254780431

254780431

hypothetical protein CLIBASIA_01580

GeneID in NCBI database:8209417Locus tag:CLIBASIA_01580
Protein GI in NCBI database:254780431Protein Accession:YP_003064844.1
Gene range:-(337920, 338456)Protein Length:178aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein; K13583 GcrA cell cycle regulator
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------18
MVWTVERIDKLKKFWSEGLSASQIAVQLGGVTRNAVIGKLHRLFLSNRVKVNENKQSDGNRKNVTLGSTSPKTRQSSNVYICEPVLKGQLPVVRSKRKSKSMEKNNTISSGIVLPISRCLRLMELTDNTCKWPLGDPFGKDFSFCGSDVCNDSPYCDYHKKLAYQRVNDRRKVQANSE
ccccHHHHHHHHHHHHccccHHHHHHHHcccHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccEEEEcccccccccccccccccEEEccccccccccccHHHHcEEEcccHHHHHcccccc
ccccHHHHHHHHHHHHccccHHHHHHHHccccHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccHHHccHHccccccccccccccEEccccccccccccHHHHHEEEcccHHHHHHHcccc
MVWTVERIDKLKKFWSEGLSASQIAVQLGGVTRNAVIGKLHRLFLSNRVkvnenkqsdgnrknvtlgstspktrqssnvyicepvlkgqlpvvrskrksksmeknntissgivlpisrCLRLmeltdntckwplgdpfgkdfsfcgsdvcndspycdyhkkLAYQRVNDRRKVQANSE
MVWTVERIDKLKKFWSEGLSASQIAVQLGGVTRNAVIGKLHRlflsnrvkvnenkqsdgnrknvtlgstspktrqssnvyicepvlkgqlpvvrskrksksmeknntissgivlpisRCLRLMELTDNTCKWPLGDPFGKDFSFCGSDVCNDSPYCDYHKKLAYQRVNDRRKVQANSE
MVWTVERIDKLKKFWSEGLSASQIAVQLGGVTRNAVIGKLHRLFLSNRVKVNENKQSDGNRKNVTLGSTSPKTRQSSNVYICEPVLKGQLPVVRSKRKSKSMEKNNTISSGIVLPISRCLRLMELTDNTCKWPLGDPFGKDFSFCGSDVCNDSPYCDYHKKLAYQRVNDRRKVQANSE
*VWTVERIDKLKKFWSEGLSASQIAVQLGGVTRNAVIGKLHRL********************************************************************************ELTDNTCKWPLGDPFGKDFSFCGSDVCNDSPYCDYHKKL****************
MVWTVERIDKLKKFWSEGLSASQIAVQLGGVTRNAVIGKLHRLFLSNRVKVNENKQSDGNRKNVTLGSTSPKTRQSSNVYICEPVLKGQLPV************NNTISSGIVLPISRCLRLMELTDNTCKWPLGDPFGKDFSFCGSDVCNDSPYCDYHKKLAYQRVN**********
*VWTVERIDKLKKFWSEGLSASQIAVQLGGVTRNAVIGKLHRLFL******************************************************KSMEKNNTISSGIVLPISRCLRLMELTDNTCKWPLGDPFGKDFSFCGSDVCNDSPYCDYHKKLAYQRVNDR********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVWTVERIDKLKKFWSEGLSASQIAVQLGGVTRNAVIGKLHRLFLSNRVKVNENKQSDGNRKNVTLGSTSPKTRQSSNVYICEPVLKGQLPVVRSKRKSKSMEKNNTISSGIVLPISRCLRLMELTDNTCKWPLGDPFGKDFSFCGSDVCNDSPYCDYHKKLAYQRVNDRRKVQANSE
MVWTVERIDKLKKFWSEGLSASQIAVQLGGVTRNAVIGKLHRLFLSNRVKVNENKQSDGNRKNVTLGSTSPKTRQSSNVYICEPVLKGQLPVVRSKRKSKSMEKNNTISSGIVLPISRCLRLMELTDNTCKWPLGDPFGKDFSFCGSDVCNDSPYCDYHKKLAYQRVNDRRKVQANSE
MVWTVERIDKLKKFWSEGLSASQIAVQLGGVTRNAVIGKLHRLFLSNRVKVNENKQSDGNRKNVTLGSTSPKTRQSSNVYICEPVLKGQLPVVRSKRKSKSMEKNNTISSGIVLPISRCLRLMELTDNTCKWPLGDPFGKDFSFCGSDVCNDSPYCDYHKKLAYQRVNDRRKVQANSE

