQ 
Sbjct: 66  D--LYRKQALPDLLRRLNSLNGEFWIRVMYLHPDHLTEEIISAMLELDKVVKYFDVPVQH 123

Query: 298 GSDRILKSMNRRHTAYEYRQIIDRIRSVRPDIAISSDFIVGFPGETDDDFRATMDLVDKI 357
           GSD+ILK M R  ++ E ++++  IR   PD  + +  IVGFPGET++DF      V++I
Sbjct: 124 GSDKILKLMGRTKSSEELKKMLSSIRERFPDAVLRTSIIVGFPGETEEDFEELKQFVEEI 183

Query: 358 GYAQAFSFKYSPRLGTPGSNMLEQVDENVKAERLLCLQKKLREQQVSFNDACVGQIIEVL 417
            + +  +F YS   GT   N+ E+VD  +   R   L     E   S  D  VG+ ++ L
Sbjct: 184 QFDKLGAFVYSDEEGTVAFNLKEKVDPEMAKRRQEELLLLQAEISNSRLDRFVGKKLKFL 243

Query: 418 IEKHGKEKGKLVGRS----PWLQSVVLNSKNHNIGDIIKVRITDVKISTLYGELVV 469
           +E  GKE   LVGR+    P +  VV       IGD ++V I +     ++G +++
Sbjct: 244 VE--GKEGKFLVGRTWTEAPEVDGVVFVRGKGKIGDFLEVVIKEHDEYDMWGSVIL 297


>1olt_A Oxygen-independent coproporphyrinogen III oxidase; heme biosynthesis, decarboxylase, radical SAM enzyme, 4Fe- 4S cluster; HET: SAM; 2.07A {Escherichia coli} SCOP: c.1.28.2 Length = 457 Back     alignment and structure
>3iix_A Biotin synthetase, putative; adoMet radical, SAM radical, adoMet cleavage, Fe4S4 cluster, HYDE, hydrogenase, maturation, beta barrel; HET: OTY CSO 5AD CPS; 1.25A {Thermotoga maritima} PDB: 3ciw_A* 3iiz_A* 3cix_A* Length = 348 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target469 2-methylthioadenine synthetase (miaB-like) protein [Can
2qgq_A304 Protein TM_1862; alpha-beta protein, structural genomic 100.0
3iix_A348 Biotin synthetase, putative; adoMet radical, SAM radica 99.91
1olt_A 457 Oxygen-independent coproporphyrinogen III oxidase; heme 99.88
1r30_A369 Biotin synthase; SAM radical protein, TIM barrel, FES c 99.57
3c8f_A245 Pyruvate formate-lyase 1-activating enzyme; adoMet radi 98.98
1tv8_A340 MOAA, molybdenum cofactor biosynthesis protein A; TIM b 98.81
2a5h_A416 L-lysine 2,3-aminomutase; radical SAM, four-iron-four-s 98.8
2yx0_A342 Radical SAM enzyme; predicted tRNA modification enzyme, 98.25
2z2u_A311 UPF0026 protein MJ0257; metal binding protein; 2.40A {M 97.8
1req_A727 Methylmalonyl-COA mutase; isomerase, intramolecular tra 94.71
2xij_A 762 Methylmalonyl-COA mutase, mitochondrial; isomerase, org 93.53
3can_A182 Pyruvate-formate lyase-activating enzyme; structural ge 94.28
1yvc_A70 MRR5; structure, autostructure, autoassign, northeast s 93.88
1yez_A68 MM1357; MAR30, structure, autostructure, northeast stru 90.64
2yxb_A161 Coenzyme B12-dependent mutase; alpha/beta, structural g 91.62
>2qgq_A Protein TM_1862; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; HET: CXS; 2.00A {Thermotoga maritima MSB8} Back     alignment and structure
Probab=100.00  E-value=0  Score=540.32  Aligned_cols=291  Identities=33%  Similarity=0.536  Sum_probs=274.0

