254780429

254780429

hypothetical protein CLIBASIA_01570

GeneID in NCBI database:8209415Locus tag:CLIBASIA_01570
Protein GI in NCBI database:254780429Protein Accession:YP_003064842.1
Gene range:-(336568, 337188)Protein Length:206aa
Gene description:hypothetical protein
COG prediction:[O] Inactive homolog of metal-dependent proteases, putative molecular chaperone
KEGG prediction:hypothetical protein
SEED prediction:Inactive homolog of metal-dependent proteases, putative molecular chaperone
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Bacterial RNA-metabolizing Zn-dependent hydrolases;
Conserved gene cluster associated with Met-tRNA formyltransferase;
Ribosome biogenesis bacterial;
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200------
MIVLALDTTGADCSVAIYDSHAGRILGSYFKNLGRGHAEHLMPAIDYALKDSRLEVSQVDRVVTALGPGSFTGVRVSIAVARGISLVLKQPALGVGNLEVLARAHLDSHVGRPIMVLVSLFHQKVCCQKFSLDGVSCSDPVLLNYEQTRSEVDNFEGEIVGSGLSAIRGIENDIDHLPMDVLSRLGITKSSPFPSPIYLRSPCFLV
ccEEEEEcccHHHEEEEEEccccEEEEEEEEEccHHHHHHHHHHHHHHHHHccccHHHccEEEEEcccccHHHHHHHHHHHHHHHHHHcccEEEEcHHHHHHHHHHcccccccEEEEEEcccccEEEEEEEEccccccccccccHHHHHHHHcccccEEEcccHHHccccccccccccHHHHHHHccccccccccccccccccccc
cEEEEEEccccccEEEEEcccccEEEEEEEccccHHHHHHHHHHHHHHHHHccccHHHHHHEEEcccccccHHHHHHHHHHHHHHHHcccccEcccHHHHHHHHHHHHcccccEEEEEEcccccEEEEEEcccccEccccccccHHHHHHHHHcccccEEEcccHHHccHcccccccHHHHHHHHcccccccccccEEEccccEcc
MIVLAldttgadcsvaiydshagriLGSYFKnlgrghaehLMPAIDYALkdsrlevsQVDRVvtalgpgsftGVRVSIAVARGISLVlkqpalgvgnLEVLARAHLDSHVGRPIMVLVSLFHQKvccqkfsldgvscsdpvllnyeqtrsevdnfegeivGSGLSAIRGiendidhlpmdvlsrlgitksspfpspiylrspcflv
mivlaldttgadcsvaiyDSHAGRILGSYFKNLGRGHAEHLMPAIDYALKDSRLEVSQVDRVVtalgpgsftgVRVSIAVARGISLVLKQPALGVGNLEVLARAHLDSHVGRPIMVLVSLFHQKVCCQKFSLDGVSCSDPVLLNYEQTRSEVDNFEGEIVGSGLSAIRGIENDIDHLPMDVLSRLGitksspfpspiylrspcflv
MIVLALDTTGADCSVAIYDSHAGRILGSYFKNLGRGHAEHLMPAIDYALKDSRLEVSQVDRVVTALGPGSFTGVRVSIAVARGISLVLKQPALGVGNLEVLARAHLDSHVGRPIMVLVSLFHQKVCCQKFSLDGVSCSDPVLLNYEQTRSEVDNFEGEIVGSGLSAIRGIENDIDHLPMDVLSRLGITKSSPFPSPIYLRSPCFLV
MIVLALDTTGADCSVAIYDSHAGRILGSYFKNLGRGHAEHLMPAIDYALKDSRLEVSQVDRVVTALGPGSFTGVRVSIAVARGISLVLKQPALGVGNLEVLARAHLDSHVGRPIMVLVSLFHQKVCCQKFSLDGVSCSDPVLLNYEQTRSEVDNFEGEIVGSGLSAIRGIENDIDHLPMDVLSRLGITKSSPFPSPIYLRSPCFL*
MIVLALDTTGADCSVAIYDSHAGRILGSYFKNLGRGHAEHLMPAIDYALKDSRLEVSQVDRVVTALGPGSFTGVRVSIAVARGISLVLKQPALGVGNLEVLARAHLDSHVGRPIMVLVSLFHQKVCCQKFSLDGVSCSDPVLLNYEQTRSEVDNFEGEIVGSGLSAIRGIENDIDHLPMDVLSRLGITKSSPFPSPIYLRSPCFLV
MIVLALDTTGADCSVAIYDSHAGRILGSYFKNLGRGHAEHLMPAIDYALKDSRLEVSQVDRVVTALGPGSFTGVRVSIAVARGISLVLKQPALGVGNLEVLARAHLDSHVGRPIMVLVSLFHQKVCCQKFSLDGVSCSDPVLLNYEQTRSEVDNFEGEIVGSGLSAIRGIENDIDHLPMDVLSRLGITKSSPFPSPIYLRSPCFLV
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIVLALDTTGADCSVAIYDSHAGRILGSYFKNLGRGHAEHLMPAIDYALKDSRLEVSQVDRVVTALGPGSFTGVRVSIAVARGISLVLKQPALGVGNLEVLARAHLDSHVGRPIMVLVSLFHQKVCCQKFSLDGVSCSDPVLLNYEQTRSEVDNFEGEIVGSGLSAIRGIENDIDHLPMDVLSRLGITKSSPFPSPIYLRSPCFLV
MIVLALDTTGADCSVAIYDSHAGRILGSYFKNLGRGHAEHLMPAIDYALKDSRLEVSQVDRVVTALGPGSFTGVRVSIAVARGISLVLKQPALGVGNLEVLARAHLDSHVGRPIMVLVSLFHQKVCCQKFSLDGVSCSDPVLLNYEQTRSEVDNFEGEIVGSGLSAIRGIENDIDHLPMDVLSRLGITKSSPFPSPIYLRSPCFLV
MIVLALDTTGADCSVAIYDSHAGRILGSYFKNLGRGHAEHLMPAIDYALKDSRLEVSQVDRVVTALGPGSFTGVRVSIAVARGISLVLKQPALGVGNLEVLARAHLDSHVGRPIMVLVSLFHQKVCCQKFSLDGVSCSDPVLLNYEQTRSEVDNFEGEIVGSGLSAIRGIENDIDHLPMDVLSRLGITKSSPFPSPIYLRSPCFLV

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target206 hypothetical protein CLIBASIA_01570 [Candidatus Liberib
254781038 363 putative DNA-binding/iron metalloprotein/AP endonu 2e-04
>gi|254781038|ref|YP_003065451.1| putative DNA-binding/iron metalloprotein/AP endonuclease [Candidatus Liberibacter asiaticus str. psy62] Length = 363 Back     alignment
 Score = 37.7 bits (86), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 41/86 (47%), Gaps = 1/86 (1%)

Query: 34  GRGHAEHLMPAIDYALKDSRLEVSQVDRVVTALGPGSFTGVRVSIAVARGISLVLKQPAL 93
            R H + L   I   L  + +++S +D +    GPG   G+ V +  A+ IS V  +P  
Sbjct: 56  ARAHVDVLDILIKQTLLRANMQISDMDSIAVTAGPGLMGGLIVGLMTAKAISYVSHKPFY 115

Query: 94  GVGNLE-VLARAHLDSHVGRPIMVLV 118
            + +LE  +  A L   +  P +VL+
Sbjct: 116 AINHLEGHILTARLTDDIAFPYLVLL 141