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target178 hypothetical protein CLIBASIA_01580 [Candidatus Liberib
254780404286 inositol monophosphatase family protein [Candidatu 0.038
>gi|254780404|ref|YP_003064817.1| inositol monophosphatase family protein [Candidatus Liberibacter asiaticus str. psy62] Length = 286 Back     alignment
 Score = 29.3 bits (64), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 43/169 (25%), Positives = 72/169 (42%), Gaps = 22/169 (13%)

Query: 2   VWTVERIDKLKKFWSEGLSASQIAVQLGGVTRNAVIGKLHRLFLSNRVKVNENKQSDGNR 61
           ++ V+ ID  + F  EG +   I+V +    R  VIG +H   L     V+   +S  N 
Sbjct: 110 LFVVDPIDGTRAF-IEGRNEWCISVAVVHHGR-PVIGVVHASALGKEFFVSVGMKSTCNG 167

Query: 62  KNVTLGSTSPKTRQSSNVYICEPVLKGQLPVVRSKRKSKSMEKNNTISSGIVLPISRCLR 121
           KN+++  +S +   S  +   +  LKG    VR +R+S       +IS       S CLR
Sbjct: 168 KNISV--SSNQMSDSLAIMASDVSLKGLDSYVRFRRQS-------SIS-------SLCLR 211

Query: 122 LMELTDNTCKWPLGDPFGKDFSFCGSDV---CNDSPYCDYHKK-LAYQR 166
           ++ +        + D    D+    +D+   C+     D  +K L Y R
Sbjct: 212 ILMIASGEVDVLIVDRNANDWDLAAADLLLECSGGALVDIDRKLLTYNR 260

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target178 hypothetical protein CLIBASIA_01580 [Candidatus Liberib
315122121180 hypothetical protein CKC_01855 [Candidatus Liberibacter 1 3e-69
49473780177 hypothetical protein BQ01020 [Bartonella quintana str. 1 3e-38
15964269173 hypothetical protein SMc02139 [Sinorhizobium meliloti 1 1 2e-37
319407975177 conserved hypothetical protein [Bartonella schoenbuchen 1 2e-37
163867404177 hypothetical protein Btr_0114 [Bartonella tribocorum CI 1 3e-37
49474928177 hypothetical protein BH01100 [Bartonella henselae str. 1 1e-36
240849778177 GcrA cell cycle regulator [Bartonella grahamii as4aup] 1 2e-36
222084785178 hypothetical protein Arad_0773 [Agrobacterium radiobact 1 3e-36
325291859177 hypothetical protein AGROH133_03707 [Agrobacterium sp. 1 3e-36
327190078177 hypothetical protein RHECNPAF_469002 [Rhizobium etli CN 1 5e-36
>gi|315122121|ref|YP_004062610.1| hypothetical protein CKC_01855 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 180 Back     alignment and organism information
 Score =  265 bits (676), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 129/180 (71%), Positives = 147/180 (81%), Gaps = 2/180 (1%)

Query: 1   MVWTVERIDKLKKFWSEGLSASQIAVQLGGVTRNAVIGKLHRLFLSNRVKVNENKQSDG- 59
           MVWT ERIDKLK+FWS+GLSASQIA QLGGVTRNAVIGK+HRLFLS RVK+NEN++S   
Sbjct: 1   MVWTDERIDKLKQFWSDGLSASQIATQLGGVTRNAVIGKVHRLFLSGRVKINENRKSAAE 60