Q ss_pred             CCEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCEEEECCCCCCCCCCCHHHHHH
Q ss_conf             72578741233244681110012213764100588999887631013310587314541134113444310002167886
Q gi|255764472|r  175 GVTAFLTIQEGCDKFCTFCVVPYTRGIEISRSLSQVVDEARKLIDNGVCEITLLGQNVNAWRGKGLDGEKCTFSDLLYSL  254 (469)
Q Consensus       175 ~~~a~ikI~~GC~~~CsfC~ip~~RG~~rSr~~~~Iv~ei~~l~~~G~kEi~L~g~d~~~Y~g~~~~~~~~~l~~Ll~~l  254 (469)
                      +++|||+||||||++||||++|++||++||||+++|++|++.+++.|++||+|+|+|++.| +.+.. ....+.+|+..+
T Consensus         3 ~~~A~i~isrGC~~~CsFC~ip~~rG~~rsr~~e~Ii~Ei~~l~~~G~kei~l~~~d~~~~-~~~~~-~~~~~~~L~~~~   80 (304)
T 2qgq_A            3 RPYAYVKISDGCDRGCTFCSIPSFKGSLRSRSIEDITREVEDLLKEGKKEIILVAQDTTSY-GIDLY-RKQALPDLLRRL   80 (304)
T ss_dssp             CSEEEEESBCCC-------------CCCCBCCHHHHHHHHHHHHHTTCCEEEEECTTGGGT-THHHH-SSCCHHHHHHHH
T ss_pred             CCEEEEEECCCCCCCCEECEEEEEECCEEEECHHHHHHHHHHHHHCCCEEEEEEEECCCCC-CCCCC-CCHHHHHHHHHH
T ss_conf             8619989776989987755562014983771999999999999986990999985646655-54244-511489999987


Q ss_pred             HCCCCCCCCCCCCCCCCCCCCHHHHHHCCCCCCCCCEEEEEECCCHHHHHHHCCCCCCCHHHHHHHHHHHHCCCCCCCEE
Q ss_conf             20444300135442100010003665202211122013321114578998730333441146789998740134432000
Q gi|255764472|r  255 SEIKGLVRLRYTTSHPRDMSDCLIKAHGDLDVLMPYLHLPVQSGSDRILKSMNRRHTAYEYRQIIDRIRSVRPDIAISSD  334 (469)
Q Consensus       255 ~~i~~~~riR~~s~~P~~~~~~li~~~~~~~~i~~~lhlpiQSgs~~vLk~M~R~~~~e~~~~~i~~~r~~~p~~~i~td  334 (469)
                      .+..+..|+|+++++|..+++++++++++.+++|+|+|+|+||||++||++|||+|+.+++.++++.+|+..|++.++||
T Consensus        81 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~igieSgs~~vLk~m~r~~t~e~~~~~v~~ir~~~p~~~i~t~  160 (304)
T 2qgq_A           81 NSLNGEFWIRVMYLHPDHLTEEIISAMLELDKVVKYFDVPVQHGSDKILKLMGRTKSSEELKKMLSSIRERFPDAVLRTS  160 (304)
T ss_dssp             HTSSSSCEEEECCCCGGGCCHHHHHHHHHCTTBCCEEECCCBCSCHHHHHHTTCCSCHHHHHHHHHHHHHHCTTCEEEEE
T ss_pred             HCCCCCEEEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHCCCCCHHHHHHHHHHHHHHCCCCEEEEE
T ss_conf             23688358994035843677887776764484646774064327879998750476455544588767664899557635