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target206 hypothetical protein CLIBASIA_01570 [Candidatus Liberib
315122123205 hypothetical protein CKC_01865 [Candidatus Liberibacter 1 2e-87
15887703222 hypothetical protein Atu0352 [Agrobacterium tumefaciens 1 3e-38
218658419220 putative endopeptidase [Rhizobium etli IE4771] Length = 1 4e-36
227820625220 putative peptidase M22, glycoprotease [Sinorhizobium fr 1 6e-36
116250168220 endopeptidase [Rhizobium leguminosarum bv. viciae 3841] 1 3e-35
325291786222 peptidase M22 glycoprotease [Agrobacterium sp. H13-3] L 1 4e-35
190890050220 O-sialoglycoprotein endopeptidase [Rhizobium etli CIAT 1 2e-34
209547635220 peptidase M22 glycoprotease [Rhizobium leguminosarum bv 1 4e-34
327188588253 putative O-sialoglycoprotein endopeptidase protein [Rhi 1 1e-33
241202789220 peptidase M22 glycoprotease [Rhizobium leguminosarum bv 1 8e-33
>gi|315122123|ref|YP_004062612.1| hypothetical protein CKC_01865 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 205 Back     alignment and organism information
 Score =  325 bits (833), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 157/205 (76%), Positives = 181/205 (88%)

Query: 1   MIVLALDTTGADCSVAIYDSHAGRILGSYFKNLGRGHAEHLMPAIDYALKDSRLEVSQVD 60
           MIVLALDTTG DCSV +YDS+A  ILGSYFKNLGRGHAE+L+PAID AL+DS+L++SQ+D
Sbjct: 1   MIVLALDTTGVDCSVIVYDSNAHYILGSYFKNLGRGHAEYLIPAIDCALRDSQLDISQID 60

Query: 61  RVVTALGPGSFTGVRVSIAVARGISLVLKQPALGVGNLEVLARAHLDSHVGRPIMVLVSL 120
           R+VTALGPGSFTGVRVSIAVARGISLVL + A GVGNLEVLAR+HLD+H GRP+MVLVSL
Sbjct: 61  RIVTALGPGSFTGVRVSIAVARGISLVLGKSAFGVGNLEVLARSHLDTHAGRPVMVLVSL 120

Query: 121 FHQKVCCQKFSLDGVSCSDPVLLNYEQTRSEVDNFEGEIVGSGLSAIRGIENDIDHLPMD 180
            H+K+C Q FS+DG+  S+PVLLNYEQTR EVDNFEGEI+GSG S I+GIE + DHLPMD
Sbjct: 121 LHKKICRQTFSVDGIPLSEPVLLNYEQTRFEVDNFEGEIIGSGFSVIKGIEGENDHLPMD 180

Query: 181 VLSRLGITKSSPFPSPIYLRSPCFL 205
           VL+RLGI K+   PSPIYLRSPC L
Sbjct: 181 VLARLGILKTGIAPSPIYLRSPCTL 205


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|15887703|ref|NP_353384.1| hypothetical protein Atu0352 [Agrobacterium tumefaciens str. C58] Length = 222 Back     alignment and organism information
>gi|218658419|ref|ZP_03514349.1| putative endopeptidase [Rhizobium etli IE4771] Length = 220 Back     alignment and organism information
>gi|227820625|ref|YP_002824595.1| putative peptidase M22, glycoprotease [Sinorhizobium fredii NGR234] Length = 220 Back     alignment and organism information
>gi|116250168|ref|YP_766006.1| endopeptidase [Rhizobium leguminosarum bv. viciae 3841] Length = 220 Back     alignment and organism information
>gi|325291786|ref|YP_004277650.1| peptidase M22 glycoprotease [Agrobacterium sp. H13-3] Length = 222 Back     alignment and organism information
>gi|190890050|ref|YP_001976592.1| O-sialoglycoprotein endopeptidase [Rhizobium etli CIAT 652] Length = 220 Back     alignment and organism information
>gi|209547635|ref|YP_002279552.1| peptidase M22 glycoprotease [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 220 Back     alignment and organism information
>gi|327188588|gb|EGE55798.1| putative O-sialoglycoprotein endopeptidase protein [Rhizobium etli CNPAF512] Length = 253 Back     alignment and organism information
>gi|241202789|ref|YP_002973885.1| peptidase M22 glycoprotease [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 220 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target206 hypothetical protein CLIBASIA_01570 [Candidatus Liberib
TIGR03725202 TIGR03725, bact_YeaZ, universal bacterial protein YeaZ 5e-35
COG1214220 COG1214, COG1214, Inactive homolog of metal-dependent p 6e-30
pfam00814225 pfam00814, Peptidase_M22, Glycoprotease family 4e-17
PRK14878 323 PRK14878, PRK14878, UGMP family protein; Provisional 1e-04
KOG2708 336 KOG2708, KOG2708, KOG2708, Predicted metalloprotease wi 0.001
PTZ00340 345 PTZ00340, PTZ00340, O-sialoglycoprotein endopeptidase-l 0.004
COG0533 342 COG0533, QRI7, Metal-dependent proteases with possible 4e-10
TIGR00329305 TIGR00329, gcp_kae1, metallohydrolase, glycoprotease/Ka 5e-09
PRK09604 332 PRK09604, PRK09604, UGMP family protein; Validated 3e-08
TIGR03723314 TIGR03723, bact_gcp, putative glycoprotease GCP 1e-07
PRK09605 535 PRK09605, PRK09605, bifunctional UGMP family protein/se 2e-05
TIGR03722 322 TIGR03722, arch_KAE1, universal archaeal protein Kae1 3e-05
KOG2707 405 KOG2707, KOG2707, KOG2707, Predicted metalloprotease wi 1e-04
>gnl|CDD|163437 TIGR03725, bact_YeaZ, universal bacterial protein YeaZ Back     alignment and domain information
>gnl|CDD|31407 COG1214, COG1214, Inactive homolog of metal-dependent proteases, putative molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|144420 pfam00814, Peptidase_M22, Glycoprotease family Back     alignment and domain information
>gnl|CDD|184878 PRK14878, PRK14878, UGMP family protein; Provisional Back     alignment and domain information
>gnl|CDD|37919 KOG2708, KOG2708, KOG2708, Predicted metalloprotease with chaperone activity (RNAse H/HSP70 fold) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|185566 PTZ00340, PTZ00340, O-sialoglycoprotein endopeptidase-like protein; Provisional Back     alignment and domain information
>gnl|CDD|30879 COG0533, QRI7, Metal-dependent proteases with possible chaperone activity [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|129429 TIGR00329, gcp_kae1, metallohydrolase, glycoprotease/Kae1 family Back     alignment and domain information
>gnl|CDD|181984 PRK09604, PRK09604, UGMP family protein; Validated Back     alignment and domain information
>gnl|CDD|163435 TIGR03723, bact_gcp, putative glycoprotease GCP Back     alignment and domain information
>gnl|CDD|181985 PRK09605, PRK09605, bifunctional UGMP family protein/serine/threonine protein kinase; Validated Back     alignment and domain information
>gnl|CDD|163434 TIGR03722, arch_KAE1, universal archaeal protein Kae1 Back     alignment and domain information
>gnl|CDD|37918 KOG2707, KOG2707, KOG2707, Predicted metalloprotease with chaperone activity (RNAse H/HSP70 fold) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 206 hypothetical protein CLIBASIA_01570 [Candidatus Liberib
COG1214220 Inactive homolog of metal-dependent proteases, putative 100.0
TIGR00329 337 gcp metalloendopeptidase, putative, glycoprotease famil 99.82
PRK09604 335 putative DNA-binding/iron metalloprotein/AP endonucleas 99.9
PTZ00340 348 O-sialoglycoprotein endopeptidase; Provisional 99.89
COG0533 342 QRI7 Metal-dependent proteases with possible chaperone 99.87
PRK09605 536 O-sialoglycoprotein endopeptidase/protein kinase; Revie 99.84
KOG2707 405 consensus 99.72
COG2192 555 Predicted carbamoyl transferase, NodU family [Posttrans 96.93
pfam00814225 Peptidase_M22 Glycoprotease family. The Peptidase M22 p 99.88
TIGR01368383 CPSaseIIsmall carbamoyl-phosphate synthase, small subun 90.64
KOG2708 336 consensus 98.85
PRK00039169 ruvC Holliday junction resolvase; Reviewed 94.64
TIGR03192293 benz_CoA_bzdQ benzoyl-CoA reductase, bzd-type, Q subuni 94.4
cd00529154 RuvC_resolvase Holliday junction resolvases (HJRs) are 93.86
PRK13310302 N-acetyl-D-glucosamine kinase; Provisional 92.03
PRK09557301 fructokinase; Reviewed 91.32
pfam03652134 UPF0081 Uncharacterized protein family (UPF0081). 91.11
PRK05082291 N-acetylmannosamine kinase; Provisional 90.62
PRK04123 542 ribulokinase; Provisional 95.26
PRK00047 498 glpK glycerol kinase; Provisional 92.56
pfam00370245 FGGY_N FGGY family of carbohydrate kinases, N-terminal 92.33
TIGR01312 494 XylB xylulokinase; InterPro: IPR006000 The ability to m 91.58
PRK10939 521 autoinducer-2 (AI-2) kinase; Provisional 91.1
PRK13324258 pantothenate kinase; Reviewed 90.93
PRK13319258 consensus 90.76
COG1070 502 XylB Sugar (pentulose and hexulose) kinases [Carbohydra 90.61
PRK13321256 pantothenate kinase; Reviewed 90.41
PRK08313 391 acetyl-CoA acetyltransferase; Provisional 94.12
PRK06065 393 acetyl-CoA acetyltransferase; Provisional 92.93
>COG1214 Inactive homolog of metal-dependent proteases, putative molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00329 gcp metalloendopeptidase, putative, glycoprotease family; InterPro: IPR000905 Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date Back     alignment and domain information
>PRK09604 putative DNA-binding/iron metalloprotein/AP endonuclease; Reviewed Back     alignment and domain information
>PTZ00340 O-sialoglycoprotein endopeptidase; Provisional Back     alignment and domain information
>COG0533 QRI7 Metal-dependent proteases with possible chaperone activity [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09605 O-sialoglycoprotein endopeptidase/protein kinase; Reviewed Back     alignment and domain information
>KOG2707 consensus Back     alignment and domain information
>COG2192 Predicted carbamoyl transferase, NodU family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>pfam00814 Peptidase_M22 Glycoprotease family Back     alignment and domain information
>TIGR01368 CPSaseIIsmall carbamoyl-phosphate synthase, small subunit; InterPro: IPR006274 Carbamoyl phosphate synthase (CPSase) is a heterodimeric enzyme composed of a small and a large subunit (with the exception of CPSase III, see below) Back     alignment and domain information
>KOG2708 consensus Back     alignment and domain information
>PRK00039 ruvC Holliday junction resolvase; Reviewed Back     alignment and domain information
>TIGR03192 benz_CoA_bzdQ benzoyl-CoA reductase, bzd-type, Q subunit Back     alignment and domain information
>cd00529 RuvC_resolvase Holliday junction resolvases (HJRs) are endonucleases that specifically resolve Holliday junction DNA intermediates during homologous recombination Back     alignment and domain information
>PRK13310 N-acetyl-D-glucosamine kinase; Provisional Back     alignment and domain information
>PRK09557 fructokinase; Reviewed Back     alignment and domain information
>pfam03652 UPF0081 Uncharacterized protein family (UPF0081) Back     alignment and domain information
>PRK05082 N-acetylmannosamine kinase; Provisional Back     alignment and domain information
>PRK04123 ribulokinase; Provisional Back     alignment and domain information
>PRK00047 glpK glycerol kinase; Provisional Back     alignment and domain information
>pfam00370 FGGY_N FGGY family of carbohydrate kinases, N-terminal domain Back     alignment and domain information
>TIGR01312 XylB xylulokinase; InterPro: IPR006000 The ability to metabolise xylose, one of the most abundant sugars in nature, is dependent on its conversion to xylulose-5-phosphate, which then enters the non-oxidative pentose phosphate pathway Back     alignment and domain information
>PRK10939 autoinducer-2 (AI-2) kinase; Provisional Back     alignment and domain information
>PRK13324 pantothenate kinase; Reviewed Back     alignment and domain information
>PRK13319 consensus Back     alignment and domain information
>COG1070 XylB Sugar (pentulose and hexulose) kinases [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK13321 pantothenate kinase; Reviewed Back     alignment and domain information
>PRK08313 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06065 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target206 hypothetical protein CLIBASIA_01570 [Candidatus Liberib
2gel_A231 2.05a Crystal Structure Of Salmonella Typhimurium Y 2e-35
1okj_A251 Crystal Structure Of The Essential E. Coli Yeaz Pro 2e-33
2ivn_A 330 Structure Of Up1 Protein Length = 330 7e-13
2vwb_A 535 Structure Of The Archaeal Kae1-Bud32 Fusion Protein 2e-12
3enh_A 540 Crystal Structure Of Cgi121BUD32KAE1 COMPLEX Length 2e-12
2a6a_A218 Crystal Structure Of Glycoprotein Endopeptidase (Tm 6e-11
3eno_A 334 Crystal Structure Of Pyrococcus Furiosus Pcc1 In Co 2e-10
gi|112490743|pdb|2GEL|A Chain A, 2.05a Crystal Structure Of Salmonella Typhimurium Yeaz, Form B Length = 231 Back     alignment and structure
 Score =  153 bits (386), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 55/224 (24%), Positives = 99/224 (44%), Gaps = 27/224 (12%)

Query: 1   MIVLALDTTGADCSVAIYDSHAGRILGSYFKNLGRGHAEHLMPAIDYALKDSRLEVSQVD 60
           M +LA+DT    CSVA++++     + ++F+   R H + ++P +   L  S   ++++D
Sbjct: 1   MRILAIDTATEACSVALWNNGT---INAHFELCPREHTQRILPMVQEILAASGASLNEID 57

Query: 61  RVVTALGPGSFTGVRVSIAVARGISLVLKQPALGVGNLEVLARAHLDSHVGRPIMVLVSL 120
            +    GPGSFTGVR+ I +A+G++L    P +GV  L  +A+          ++  +  
Sbjct: 58  ALAFGRGPGSFTGVRIGIGIAQGLALGANLPMIGVSTLATMAQGAWRKTGATRVLAAIDA 117

Query: 121 FHQKVCCQKFSLDGVSC----SDPVLLNYEQTRSEVDNFEGEI--VGSGLSAIRGIENDI 174
              +V   ++  D            +L  E+    +    GE   VG+G SA   +  + 
Sbjct: 118 RMGEVYWAEYQRDAQGVWQGEETEAVLKPERVGERLKQLSGEWATVGTGWSAWPDLAKEC 177