Query: 60  -NRKNVTLGSTSPKTRQSSNVYICEPVLKGQLPVVRSKRKSKSMEKNNTISSGIVLPISR 118
             RK+   G+ S K RQSS   I E + KG++ V  SKRKSK +EK + I SGIVLPISR
Sbjct: 61  VGRKDSNSGNASAKIRQSSVACIPESMSKGRVSVAASKRKSKPLEKGDEIPSGIVLPISR 120

Query: 119 CLRLMELTDNTCKWPLGDPFGKDFSFCGSDVCNDSPYCDYHKKLAYQRVNDRRKVQANSE 178
           CLRLMELT+NTCKWPLG+P GKDFSFCGSD  NDSPYCDYHK LAYQRV DRRK+Q N++
Sbjct: 121 CLRLMELTENTCKWPLGNPLGKDFSFCGSDAHNDSPYCDYHKNLAYQRVQDRRKIQVNAK 180


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|49473780|ref|YP_031822.1| hypothetical protein BQ01020 [Bartonella quintana str. Toulouse] Length = 177 Back     alignment and organism information
>gi|15964269|ref|NP_384622.1| hypothetical protein SMc02139 [Sinorhizobium meliloti 1021] Length = 173 Back     alignment and organism information
>gi|319407975|emb|CBI81629.1| conserved hypothetical protein [Bartonella schoenbuchensis R1] Length = 177 Back     alignment and organism information
>gi|163867404|ref|YP_001608599.1| hypothetical protein Btr_0114 [Bartonella tribocorum CIP 105476] Length = 177 Back     alignment and organism information
>gi|49474928|ref|YP_032969.1| hypothetical protein BH01100 [Bartonella henselae str. Houston-1] Length = 177 Back     alignment and organism information
>gi|240849778|ref|YP_002971166.1| GcrA cell cycle regulator [Bartonella grahamii as4aup] Length = 177 Back     alignment and organism information
>gi|222084785|ref|YP_002543314.1| hypothetical protein Arad_0773 [Agrobacterium radiobacter K84] Length = 178 Back     alignment and organism information
>gi|325291859|ref|YP_004277723.1| hypothetical protein AGROH133_03707 [Agrobacterium sp. H13-3] Length = 177 Back     alignment and organism information
>gi|327190078|gb|EGE57194.1| hypothetical protein RHECNPAF_469002 [Rhizobium etli CNPAF512] Length = 177 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target178 hypothetical protein CLIBASIA_01580 [Candidatus Liberib
pfam07750162 pfam07750, GcrA, GcrA cell cycle regulator 2e-42
COG5352169 COG5352, COG5352, Uncharacterized protein conserved in 2e-38
>gnl|CDD|116364 pfam07750, GcrA, GcrA cell cycle regulator Back     alignment and domain information
>gnl|CDD|34927 COG5352, COG5352, Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 178 hypothetical protein CLIBASIA_01580 [Candidatus Liberib
pfam07750162 GcrA GcrA cell cycle regulator. GcrA is a master cell c 100.0
COG5352169 Uncharacterized protein conserved in bacteria [Function 100.0
cd0056942 HTH_Hin_like Helix-turn-helix domain of Hin and related 95.77
COG3415138 Transposase and inactivated derivatives [DNA replicatio 94.19
pfam0279645 HTH_7 Helix-turn-helix domain of resolvase. 93.84
pfam04297101 UPF0122 Putative helix-turn-helix protein, YlxM / p13 l 92.7
PRK02277201 orotate phosphoribosyltransferase-like protein; Provisi 91.41
PRK00118105 putative DNA-binding protein; Validated 91.15
PRK03975139 tfx putative transcriptional regulator; Provisional 90.99
COG2522119 Predicted transcriptional regulator [General function p 90.85
cd0617057 LuxR_C_like C-terminal DNA-binding domain of LuxR-like 90.74
cd0009078 HTH_ARSR Arsenical Resistance Operon Repressor and simi 90.18
PRK06930170 positive control sigma-like factor; Validated 90.11
>pfam07750 GcrA GcrA cell cycle regulator Back     alignment and domain information
>COG5352 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>cd00569 HTH_Hin_like Helix-turn-helix domain of Hin and related proteins, a family of DNA-binding domains unique to bacteria and represented by the Hin protein of Salmonella Back     alignment and domain information
>COG3415 Transposase and inactivated derivatives [DNA replication, recombination, and repair] Back     alignment and domain information
>pfam02796 HTH_7 Helix-turn-helix domain of resolvase Back     alignment and domain information
>pfam04297 UPF0122 Putative helix-turn-helix protein, YlxM / p13 like Back     alignment and domain information
>PRK02277 orotate phosphoribosyltransferase-like protein; Provisional Back     alignment and domain information
>PRK00118 putative DNA-binding protein; Validated Back     alignment and domain information
>PRK03975 tfx putative transcriptional regulator; Provisional Back     alignment and domain information
>COG2522 Predicted transcriptional regulator [General function prediction only] Back     alignment and domain information
>cd06170 LuxR_C_like C-terminal DNA-binding domain of LuxR-like proteins Back     alignment and domain information
>cd00090 HTH_ARSR Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors Back     alignment and domain information
>PRK06930 positive control sigma-like factor; Validated Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target178 hypothetical protein CLIBASIA_01580 [Candidatus Liberib
1jko_C52 HIN recombinase, DNA-invertase HIN; water-mediated reco 95.5
1u78_A141 TC3 transposase, transposable element TC3 transposase; 94.96
1xsv_A113 Hypothetical UPF0122 protein SAV1236; helix-turn-helix, 92.64
3c57_A95 Two component transcriptional regulatory protein DEVR; 91.69
1je8_A82 Nitrate/nitrite response regulator protein NARL; protei 91.22
2elh_A87 CG11849-PA, LD40883P; structural genomics, NPPSFA, nati 90.2
1s7o_A113 Hypothetical UPF0122 protein SPY1201/SPYM3_0842/SPS1042 90.04
2k27_A159 Paired box protein PAX-8; paired domain, solution struc 90.01
>1jko_C HIN recombinase, DNA-invertase HIN; water-mediated recognition, protein-DNA complex, A10G mutant, DNA binding protein/DNA complex; 2.24A {Synthetic} SCOP: a.4.1.2 PDB: 1ijw_C* 1jj6_C* 1jj8_C* 1hcr_A 1jkp_C 1jkq_C 1jkr_C Back     alignment and structure
Probab=95.50  E-value=0.0072  Score=39.07  Aligned_cols=34  Identities=12%  Similarity=0.329  Sum_probs=31.0

Q ss_pred             CCHHHHHHHHHHHHCCCCHHHHHHHHCCCCHHHHH
Q ss_conf             77899999999998186588999996785434666
Q gi|254780431|r    3 WTVERIDKLKKFWSEGLSASQIAVQLGGVTRNAVI   37 (178)
Q Consensus         3 WTderve~LkkLW~eG~SasqIA~~lGgvtRNAVI   37 (178)
                      -|||.|+.+++|-.+|.|.+|||+.+| |||.-+-
T Consensus         6 Lt~~q~~~a~~l~~~G~s~~~iA~~~g-Vsr~TlY   39 (52)
T 1jko_C            6 INKHEQEQISRLLEKGHPRQQLAIIFG-IGVSTLY   39 (52)
T ss_dssp             SCTTHHHHHHHHHHTTCCHHHHHHTTS-CCHHHHH
T ss_pred             CCHHHHHHHHHHHHCCCCHHHHHHHHC-CCHHHHH
T ss_conf             999999999999997898999999979-7999999



>1u78_A TC3 transposase, transposable element TC3 transposase; transposon DNA, bipartite DNA-binding, HTH- motif, DNA binding protein/DNA complex; 2.69A {Caenorhabditis elegans} SCOP: a.4.1.2 a.4.1.2 Back     alignment and structure
>1xsv_A Hypothetical UPF0122 protein SAV1236; helix-turn-helix, putative DNA-binding protein, signal recognition particle, unknown function; 1.70A {Staphylococcus aureus subsp} SCOP: a.4.13.3 Back     alignment and structure
>3c57_A Two component transcriptional regulatory protein DEVR; response regulator, two-component regulatory system, DNA- binding protein; 1.70A {Mycobacterium tuberculosis} PDB: 1zlk_A 1zlj_A Back     alignment and structure
>1je8_A Nitrate/nitrite response regulator protein NARL; protein-DNA complex, two-component response regulator, helix-turn-helix, DNA bending; 2.12A {Escherichia coli} SCOP: a.4.6.2 PDB: 1zg1_A 1zg5_A Back     alignment and structure
>2elh_A CG11849-PA, LD40883P; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Drosophila melanogaster} Back     alignment and structure
>1s7o_A Hypothetical UPF0122 protein SPY1201/SPYM3_0842/SPS1042/SPYM18_1152; putative DNA binding protein, structural genomics; 2.31A {Streptococcus pyogenes serotype M3} SCOP: a.4.13.3 Back     alignment and structure
>2k27_A Paired box protein PAX-8; paired domain, solution structure, triple frequency, 3D NMR, induced FIT, alternative splicing, developmental protein; NMR {Homo sapiens} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target178 hypothetical protein CLIBASIA_01580 [Candidatus Liberib
d1gdta143 gamma,delta resolvase (C-terminal domain) {Escherichia 97.0
d1ijwc_47 HIN recombinase (DNA-binding domain) {Synthetic} 95.7
d1s7oa_106 Hypothetical protein SPy1201 {Streptococcus pyogenes [T 92.75
d1xsva_106 Hypothetical protein SAV1236 {Staphylococcus aureus, st 92.58
d1rp3a271 Sigma factor sigma-28 (FliA) {Aquifex aeolicus [TaxId: 91.09
d1a04a167 Nitrate/nitrite response regulator (NarL) {Escherichia 90.97
>d1gdta1 a.4.1.2 (A:141-183) gamma,delta resolvase (C-terminal domain) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Recombinase DNA-binding domain
domain: gamma,delta resolvase (C-terminal domain)
species: Escherichia coli [TaxId: 562]
Probab=97.00  E-value=0.00029  Score=46.68  Aligned_cols=28  Identities=32%  Similarity=0.676  Sum_probs=25.2

Q ss_pred             HHHHHHHHHCCCCHHHHHHHHCCCCHHHH
Q ss_conf             99999999818658899999678543466
Q gi|254780431|r    8 IDKLKKFWSEGLSASQIAVQLGGVTRNAV   36 (178)
Q Consensus         8 ve~LkkLW~eG~SasqIA~~lGgvtRNAV   36 (178)
                      ++..++|+.+|+++++||++|| ++|..|
T Consensus         8 ~~~V~~L~~~G~gat~IAk~lg-I~R~SV   35 (43)
T d1gdta1           8 RDAVLNMWQQGLGASHISKTMN-IARSTV   35 (43)
T ss_dssp             HHHHHHHHHTTCCHHHHHHHHT-CCHHHH
T ss_pred             HHHHHHHHHCCCCHHHHHHHHC-CCHHHH
T ss_conf             9999999994898999999979-879999



>d1ijwc_ a.4.1.2 (C:) HIN recombinase (DNA-binding domain) {Synthetic} Back     information, alignment and structure
>d1s7oa_ a.4.13.3 (A:) Hypothetical protein SPy1201 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1xsva_ a.4.13.3 (A:) Hypothetical protein SAV1236 {Staphylococcus aureus, strain Mu50 / ATCC 700699 [TaxId: 1280]} Back     information, alignment and structure
>d1rp3a2 a.4.13.2 (A:164-234) Sigma factor sigma-28 (FliA) {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1a04a1 a.4.6.2 (A:150-216) Nitrate/nitrite response regulator (NarL) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target178 hypothetical protein CLIBASIA_01580 [Candidatus Liberib
1gdt_A_142-18342 GD resolvase, protein (gamma delta resolvase); pro 96.56
1jko_C_52 HIN recombinase, DNA-invertase HIN; water-mediated 95.98
2r0q_C_151-20959 Putative transposon TN552 DNA-invertase BIN3; site 94.97
1pdn_C_17-6953 Protein (PRD paired); protein-DNA complex, double 92.77
2k27_A_1-7575 Paired box protein PAX-8; paired domain, solution 91.6
2cfx_A_1-5555 HTH-type transcriptional regulator LRPC; transcrip 91.0
2oqg_A_1-7979 Possible transcriptional regulator, ARSR family pr 91.0
1u78_A_1-5353 TC3 transposase, transposable element TC3 transpos 90.56
1rp3_A_90-239150 RNA polymerase sigma factor sigma-28 (FLIA); trans 90.46
>1gdt_A (A:142-183) GD resolvase, protein (gamma delta resolvase); protein-DNA complex, double helix, overhanging base, DNA binding protein/DNA complex; 3.00A {Escherichia coli} Back     alignment and structure
Probab=96.56  E-value=0.0022  Score=43.44  Aligned_cols=29  Identities=31%  Similarity=0.645  Sum_probs=25.3

Q ss_pred             HHHHHHHHHCCCCHHHHHHHHCCCCHHHHH
Q ss_conf             999999998186588999996785434666
Q gi|254780431|r    8 IDKLKKFWSEGLSASQIAVQLGGVTRNAVI   37 (178)
Q Consensus         8 ve~LkkLW~eG~SasqIA~~lGgvtRNAVI   37 (178)
                      .+....|+.+|+++++||++|| ++|..|-
T Consensus         7 ~~~V~~L~~~G~g~t~IAk~Lg-I~R~sVY   35 (42)
T 1gdt_A            7 RDAVLNMWQQGLGASHISKTMN-IARSTVY   35 (42)
T ss_dssp             HHHHHHHHHTTCCHHHHHHHHT-CCHHHHH
T ss_pred             HHHHHHHHHCCCCHHHHHHHHC-CCHHHHH
T ss_conf             9999999987999999999989-2999999



>1jko_C (C:) HIN recombinase, DNA-invertase HIN; water-mediated recognition, protein-DNA complex, A10G mutant, DNA binding protein/DNA complex; 2.24A {Synthetic} Back     alignment and structure
>2r0q_C (C:151-209) Putative transposon TN552 DNA-invertase BIN3; site-specific recombinase, resolvase, DNA-binding protein, protein-DNA complex, DNA integration, DNA invertase, DNA recombination; 3.20A {Staphylococcus aureus} Back     alignment and structure
>1pdn_C (C:17-69) Protein (PRD paired); protein-DNA complex, double helix, PAX, paired domain, DNA-binding protein, gene regulation/DNA complex; HET: DNA; 2.50A {Drosophila melanogaster} Back     alignment and structure
>2k27_A (A:1-75) Paired box protein PAX-8; paired domain, solution structure, triple frequency, 3D NMR, induced FIT, alternative splicing, developmental protein; NMR {Homo sapiens} Back     alignment and structure
>2cfx_A (A:1-55) HTH-type transcriptional regulator LRPC; transcriptional regulation, DNA binding, FFRP; 2.4A {Bacillus subtilis} Back     alignment and structure
>2oqg_A (A:1-79) Possible transcriptional regulator, ARSR family protein; winged-helix-turn-helix, structural genomics, PSI-2, protein structure initiative; 1.54A {Rhodococcus SP} Back     alignment and structure
>1u78_A (A:1-53) TC3 transposase, transposable element TC3 transposase; transposon DNA, bipartite DNA-binding, HTH- motif, DNA binding protein/DNA complex; 2.69A {Caenorhabditis elegans} Back     alignment and structure
>1rp3_A (A:90-239) RNA polymerase sigma factor sigma-28 (FLIA); transcription; 2.30A {Aquifex aeolicus} Back     alignment and structure