Q ss_pred             EECCCCCCHHHHHHHHHHHHHHHHHHHCCCHHEEECCCHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEE
Q ss_conf             00135220124789886332210111002000011120123214368898999999999999999999999998579789
Q gi|255764472|r  335 FIVGFPGETDDDFRATMDLVDKIGYAQAFSFKYSPRLGTPGSNMLEQVDENVKAERLLCLQKKLREQQVSFNDACVGQII  414 (469)
Q Consensus       335 iIvGfPgETeedf~~Tl~~i~~~~~~~~~vf~yS~r~gT~Aa~m~~qV~~~vk~~R~~~l~~~~~~~~~~~~~~~iG~~~  414 (469)
                      |||||||||+|||++|++|+++++|+++|+|+|||||||||+.|++||++++|++|+++|++++.++..+++++++|+++
T Consensus       161 fIvGfPgET~edf~~T~~fl~~~~~d~~~i~~~sp~pGT~a~~~~~~v~~~~k~~r~~~l~~~~~~~~~~~~~~~~g~~~  240 (304)
T 2qgq_A          161 IIVGFPGETEEDFEELKQFVEEIQFDKLGAFVYSDEEGTVAFNLKEKVDPEMAKRRQEELLLLQAEISNSRLDRFVGKKL  240 (304)
T ss_dssp             EEECCTTCCHHHHHHHHHHHHHHCCSEEEEEECCC-----------CCCHHHHHHHHHHHHHHHHHHHHHHHHTTTTCEE
T ss_pred             EEEECCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEE
T ss_conf             75678987689999999999856978330024256699766663678997999999999999987654577898569299


Q ss_pred             EEEEECCCCCCCEEEEECCCCCE----EEECCCCCCCCCEEEEEEEEEECCEEEEEEEC
Q ss_conf             99984256808689999878628----89738876768889999998308738999949
Q gi|255764472|r  415 EVLIEKHGKEKGKLVGRSPWLQS----VVLNSKNHNIGDIIKVRITDVKISTLYGELVV  469 (469)
Q Consensus       415 ~Vlve~~~~~~~~~~G~t~~~~~----V~~~~~~~~~G~~v~V~I~~~~~~~L~G~vi~  469 (469)
                      +||+|+.  +++.+.||+.+|.+    |++.++...+|++++|+|+++..++|+|++|.
T Consensus       241 ~vlve~~--~~~~~~Gr~~~~~p~~~~vv~~~~~~~~G~~v~v~I~~~~~~~L~G~~i~  297 (304)
T 2qgq_A          241 KFLVEGK--EGKFLVGRTWTEAPEVDGVVFVRGKGKIGDFLEVVIKEHDEYDMWGSVIL  297 (304)
T ss_dssp             EEEEEEE--ETTEEEEEETTCCTTTSCCEEEESCCCTTCEEEEEEEEEETTEEEEEEC-
T ss_pred             EEEEEEC--CCCEEEEECCCCCCCCCEEEEECCCCCCCCEEEEEEEECCCCCEEEEEEE
T ss_conf             9999935--18999988888785563479608987899989999997625508999999