Query: 175 ---------------DHLPMD--VLSRLGITKSSPFPSPIYLRS 201
                          D LP+    L+  G T +     P+YLR+
Sbjct: 178 GLTLHDGEVSLPAAEDMLPIASQKLAA-GETVAVEHAEPVYLRN 220


>gi|55669531|pdb|1OKJ|A Chain A, Crystal Structure Of The Essential E. Coli Yeaz Protein By Mad Method Using The Gadolinium Complex "dotma" Length = 251 Back     alignment and structure
>gi|157835220|pdb|2IVN|A Chain A, Structure Of Up1 Protein Length = 330 Back     alignment and structure
gi|197107196|pdb|2VWB|A Chain A, Structure Of The Archaeal Kae1-Bud32 Fusion Protein Mj1130: A Model For The Eukaryotic Ekc-Keops Subcomplex Involved In Transcription And Telomere Homeostasis. Length = 535 Back     alignment and structure
>gi|210061039|pdb|3ENH|A Chain A, Crystal Structure Of Cgi121BUD32KAE1 COMPLEX Length = 540 Back     alignment and structure
>gi|73536145|pdb|2A6A|A Chain A, Crystal Structure Of Glycoprotein Endopeptidase (Tm0874) From Thermotoga Maritima At 2.50 A Resolution Length = 218 Back     alignment and structure
>gi|210061045|pdb|3ENO|A Chain A, Crystal Structure Of Pyrococcus Furiosus Pcc1 In Complex With Thermoplasma Acidophilum Kae1 Length = 334 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target206 hypothetical protein CLIBASIA_01570 [Candidatus Liberib
2gel_A231 Putative GRAM negative resuscitation promoting factor; 6e-22
2a6a_A218 Hypothetical protein TM0874; glycoprotein endopeptidase 2e-20
2ivn_A 330 O-sialoglycoprotein endopeptidase; UP1 keops complex, F 4e-13
3en9_A 540 Glycoprotease, O-sialoglycoprotein endopeptidase/protei 4e-12
3eno_A 334 Putative O-sialoglycoprotein endopeptidase; hydrolase, 2e-10
2pff_A 1688 Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carr 0.001
>2gel_A Putative GRAM negative resuscitation promoting factor; YEAZ, RPF, actin-like-fold, glycoprotease, chaperone; 2.05A {Salmonella typhimurium LT2} PDB: 2gem_A 1okj_A Length = 231 Back     alignment and structure
 Score = 99.2 bits (246), Expect = 6e-22
 Identities = 54/224 (24%), Positives = 97/224 (43%), Gaps = 25/224 (11%)

Query: 1   MIVLALDTTGADCSVAIYDSHAGRILGSYFKNLGRGHAEHLMPAIDYALKDSRLEVSQVD 60
           M +LA+DT    CSVA++++  G I  ++F+   R H + ++P +   L  S   ++++D
Sbjct: 1   MRILAIDTATEACSVALWNN--GTIN-AHFELCPREHTQRILPMVQEILAASGASLNEID 57

Query: 61  RVVTALGPGSFTGVRVSIAVARGISLVLKQPALGVGNLEVLARAHLDSHVGRPIMVLVSL 120
            +    GPGSFTGVR+ I +A+G++L    P +GV  L  +A+          ++  +  
Sbjct: 58  ALAFGRGPGSFTGVRIGIGIAQGLALGANLPMIGVSTLATMAQGAWRKTGATRVLAAIDA 117

Query: 121 FHQKVCCQKFSLDGVSC----SDPVLLNYEQTRSEVDNFEGE--IVGSGLSAIRGIENDI 174
              +V   ++  D            +L  E+    +    GE   VG+G SA   +  + 
Sbjct: 118 RMGEVYWAEYQRDAQGVWQGEETEAVLKPERVGERLKQLSGEWATVGTGWSAWPDLAKEC 177

Query: 175 D--------HLP----MDVLSRLGITKSSPFP----SPIYLRSP 202
                     LP    M  ++   +            P+YLR+ 
Sbjct: 178 GLTLHDGEVSLPAAEDMLPIASQKLAAGETVAVEHAEPVYLRNE 221


>2a6a_A Hypothetical protein TM0874; glycoprotein endopeptidase, structural genomics, joint center for structural genomics, JCSG; 2.50A {Thermotoga maritima MSB8} SCOP: c.55.1.9 c.55.1.9 Length = 218 Back     alignment and structure
>2ivn_A O-sialoglycoprotein endopeptidase; UP1 keops complex, Fe/Zn dependent nucleotide phosphatase, metalloprotease, hypothetical protein, zinc; HET: ANP; 1.65A {Pyrococcus abyssi} PDB: 2ivo_A 2ivp_A* Length = 330 Back     alignment and structure
>3en9_A Glycoprotease, O-sialoglycoprotein endopeptidase/protein kinase; endopeptidase activity, protein kinase activity; HET: TBR; 2.67A {Methanocaldococcus jannaschii} PDB: 3enh_A* 2vwb_A* Length = 540 Back     alignment and structure
>3eno_A Putative O-sialoglycoprotein endopeptidase; hydrolase, metal-binding, metalloprotease, protease, zinc, keops complex, ATPase, metal ION binding; 3.02A {Thermoplasma acidophilum} Length = 334 Back     alignment and structure
>2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 1688 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target206 hypothetical protein CLIBASIA_01570 [Candidatus Liberib
2gel_A231 Putative GRAM negative resuscitation promoting factor; 100.0
2a6a_A218 Hypothetical protein TM0874; glycoprotein endopeptidase 100.0
2ivn_A 330 O-sialoglycoprotein endopeptidase; UP1 keops complex, F 99.94
3eno_A 334 Putative O-sialoglycoprotein endopeptidase; hydrolase, 99.89
3en9_A 540 Glycoprotease, O-sialoglycoprotein endopeptidase/protei 99.86
1hux_A270 Activator of (R)-2-hydroxyglutaryl-COA dehydratase; act 96.81
1hjr_A158 Holliday junction resolvase (RUVC); site-specific recom 95.85
1saz_A 381 Probable butyrate kinase 2; askha (acetate and sugar ki 94.93
2iir_A 403 Acetate kinase; transferase; 3.30A {Thermotoga maritima 93.91
2aa4_A289 Mannac kinase, putative N-acetylmannosamine kinase; sug 93.57
3g25_A 501 Glycerol kinase; IDP00743, ATP-binding, glycerol metabo 94.92
2dpn_A 495 Glycerol kinase; thermus thermophilus HB8, structural g 93.88
3jvp_A 572 Ribulokinase; PSI-II, NYSGXRC, ribulose kinase, sugar k 92.86
2zf5_O 497 Glycerol kinase; hyperthermophilic archaeon, ATP-bindin 92.45
3l0q_A 554 Xylulose kinase; xlylulose kinase, SGX, PSI, structural 91.29
2d4w_A 504 Glycerol kinase; alpha and beta protein, ribonuclease H 91.09
3h3n_X 506 Glycerol kinase; ATP-binding, glycerol metabolism, nucl 90.84
>2gel_A Putative GRAM negative resuscitation promoting factor; YEAZ, RPF, actin-like-fold, glycoprotease, chaperone; 2.05A {Salmonella typhimurium LT2} PDB: 2gem_A 1okj_A Back     alignment and structure
Probab=100.00  E-value=1.2e-43  Score=302.28  Aligned_cols=199  Identities=26%  Similarity=0.448  Sum_probs=162.6

Q ss_pred             CCEEEEECCCHHHEEEEEECCCCEEEEEEEEECCHHHHHHHHHHHHHHHHHHCCCHHHHHHHHCCCCCCCCHHHHHHHHH
Q ss_conf             92788621680127899977981399999984226899989999999997609998786654303785432024668999
Q gi|254780429|r    1 MIVLALDTTGADCSVAIYDSHAGRILGSYFKNLGRGHAEHLMPAIDYALKDSRLEVSQVDRVVTALGPGSFTGVRVSIAV   80 (206)
Q Consensus         1 M~iLaIdTs~~~~sval~~~~~~~~~~~~~~~~~r~hs~~L~~~i~~lL~~~~~~~~~id~iav~~GPGSFTGlRigia~   80 (206)
                      |+|||||||++.|||||+++  ++++.+ .+..+|+|++.|+|+|+++|++++++++|||.|+|++|||||||||||+++
T Consensus         1 M~iLaIdTS~~~~sval~~~--~~i~~~-~~~~~r~hs~~L~~~i~~~L~~~~i~~~did~i~v~~GPGSFTGlRig~s~   77 (231)
T 2gel_A            1 MRILAIDTATEACSVALWNN--GTINAH-FELCPREHTQRILPMVQEILAASGASLNEIDALAFGRGPGSFTGVRIGIGI   77 (231)
T ss_dssp             CEEEEEECSSSEEEEEEEET--TEEEEE-EEECCSCCHHHHHHHHHHHHHHTTCCGGGCSEEEEECCSSCHHHHHHHHHH
T ss_pred             CCEEEEECCCCCEEEEEEEC--CEEEEE-EEECCHHHHHHHHHHHHHHHHHCHHHHHHHCEEEEECCCCCHHHHHHHHHH
T ss_conf             98999993772719999999--999999-997558999999999999987550212331079997586513758899999


Q ss_pred             HHHHHHHCCCCCCCCCHHHHHHHHHHCCCCCCEEEEEECCCCCEEEEEEEEECCC----CCCCCCCCCHHHHHHHHCC--
Q ss_conf             9999973268711038389999875214678659998508714179999961783----1145110699999884227--
Q gi|254780429|r   81 ARGISLVLKQPALGVGNLEVLARAHLDSHVGRPIMVLVSLFHQKVCCQKFSLDGV----SCSDPVLLNYEQTRSEVDN--  154 (206)
Q Consensus        81 akgLa~~~~~pv~gvssle~la~~~~~~~~~~~i~~~idArr~~~y~~~~~~~g~----~~~~~~~~~~~~~~~~~~~--  154 (206)
                      ||||++++++|++||+||+++|+++.......++++++||||+++|++.|+.+..    ...++.+...+++.+.+..  
T Consensus        78 akgla~~~~ip~igvssl~~lA~~~~~~~~~~~i~~~idArr~~~y~~~y~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~  157 (231)
T 2gel_A           78 AQGLALGANLPMIGVSTLATMAQGAWRKTGATRVLAAIDARMGEVYWAEYQRDAQGVWQGEETEAVLKPERVGERLKQLS  157 (231)
T ss_dssp             HHHHHHTTTCCEEEECHHHHHHHHHHHHHCCSEEEEEEEETTTEEEEEEEEECTTSCEECGGGCEEECHHHHHHHHTTCC
T ss_pred             HHHHHHHHCCCCCCCCHHHHHHHHHHHCCCCCCCEEEEECCCCEEEEEEEECCCCCCEECCCCCCCCCHHHHHHHHHHCC
T ss_conf             99999974888675276999999866402454321456447882999998648897401145010289999999998508


Q ss_pred             CCEEEECCCHHHCCCCCCC---------CCCCCHHHHH-------HCCCCCCCCCCCCCEECCC
Q ss_conf             7759982713314222367---------7745778898-------6388357464874000698
Q gi|254780429|r  155 FEGEIVGSGLSAIRGIEND---------IDHLPMDVLS-------RLGITKSSPFPSPIYLRSP  202 (206)
Q Consensus       155 ~~~~~~g~~~~~~~~~~~~---------~~~~~~~~~a-------~~~~~~~~~~~~PlYlR~P  202 (206)
                      .+..++|+++..+......         ........++       ..+...+...++|+|||++
T Consensus       158 ~~~~~~g~g~~~~~~~~~~~~~~~~~~~~~~p~a~~l~~la~~~~~~~~~~~~~~~~P~YlR~~  221 (231)
T 2gel_A          158 GEWATVGTGWSAWPDLAKECGLTLHDGEVSLPAAEDMLPIASQKLAAGETVAVEHAEPVYLRNE  221 (231)
T ss_dssp             SCEEEESTHHHHSTHHHHHSCCCEEEEEESSCCHHHHHHHHHHHHHTTCCBCGGGCCCCCC---
T ss_pred             CCEEEEECHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCEECCCCCC
T ss_conf             9859991689988999863566547642358799999999999998599988040753305865



>2a6a_A Hypothetical protein TM0874; glycoprotein endopeptidase, structural genomics, joint center for structural genomics, JCSG; 2.50A {Thermotoga maritima MSB8} SCOP: c.55.1.9 c.55.1.9 Back     alignment and structure
>2ivn_A O-sialoglycoprotein endopeptidase; UP1 keops complex, Fe/Zn dependent nucleotide phosphatase, metalloprotease, hypothetical protein, zinc; HET: ANP; 1.65A {Pyrococcus abyssi} PDB: 2ivo_A 2ivp_A* Back     alignment and structure
>3eno_A Putative O-sialoglycoprotein endopeptidase; hydrolase, metal-binding, metalloprotease, protease, zinc, keops complex, ATPase, metal ION binding; 3.02A {Thermoplasma acidophilum} Back     alignment and structure
>3en9_A Glycoprotease, O-sialoglycoprotein endopeptidase/protein kinase; endopeptidase activity, protein kinase activity; HET: TBR; 2.67A {Methanocaldococcus jannaschii} PDB: 3enh_A* 2vwb_A* Back     alignment and structure
>1hux_A Activator of (R)-2-hydroxyglutaryl-COA dehydratase; actin fold, metal binding protein; HET: ADP; 3.00A {Acidaminococcus fermentans} SCOP: c.55.1.5 Back     alignment and structure
>1hjr_A Holliday junction resolvase (RUVC); site-specific recombinase; 2.50A {Escherichia coli} SCOP: c.55.3.6 Back     alignment and structure
>1saz_A Probable butyrate kinase 2; askha (acetate and sugar kinases, HSC70, actin) superfamily, acetate kinase, isobutyrate kinase; HET: ACP; 2.50A {Thermotoga maritima} SCOP: c.55.1.2 c.55.1.2 PDB: 1x9j_A* Back     alignment and structure
>2iir_A Acetate kinase; transferase; 3.30A {Thermotoga maritima} Back     alignment and structure
>2aa4_A Mannac kinase, putative N-acetylmannosamine kinase; sugar methabolism, structural genomics, PSI, protein structure initiative; 2.20A {Escherichia coli} SCOP: c.55.1.10 c.55.1.10 Back     alignment and structure
>3g25_A Glycerol kinase; IDP00743, ATP-binding, glycerol metabolism, nucleotide-binding, transferase, structural genomics; HET: MSE; 1.90A {Staphylococcus aureus subsp} PDB: 3ge1_A* Back     alignment and structure
>2dpn_A Glycerol kinase; thermus thermophilus HB8, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.80A {Thermus thermophilus} Back     alignment and structure
>2zf5_O Glycerol kinase; hyperthermophilic archaeon, ATP-binding, glycerol metabolism, nucleotide-binding, transferase; 2.40A {Thermococcus kodakarensis KOD1} Back     alignment and structure
>3l0q_A Xylulose kinase; xlylulose kinase, SGX, PSI, structural genomics, protein structure initiative; HET: MSE XUL EPE; 1.61A {Yersinia pseudotuberculosis} PDB: 3gg4_A* Back     alignment and structure
>2d4w_A Glycerol kinase; alpha and beta protein, ribonuclease H-like motif, actin- like ATPase domain, transferase; 2.30A {Cellulomonas SP} Back     alignment and structure
>3h3n_X Glycerol kinase; ATP-binding, glycerol metabolism, nucleotide-binding, phosphoprotein, transferase; 1.73A {Enterococcus casseliflavus} PDB: 3h3o_O 3flc_O 3h46_X 3h45_X 3d7e_O 1r59_O 1xup_O Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 206 hypothetical protein CLIBASIA_01570 [Candidatus Liberib
d2a6aa1103 c.55.1.9 (A:1-103) Hypothetical protein TM0874 {Thermot 2e-20
d1okja1106 c.55.1.9 (A:1-106) Hypothetical protein YeaZ {Escherich 8e-15
>d2a6aa1 c.55.1.9 (A:1-103) Hypothetical protein TM0874 {Thermotoga maritima [TaxId: 2336]} Length = 103 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Ribonuclease H-like motif
superfamily: Actin-like ATPase domain
family: YeaZ-like
domain: Hypothetical protein TM0874
species: Thermotoga maritima [TaxId: 2336]
 Score = 92.6 bits (230), Expect = 2e-20
 Identities = 31/104 (29%), Positives = 47/104 (45%), Gaps = 4/104 (3%)

Query: 1   MIVLALDTTGADCSVAIYDSHAGRILGSYFKNLGRGHAEHLMPAIDYALKDSRLEVSQVD 60
           M VLALDT+     + +     G  L        + HAE L   +   L +  L+V  +D
Sbjct: 1   MNVLALDTSQR-IRIGLRK---GEDLFEISYTGEKKHAEILPVVVKKLLDELDLKVKDLD 56

Query: 61  RVVTALGPGSFTGVRVSIAVARGISLVLKQPALGVGNLEVLARA 104
            V   +GPG  TG+RV IA   G+      P   + + E+ A++
Sbjct: 57  VVGVGIGPGGLTGLRVGIATVVGLVSPYDIPVAPLNSFEMTAKS 100


>d1okja1 c.55.1.9 (A:1-106) Hypothetical protein YeaZ {Escherichia coli [TaxId: 562]} Length = 106 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target206 hypothetical protein CLIBASIA_01570 [Candidatus Liberib
d2a6aa1103 Hypothetical protein TM0874 {Thermotoga maritima [TaxId 99.95
d1okja1106 Hypothetical protein YeaZ {Escherichia coli [TaxId: 562 99.95
d1saza1172 butyrate kinase 2 {Thermotoga maritima [TaxId: 2336]} 96.75
d1huxa_259 Hydroxyglutaryl-CoA dehydratase component A {Acidaminoc 96.35
d1hjra_158 RuvC resolvase {Escherichia coli [TaxId: 562]} 95.4
d2aa4a1119 N-acetylmannosamine kinase NanK {Escherichia coli [TaxI 94.77
d2ap1a2117 Putative regulator protein YcfX {Salmonella typhimurium 93.53
d1g99a1197 Acetate kinase {Archaeon Methanosarcina thermophila [Ta 91.07
d1okja2110 Hypothetical protein YeaZ {Escherichia coli [TaxId: 562 98.43
d2a6aa290 Hypothetical protein TM0874 {Thermotoga maritima [TaxId 93.49
d1zc6a1114 Probable N-acetylglucosamine kinase CV2896 {Chromobacte 93.46
>d2a6aa1 c.55.1.9 (A:1-103) Hypothetical protein TM0874 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Ribonuclease H-like motif
superfamily: Actin-like ATPase domain
family: YeaZ-like
domain: Hypothetical protein TM0874
species: Thermotoga maritima [TaxId: 2336]
Probab=99.95  E-value=1.4e-28  Score=203.03  Aligned_cols=102  Identities=29%  Similarity=0.370  Sum_probs=94.6

Q ss_pred             CCEEEEECCCHHHEEEEEECCCCEEEEEEEEECCHHHHHHHHHHHHHHHHHHCCCHHHHHHHHCCCCCCCCHHHHHHHHH
Q ss_conf             92788621680127899977981399999984226899989999999997609998786654303785432024668999
Q gi|254780429|r    1 MIVLALDTTGADCSVAIYDSHAGRILGSYFKNLGRGHAEHLMPAIDYALKDSRLEVSQVDRVVTALGPGSFTGVRVSIAV   80 (206)
Q Consensus         1 M~iLaIdTs~~~~sval~~~~~~~~~~~~~~~~~r~hs~~L~~~i~~lL~~~~~~~~~id~iav~~GPGSFTGlRigia~   80 (206)
                      |+||+||||+ .++|++.+++   .+.+..+...|+|++.|+++|+++|++++++++|||.|+|++|||||||+|||+++
T Consensus         1 M~iLaidTS~-~~sval~~~~---~~~~~~~~~~~~hs~~l~~~i~~~l~~~~~~~~di~~i~v~~GPGsfTglRig~s~   76 (103)
T d2a6aa1           1 MNVLALDTSQ-RIRIGLRKGE---DLFEISYTGEKKHAEILPVVVKKLLDELDLKVKDLDVVGVGIGPGGLTGLRVGIAT   76 (103)
T ss_dssp             CEEEEEECSS-SEEEEEEETT---EEEEEEEESCGGGGGHHHHHHHHHHHHHTCCGGGCSEEEEECCSSCHHHHHHHHHH
T ss_pred             CCEEEEECCC-CCEEEEEECC---EEEEEECCCCHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHCCCCCCCHHHHHHHHH
T ss_conf             9599999376-5379999899---99999616766899999999999999839998996777624788763208999999


Q ss_pred             HHHHHHHCCCCCCCCCHHHHHHHHHH
Q ss_conf             99999732687110383899998752
Q gi|254780429|r   81 ARGISLVLKQPALGVGNLEVLARAHL  106 (206)
Q Consensus        81 akgLa~~~~~pv~gvssle~la~~~~  106 (206)
                      +|||++++++|++||++||++|.++.
T Consensus        77 akgla~~~~ip~~gis~l~~lA~~~p  102 (103)
T d2a6aa1          77 VVGLVSPYDIPVAPLNSFEMTAKSCP  102 (103)
T ss_dssp             HHHHHGGGTCCEEEECHHHHHHHTCS
T ss_pred             HHHHHHHCCCCEEEECHHHHHHHHCC
T ss_conf             99999980999997487999987388



>d1okja1 c.55.1.9 (A:1-106) Hypothetical protein YeaZ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1saza1 c.55.1.2 (A:1-172) butyrate kinase 2 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1huxa_ c.55.1.5 (A:) Hydroxyglutaryl-CoA dehydratase component A {Acidaminococcus fermentans [TaxId: 905]} Back     information, alignment and structure
>d1hjra_ c.55.3.6 (A:) RuvC resolvase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2aa4a1 c.55.1.10 (A:1-119) N-acetylmannosamine kinase NanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ap1a2 c.55.1.10 (A:1-117) Putative regulator protein YcfX {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1g99a1 c.55.1.2 (A:1-197) Acetate kinase {Archaeon Methanosarcina thermophila [TaxId: 2210]} Back     information, alignment and structure
>d1okja2 c.55.1.9 (A:107-216) Hypothetical protein YeaZ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a6aa2 c.55.1.9 (A:104-193) Hypothetical protein TM0874 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1zc6a1 c.55.1.5 (A:8-121) Probable N-acetylglucosamine kinase CV2896 {Chromobacterium violaceum [TaxId: 536]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 206 hypothetical protein CLIBASIA_01570 [Candidatus Li
2gel_A_1-93_190-231135 (A:1-93,A:190-231) Putative GRAM negative resuscit 2e-20
2a6a_A_1-104_174-218149 (A:1-104,A:174-218) Hypothetical protein TM0874; g 1e-19
3en9_A_1-125_287-326165 (A:1-125,A:287-326) Glycoprotease, O-sialoglycopro 3e-17
2ivn_A_1-118_283-330166 (A:1-118,A:283-330) O-sialoglycoprotein endopeptid 8e-17
3eno_A_1-126_288-334173 (A:1-126,A:288-334) Putative O-sialoglycoprotein e 9e-16
>2gel_A (A:1-93,A:190-231) Putative GRAM negative resuscitation promoting factor; YEAZ, RPF, actin-like-fold, glycoprotease, chaperone; 2.05A {Salmonella typhimurium LT2} PDB: 2gem_A 1okj_ALength = 135 Back     alignment and structure
 Score = 93.7 bits (233), Expect = 2e-20
 Identities = 34/95 (35%), Positives = 58/95 (61%), Gaps = 3/95 (3%)

Query: 1  MIVLALDTTGADCSVAIYDSHAGRILGSYFKNLGRGHAEHLMPAIDYALKDSRLEVSQVD 60
          M +LA+DT    CSVA++++  G I  ++F+   R H + ++P +   L  S   ++++D
Sbjct: 1  MRILAIDTATEACSVALWNN--GTIN-AHFELCPREHTQRILPMVQEILAASGASLNEID 57

Query: 61 RVVTALGPGSFTGVRVSIAVARGISLVLKQPALGV 95
           +    GPGSFTGVR+ I +A+G++L    P +GV
Sbjct: 58 ALAFGRGPGSFTGVRIGIGIAQGLALGANLPMIGV 92


>2a6a_A (A:1-104,A:174-218) Hypothetical protein TM0874; glycoprotein endopeptidase, structural genomics, joint center for structural genomics, JCSG; 2.50A {Thermotoga maritima MSB8}Length = 149 Back     alignment and structure
>3en9_A (A:1-125,A:287-326) Glycoprotease, O-sialoglycoprotein endopeptidase/protein kinase; endopeptidase activity, protein kinase activity; HET: TBR; 2.67A {Methanocaldococcus jannaschii} PDB: 3enh_A* 2vwb_A*Length = 165 Back     alignment and structure
>2ivn_A (A:1-118,A:283-330) O-sialoglycoprotein endopeptidase; UP1 keops complex, Fe/Zn dependent nucleotide phosphatase, metalloprotease, hypothetical protein, zinc; HET: ANP; 1.65A {Pyrococcus abyssi} PDB: 2ivo_A 2ivp_A*Length = 166 Back     alignment and structure
>3eno_A (A:1-126,A:288-334) Putative O-sialoglycoprotein endopeptidase; hydrolase, metal-binding, metalloprotease, protease, zinc, keops complex, ATPase, metal ION binding; 3.02A {Thermoplasma acidophilum}Length = 173 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target206 hypothetical protein CLIBASIA_01570 [Candidatus Liberib
2gel_A_1-93_190-231135 Putative GRAM negative resuscitation promoting fac 99.94
3en9_A_1-125_287-326165 Glycoprotease, O-sialoglycoprotein endopeptidase/p 99.93
2ivn_A_1-118_283-330166 O-sialoglycoprotein endopeptidase; UP1 keops compl 99.93
3eno_A_1-126_288-334173 Putative O-sialoglycoprotein endopeptidase; hydrol 99.91
2a6a_A_1-104_174-218149 Hypothetical protein TM0874; glycoprotein endopept 99.91
1saz_A_1-172_333-381221 Probable butyrate kinase 2; askha (acetate and sug 96.56
1hjr_A_158 Holliday junction resolvase (RUVC); site-specific 96.24
1hux_A_1-95_239-270127 Activator of (R)-2-hydroxyglutaryl-COA dehydratase 96.01
2h3g_X_1-92_240-268121 Biosynthetic protein; pantothenate kinase, anthrax 95.51
2iir_A_1-164_386-403182 Acetate kinase; transferase; 3.30A {Thermotoga mar 94.7
1vhx_A_150 Putative holliday junction resolvase; structural g 94.47
2ch5_A_1-119_314-347153 NAGK protein; transferase, N-acetylglucosamine, gl 94.04
3i8b_A_1-74_255-284_436-494163 Xylulose kinase; strain ATCC 15703 / DSM 20083, 11 93.03
2qm1_A_1-131_308-326150 Glucokinase; alpha-beta structure, putative helix- 92.43
1g99_A_1-164_384-408189 Acetate kinase; alpha/beta, askha (acetate and sug 92.17
2zf5_O_1-238238 Glycerol kinase; hyperthermophilic archaeon, ATP-b 91.32
2dpn_A_1-241241 Glycerol kinase; thermus thermophilus HB8, structu 90.47
2gel_A_94-18996 Putative GRAM negative resuscitation promoting fac 98.76
3h3n_X_1-84_222-244107 Glycerol kinase; ATP-binding, glycerol metabolism, 93.99
3jvp_A_1-96_187-278_474-509224 Ribulokinase; PSI-II, NYSGXRC, ribulose kinase, su 93.87
1zc6_A_1-121_280-305147 Probable N-acetylglucosamine kinase; NESG, Q7NU07_ 93.63
3djc_A_1-123_243-266147 Type III pantothenate kinase; structural genomics, 93.34
3g25_A_1-85_223-246109 Glycerol kinase; IDP00743, ATP-binding, glycerol m 93.19
3l0q_A_1-266_476-506297 Xylulose kinase; xlylulose kinase, SGX, PSI, struc 90.18
>2gel_A (A:1-93,A:190-231) Putative GRAM negative resuscitation promoting factor; YEAZ, RPF, actin-like-fold, glycoprotease, chaperone; 2.05A {Salmonella typhimurium LT2} PDB: 2gem_A 1okj_A Back     alignment and structure
Probab=99.94  E-value=5.1e-27  Score=195.33  Aligned_cols=126  Identities=28%  Similarity=0.494  Sum_probs=101.4

Q ss_pred             CCEEEEECCCHHHEEEEEECCCCEEEEEEEEECCHHHHHHHHHHHHHHHHHHCCCHHHHHHHHCCCCCCCCHHHHHHHHH
Q ss_conf             92788621680127899977981399999984226899989999999997609998786654303785432024668999
Q gi|254780429|r    1 MIVLALDTTGADCSVAIYDSHAGRILGSYFKNLGRGHAEHLMPAIDYALKDSRLEVSQVDRVVTALGPGSFTGVRVSIAV   80 (206)
Q Consensus         1 M~iLaIdTs~~~~sval~~~~~~~~~~~~~~~~~r~hs~~L~~~i~~lL~~~~~~~~~id~iav~~GPGSFTGlRigia~   80 (206)
                      |++|+||||++.+++|+++++  +++.+. +...++|++.|+|+++++|++++++++|||.|+|+.|||||||+|||+++
T Consensus         1 M~iLaIDTS~~~~~vAl~~d~--~il~~~-~~~~~~hse~L~~~I~~lL~~a~i~~~dId~Iavs~GPGSFTGlRVgla~   77 (135)
T 2gel_A            1 MRILAIDTATEACSVALWNNG--TINAHF-ELCPREHTQRILPMVQEILAASGASLNEIDALAFGRGPGSFTGVRIGIGI   77 (135)
T ss_dssp             CEEEEEECSSSEEEEEEEETT--EEEEEE-EECCSCCHHHHHHHHHHHHHHTTCCGGGCSEEEEECCSSCHHHHHHHHHH
T ss_pred             CCEEEEECCCCCEEEEEEECC--EEEEEE-EECCHHHHHHHHHHHHHHHHHHCCCCHHHHHHEEECCCCCCHHHHHHHHH
T ss_conf             989999927727199999999--999999-96548999999999999985500221230443000356642337788999


Q ss_pred             HHHHHHHCCCCCCCCCHHHHHHHHHHCCCCCCEEEEEECC----CCCEEEEEE
Q ss_conf             9999973268711038389999875214678659998508----714179999
Q gi|254780429|r   81 ARGISLVLKQPALGVGNLEVLARAHLDSHVGRPIMVLVSL----FHQKVCCQK  129 (206)
Q Consensus        81 akgLa~~~~~pv~gvssle~la~~~~~~~~~~~i~~~idA----rr~~~y~~~  129 (206)
                      ||||++++++|++|||+-+.++--+.+....+....+-++    -|++|-|..
T Consensus        78 AkgLa~~~~iPligvs~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  130 (135)
T 2gel_A           78 AQGLALGANLPMIGVSAAEDMLPIASQKLAAGETVAVEHAEPVYLRNEVAWKK  130 (135)
T ss_dssp             HHHHHHTTTCCEEEECCHHHHHHHHHHHHHTTCCBCGGGCCCCCC--------
T ss_pred             HHHHHHHCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCEECCCCCCCCCCC
T ss_conf             99999863898764059999999999999859998814176242585200357



>3en9_A (A:1-125,A:287-326) Glycoprotease, O-sialoglycoprotein endopeptidase/protein kinase; endopeptidase activity, protein kinase activity; HET: TBR; 2.67A {Methanocaldococcus jannaschii} PDB: 3enh_A* 2vwb_A* Back     alignment and structure
>2ivn_A (A:1-118,A:283-330) O-sialoglycoprotein endopeptidase; UP1 keops complex, Fe/Zn dependent nucleotide phosphatase, metalloprotease, hypothetical protein, zinc; HET: ANP; 1.65A {Pyrococcus abyssi} PDB: 2ivo_A 2ivp_A* Back     alignment and structure
>3eno_A (A:1-126,A:288-334) Putative O-sialoglycoprotein endopeptidase; hydrolase, metal-binding, metalloprotease, protease, zinc, keops complex, ATPase, metal ION binding; 3.02A {Thermoplasma acidophilum} Back     alignment and structure
>2a6a_A (A:1-104,A:174-218) Hypothetical protein TM0874; glycoprotein endopeptidase, structural genomics, joint center for structural genomics, JCSG; 2.50A {Thermotoga maritima MSB8} Back     alignment and structure
>1saz_A (A:1-172,A:333-381) Probable butyrate kinase 2; askha (acetate and sugar kinases, HSC70, actin) superfamily, acetate kinase, isobutyrate kinase; HET: ACP; 2.50A {Thermotoga maritima} Back     alignment and structure
>1hjr_A (A:) Holliday junction resolvase (RUVC); site-specific recombinase; 2.50A {Escherichia coli} Back     alignment and structure
>1hux_A (A:1-95,A:239-270) Activator of (R)-2-hydroxyglutaryl-COA dehydratase; actin fold, metal binding protein; HET: ADP; 3.00A {Acidaminococcus fermentans} Back     alignment and structure
>2h3g_X (X:1-92,X:240-268) Biosynthetic protein; pantothenate kinase, anthrax, type III pantothenate kinase, COAX, COAA, askha; 2.00A {Bacillus anthracis str} Back     alignment and structure
>2iir_A (A:1-164,A:386-403) Acetate kinase; transferase; 3.30A {Thermotoga maritima} Back     alignment and structure
>1vhx_A (A:) Putative holliday junction resolvase; structural genomics, hydrolase; 1.96A {Bacillus subtilis} Back     alignment and structure
>2ch5_A (A:1-119,A:314-347) NAGK protein; transferase, N-acetylglucosamine, glcnac, sugar kinase, ribonuclease H fold, sugar kinase/HSP70/actin superfamily, domain rotation; HET: NAG NDG; 1.9A {Homo sapiens} Back     alignment and structure
>3i8b_A (A:1-74,A:255-284,A:436-494) Xylulose kinase; strain ATCC 15703 / DSM 20083, 11200J,, transferase, structural genomics, PSI-2; 2.00A {Bifidobacterium adolescentis ATCC15703} Back     alignment and structure
>2qm1_A (A:1-131,A:308-326) Glucokinase; alpha-beta structure, putative helix-turn-helix, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.02A {Enterococcus faecalis V583} Back     alignment and structure
>1g99_A (A:1-164,A:384-408) Acetate kinase; alpha/beta, askha (acetate and sugar kinases, HSC70, actin) superfamily, conserved epsilon conformation; HET: ADP; 2.50A {Methanosarcina thermophila} Back     alignment and structure
>2zf5_O (O:1-238) Glycerol kinase; hyperthermophilic archaeon, ATP-binding, glycerol metabolism, nucleotide-binding, transferase; 2.40A {Thermococcus kodakarensis KOD1} Back     alignment and structure
>2dpn_A (A:1-241) Glycerol kinase; thermus thermophilus HB8, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.80A {Thermus thermophilus} Back     alignment and structure
>2gel_A (A:94-189) Putative GRAM negative resuscitation promoting factor; YEAZ, RPF, actin-like-fold, glycoprotease, chaperone; 2.05A {Salmonella typhimurium LT2} PDB: 2gem_A 1okj_A Back     alignment and structure
>3h3n_X (X:1-84,X:222-244) Glycerol kinase; ATP-binding, glycerol metabolism, nucleotide-binding, phosphoprotein, transferase; 1.73A {Enterococcus casseliflavus} PDB: 3h3o_O 3flc_O 3h46_X 3h45_X 3d7e_O 1r59_O 1xup_O Back     alignment and structure
>1zc6_A (A:1-121,A:280-305) Probable N-acetylglucosamine kinase; NESG, Q7NU07_chrvo, CVR23, structural genomics, PSI, protein structure initiative; 2.20A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>3djc_A (A:1-123,A:243-266) Type III pantothenate kinase; structural genomics, putative transferase, PSI-2, protein structure initiative; 2.40A {Legionella pneumophila subsp} Back     alignment and structure
>3g25_A (A:1-85,A:223-246) Glycerol kinase; IDP00743, ATP-binding, glycerol metabolism, nucleotide-binding, transferase, structural genomics; HET: MSE; 1.90A {Staphylococcus aureus subsp} PDB: 3ge1_A* Back     alignment and structure
>3l0q_A (A:1-266,A:476-506) Xylulose kinase; xlylulose kinase, SGX, PSI, structural genomics, protein structure initiative; HET: MSE XUL EPE; 1.61A {Yersinia pseudotuberculosis} PDB: 3gg4_A* Back     alignment and structure