>3iix_A Biotin synthetase, putative; adoMet radical, SAM radical, adoMet cleavage, Fe4S4 cluster, HYDE, hydrogenase, maturation, beta barrel; HET: OTY CSO 5AD CPS; 1.25A {Thermotoga maritima} PDB: 3ciw_A* 3iiz_A* 3cix_A* Back     alignment and structure
>1olt_A Oxygen-independent coproporphyrinogen III oxidase; heme biosynthesis, decarboxylase, radical SAM enzyme, 4Fe- 4S cluster; HET: SAM; 2.07A {Escherichia coli} SCOP: c.1.28.2 Back     alignment and structure
>1r30_A Biotin synthase; SAM radical protein, TIM barrel, FES cluster, transferase; HET: SAM DTB; 3.40A {Escherichia coli} SCOP: c.1.28.1 Back     alignment and structure
>3c8f_A Pyruvate formate-lyase 1-activating enzyme; adoMet radical, SAM radical, activase, glycyl radical, 4Fe- 4S, carbohydrate metabolism, cytoplasm; HET: MT2 PGE; 2.25A {Escherichia coli} PDB: 3cb8_A* Back     alignment and structure
>1tv8_A MOAA, molybdenum cofactor biosynthesis protein A; TIM barrel, ligand binding protein; HET: SAM; 2.20A {Staphylococcus aureus} SCOP: c.1.28.3 PDB: 1tv7_A* 2fb3_A* 2fb2_A* Back     alignment and structure
>2a5h_A L-lysine 2,3-aminomutase; radical SAM, four-iron-four-sulfur cluster, 4Fe4S, FS4, SAM, S-adenosylmethionine, alpha-beta channel; HET: SAM LYS PLP; 2.10A {Clostridium subterminale} Back     alignment and structure
>2yx0_A Radical SAM enzyme; predicted tRNA modification enzyme, metal binding protein, structural genomics, NPPSFA; 2.21A {Pyrococcus horikoshii} Back     alignment and structure
>2z2u_A UPF0026 protein MJ0257; metal binding protein; 2.40A {Methanocaldococcus jannaschii} Back     alignment and structure
>1req_A Methylmalonyl-COA mutase; isomerase, intramolecular transferase; HET: B12 DCA; 2.00A {Propionibacterium freudenreichiisubsp} SCOP: c.1.19.1 c.23.6.1 PDB: 2req_A* 3req_A* 4req_A* 6req_A* 7req_A* 5req_A* 1e1c_A* Back     alignment and structure
>2xij_A Methylmalonyl-COA mutase, mitochondrial; isomerase, organic aciduria, vitamin B12; HET: B12 5AD BTB; 1.95A {Homo sapiens} PDB: 2xiq_A* 3bic_A Back     alignment and structure
>3can_A Pyruvate-formate lyase-activating enzyme; structural genomics, PSI, MCSG, APC20359.1; 1.80A {Bacteroides vulgatus atcc 8482} Back     alignment and structure
>1yvc_A MRR5; structure, autostructure, autoassign, northeast structural genomics, autoqf, PSI, protein structure initiative; NMR {Methanococcus maripaludis} SCOP: b.40.4.12 Back     alignment and structure
>1yez_A MM1357; MAR30, structure, autostructure, northeast structural genomics, PSI, protein structure initiative; NMR {Methanosarcina mazei GO1} SCOP: b.40.4.12 Back     alignment and structure
>2yxb_A Coenzyme B12-dependent mutase; alpha/beta, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.80A {Aeropyrum pernix K1} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target469 2-methylthioadenine synthetase (miaB-like) protein [Can
d1olta_441 Oxygen-independent coproporphyrinogen III oxidase HemN 99.88
d1r30a_312 Biotin synthase {Escherichia coli [TaxId: 562]} 99.67
d1tv8a_327 Molybdenum cofactor biosynthesis protein A MoaA {Staphy 98.31
d7reqa2168 Methylmalonyl-CoA mutase alpha subunit, C-terminal doma 95.6
d7reqb2163 Methylmalonyl-CoA mutase beta subunit, C-terminal domai 94.17
d1yvca169 Hypothetical protein MMP0076 {Methanococcus maripaludis 92.79
d1yeza168 Hypothetical protein MM1357 {Methanosarcina mazei [TaxI 91.63
>d1olta_ c.1.28.2 (A:) Oxygen-independent coproporphyrinogen III oxidase HemN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Radical SAM enzymes
family: Oxygen-independent coproporphyrinogen III oxidase HemN
domain: Oxygen-independent coproporphyrinogen III oxidase HemN
species: Escherichia coli [TaxId: 562]
Probab=99.88  E-value=9e-23  Score=186.30  Aligned_cols=191  Identities=18%  Similarity=0.265  Sum_probs=141.7

Q ss_pred             CCEEEEEECCCCCCCCCCCCHHH--HHH-HHHHHHHHHHHHHHHHHHHC-CCCEEEEECCCCCEEEECCCCC--CCCCCC
Q ss_conf             72578741233244681110012--213-76410058899988763101-3310587314541134113444--310002
Q gi|255764472|r  175 GVTAFLTIQEGCDKFCTFCVVPY--TRG-IEISRSLSQVVDEARKLIDN-GVCEITLLGQNVNAWRGKGLDG--EKCTFS  248 (469)
Q Consensus       175 ~~~a~ikI~~GC~~~CsfC~ip~--~RG-~~rSr~~~~Iv~ei~~l~~~-G~kEi~L~g~d~~~Y~g~~~~~--~~~~l~  248 (469)
                      +..-||-|== |++.|+||.-+.  .+. ....+-++.+++|++...+. +-+.|.      ..|.|.+.++  ....+.
T Consensus        49 plsLYiHiPF-C~~~C~yC~~~~~~~~~~~~~~~Y~~~L~~Ei~~~~~~~~~~~v~------~i~~GGGTPt~L~~~~l~  121 (441)
T d1olta_          49 PLSLYVHIPF-CHKLCYFCGCNKIVTRQQHKADQYLDALEQEIVHRAPLFAGRHVS------QLHWGGGTPTYLNKAQIS  121 (441)
T ss_dssp             CEEEEEEECE-ESSCCTTCCSSCEECSCTHHHHHHHHHHHHHHHHHGGGGTTCCEE------EEEEEESCGGGSCHHHHH
T ss_pred             CEEEEEEECC-CCCCCCCCCCEEECCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCC------EEEECCCCCCCCCHHHHH
T ss_conf             6289997289-788899895836548885509999999999999966761798503------038618884778999999


Q ss_pred             HHHHHHHCCCCCC---CCCCCCCCCCCCCCHHHHHHCCCCCCCCCEEEEEECCCHHHHHHHCCCCCCCHHHHHHHHHHHH
Q ss_conf             1678862044430---0135442100010003665202211122013321114578998730333441146789998740
Q gi|255764472|r  249 DLLYSLSEIKGLV---RLRYTTSHPRDMSDCLIKAHGDLDVLMPYLHLPVQSGSDRILKSMNRRHTAYEYRQIIDRIRSV  325 (469)
Q Consensus       249 ~Ll~~l~~i~~~~---riR~~s~~P~~~~~~li~~~~~~~~i~~~lhlpiQSgs~~vLk~M~R~~~~e~~~~~i~~~r~~  325 (469)
                      .|+..+.+.....   .+.+ -++|..++++.+..+++.+  +..+++++||+|++||+.|||.++.+++.++++.+|+.
T Consensus       122 ~ll~~l~~~~~~~~~~e~t~-E~~P~~~~~~~l~~l~~~G--~nRiSlGvQs~~~~vl~~i~R~~~~~~~~~~~~~~r~~  198 (441)
T d1olta_         122 RLMKLLRENFQFNADAEISI-EVDPREIELDVLDHLRAEG--FNRLSMGVQDFNKEVQRLVNREQDEEFIFALLNHAREI  198 (441)
T ss_dssp             HHHHHHHHHSCEEEEEEEEE-EECSSSCCTHHHHHHHHTT--CCEEEEEEECCCHHHHHHHTCCCCHHHHHHHHHHHHHT
T ss_pred             HHHHHHHHHCCCCCHHCCCC-CCCCCCCCHHHHHHHHHHC--CCEEEECCHHCCHHHHHHHHCCCCHHHHHHHHHHHHHC
T ss_conf             99998765223450000221-0234542057899999719--85599512001304554430578789999999987741


Q ss_pred             CCCC-CCCEEEECCCCCCHHHHHHHHHHHHHHHHHHHCCCHHEEECCCHHHHH
Q ss_conf             1344-320000013522012478988633221011100200001112012321
Q gi|255764472|r  326 RPDI-AISSDFIVGFPGETDDDFRATMDLVDKIGYAQAFSFKYSPRLGTPGSN  377 (469)
Q Consensus       326 ~p~~-~i~tdiIvGfPgETeedf~~Tl~~i~~~~~~~~~vf~yS~r~gT~Aa~  377 (469)
                        ++ .+++|+|+|+||||.++|++|++.+.+++++++.+|+|+.+|+|.++.
T Consensus       199 --g~~~vn~DLI~GlPgqT~~~~~~tl~~~~~l~pd~is~y~~~~~p~~~~~q  249 (441)
T d1olta_         199 --GFTSTNIDLIYGLPKQTPESFAFTLKRVAELNPDRLSVFNYAHLPTIFAAQ  249 (441)
T ss_dssp             --TCCSCEEEEEESCTTCCHHHHHHHHHHHHHHCCSEEEEEECCCCTTTSGGG
T ss_pred             --CCCEEECCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCEECCCHHHHH
T ss_conf             --442362354432377603778899989985088742232211246126766



>d1r30a_ c.1.28.1 (A:) Biotin synthase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tv8a_ c.1.28.3 (A:) Molybdenum cofactor biosynthesis protein A MoaA {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure