254780432

254780432

acetylornithine transaminase protein

GeneID in NCBI database:8209418Locus tag:CLIBASIA_01585
Protein GI in NCBI database:254780432Protein Accession:YP_003064845.1
Gene range:+(338777, 339955)Protein Length:392aa
Gene description:acetylornithine transaminase protein
COG prediction:[E] Ornithine/acetylornithine aminotransferase
KEGG prediction:argD; acetylornithine transaminase protein (EC:2.6.1.11); K00821 acetylornithine/N-succinyldiaminopimelate aminotransferase [EC:2.6.1.11 2.6.1.17]
SEED prediction:Acetylornithine aminotransferase (EC 2.6.1.11)
Pathway involved in KEGG:Lysine biosynthesis [PATH:las00300]
Arginine and proline metabolism [PATH:las00330]
Subsystem involved in SEED:Arginine Biosynthesis extended
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390--
MNKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRILPPLTITAEEIHEGLERIERTAIKLSH
cccccEEEcccccccEEEEEccccEEEEccccEEEEHHHHHHHHccccccHHHHHHHHHHHHHcccccccccccHHHHHHHHHHccccccEEEEEccHHHHHHHHHHHHHHHHHHcccccccEEEEEEccccccHHHHHHHcccHHHHcccccccccccccccccHHHHHHHcccccEEEEEcccccccccccccHHHHHHHHHHHHHHccEEEEcccccccccccccccHHHccccccEEEEcHHHccccHHHEEEEcHHHHHHcccccccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEEEEEcccHHHHHHHHHHccEEEEEccccEEEEEccccccHHHHHHHHHHHHHHHHHHcc
cccccccccccccccEEEEccccEEEEcccccEEEEHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccccEEEcccHHHHHHHHHHHHHHHHHHHcccccEEEEEEEccccccEEEEEEcccccHHcccccccccccEEEccccHHHHHHHccccEEEEEEcccEcccccEcccccHHHHHHHHHHHcccEEEEEcccccccccccccHHHHHcccccEEEEcHHHHcccccEEEEEcHHHHHHcccccccccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHccccEEEEEEccccHHHHHHHHHHcccEEEcccccEEEEccccEEcHHHHHHHHHHHHHHHHHHcc
mnkndflfntydqsdirfekgkgawlfsengipfldfasgiavnslghSHPELVAILKSQSEKLWHVSNLYQSTQQEIFANHlihstfadrvfftnsgaESVECAIKTARRYHYMAGKTNKFRIVTfegafhgrtlatisaggklqylegfgpkiegfdqakfcdlqslknqisNDTAAILIepiqgeggvrkvPEEFLQQLRKICDDIDALLIFDevqtgygrtgKLFAYEWANVKPDIMTIAkgmgggfpigaclatNEVAAcmnqgshgstyggNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFrdeclltapssdnvvrilppltitAEEIHEGLERIERTAIKLSH
mnkndflfntydqsdiRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLltapssdnvvrilPPLTITAEEIHEGLERIERTAIKLSH
MNKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRILPPLTITAEEIHEGLERIERTAIKLSH
**KNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRILPPLTITAEEIHEGLERIERTAIKLS*
MNKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRILPPLTITAEEIHEGLERIERTAIKLSH
***NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRILPPLTITAEEIHEGLERIERTAIKLS*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRILPPLTITAEEIHEGLERIERTAIKLSH
MNKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRILPPLTITAEEIHEGLERIERTAIKLSH
MNKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRILPPLTITAEEIHEGLERIERTAIKLSH

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target392 acetylornithine transaminase protein [Candidatus Liberi
254780488423 adenosylmethionine--8-amino-7-oxononanoate transam 7e-34
>gi|254780488|ref|YP_003064901.1| adenosylmethionine--8-amino-7-oxononanoate transaminase [Candidatus Liberibacter asiaticus str. psy62] Length = 423 Back     alignment
 Score =  136 bits (342), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 109/384 (28%), Positives = 183/384 (47%), Gaps = 31/384 (8%)

Query: 20  KGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVS-NLYQSTQQEI 78
           K +G++L  EN    +D  S   V + GH HP ++  ++S SE    +  + Y     E 
Sbjct: 28  KTEGSYLIDENHDKIIDAISSWWVITHGHRHPIIMNAIRSASENYDQIIFSEYTHEPAEQ 87

Query: 79  FANHLIH--STFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTL 136
            A  LI         VFF++SG+ S+E A+K A  + +      + +IV  E  +HG T+
Sbjct: 88  LARLLIKIAPLGLQYVFFSDSGSTSIEVALKMALGF-FNNNNMPRNKIVVMEHGYHGDTI 146

Query: 137 ATISAGGKLQYLEGFGPKIEGFDQAKFCD-------LQSLKNQISNDT-AAILIEP-IQG 187
            ++S   +  +   + P +   +   F         L  L+   S    AA L+EP I G
Sbjct: 147 GSMSVSMRGAFNNSYEPLLFDVETIPFPHHNEEQKTLDDLEKHCSTQKIAAFLVEPLILG 206

Query: 188 EGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGM 247
            GG++      L++  +I    D LLI DEV TG+GRTGK+FA   A++ PDI+ ++KG+
Sbjct: 207 AGGMQTYRPYILKEFMRITKKYDTLLIADEVMTGWGRTGKIFACNHADITPDILCLSKGI 266

Query: 248 -GGGFPIGACLATNEVAACMNQGS------HGSTYGGNVLAMVLGEKVLNIIQSDGFLEN 300
            GG  P+ A L + E+              H S+Y  N +A       L I + +  +E 
Sbjct: 267 TGGALPLAATLCSEEIFDSHLSSDKKKTFFHSSSYTANPIACAAALANLQIWEKEPVIER 326

Query: 301 VINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGL------KTVF--SPALLAAKFRDEC 352
           + N+ ++  + L+ +K+     F+ +R  G ++ L      K  F    A L   FR++ 
Sbjct: 327 IKNLERMHADRLSLLKSN--KKFVNIRQMGTIVALDFNVQNKGYFFDKNAKLKNFFREKK 384

Query: 353 LLTAPSSDNVVRILPPLTITAEEI 376
           +L  P   +++ ++PP  ITA ++
Sbjct: 385 ILIRPLG-HIMYLMPPYCITATDL 407

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target392 acetylornithine transaminase protein [Candidatus Liberi
315122120393 acetylornithine transaminase protein [Candidatus Liberi 1 0.0
15887775399 bifunctional N-succinyldiaminopimelate- aminotransferas 1 1e-140
239831153403 acetylornithine and succinylornithine aminotransferase 1 1e-140
153007739403 acetylornithine transaminase protein [Ochrobactrum anth 1 1e-139
325291861400 acetylornithine aminotransferase [Agrobacterium sp. H13 1 1e-139
163842586403 bifunctional N-succinyldiaminopimelate- aminotransferas 1 1e-138
17987904403 acetylornithine transaminase protein [Brucella melitens 1 1e-138
254718494403 acetylornithine transaminase protein [Brucella sp. 83/1 1 1e-138
254713118403 acetylornithine transaminase protein [Brucella ceti M64 1 1e-137
306844940403 acetylornithine and succinylornithine aminotransferase 1 1e-137
>gi|315122120|ref|YP_004062609.1| acetylornithine transaminase protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 393 Back     alignment and organism information
 Score =  681 bits (1758), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/391 (82%), Positives = 364/391 (93%)

Query: 1   MNKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQ 60
           MN +D LFNTYD++ IRF KGKG+WLFSE+G PFLDFASGIAVNSLGHSHPELV++LKSQ
Sbjct: 1   MNNSDCLFNTYDRAKIRFTKGKGSWLFSEDGTPFLDFASGIAVNSLGHSHPELVSVLKSQ 60

Query: 61  SEKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTN 120
           SEKLWHVSNLYQST+Q+IFANHLI+STFAD+VFFTNSG ESVECAIKTARRYHY  GKTN
Sbjct: 61  SEKLWHVSNLYQSTEQDIFANHLINSTFADKVFFTNSGTESVECAIKTARRYHYTRGKTN 120

Query: 121 KFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAI 180
           KFRIVTFEGAFHGR+LATISA GKL+YLEGFGPKIEGFDQAKFCDLQSL+  I N+TAAI
Sbjct: 121 KFRIVTFEGAFHGRSLATISASGKLKYLEGFGPKIEGFDQAKFCDLQSLEKIIGNETAAI 180

Query: 181 LIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDI 240
           LIEPIQGEGG+RKVP EFLQ+LR+IC++IDALLIFDE+QTG GRTGKLFAYEWA+VKPDI
Sbjct: 181 LIEPIQGEGGIRKVPPEFLQKLREICNNIDALLIFDEIQTGSGRTGKLFAYEWADVKPDI 240

Query: 241 MTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLEN 300
           MTIAKG+GGGFP+GACLAT++VA+CM  GSHGSTYGGNVLAMV+G+KVL+IIQSDGFLEN
Sbjct: 241 MTIAKGLGGGFPVGACLATHKVASCMGMGSHGSTYGGNVLAMVIGKKVLDIIQSDGFLEN 300

Query: 301 VINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSD 360
           V N++KILFEGLT IKNRFPN+FLEVRGQGLL GL+T FSPA++  + R+E LLTAP+S+
Sbjct: 301 VRNLSKILFEGLTLIKNRFPNVFLEVRGQGLLSGLETAFSPAIVTKELRNERLLTAPASN 360

Query: 361 NVVRILPPLTITAEEIHEGLERIERTAIKLS 391
           NVVRILPPLT+TA+EI EGL+RIE  AIKLS
Sbjct: 361 NVVRILPPLTVTADEIREGLKRIESAAIKLS 391


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|15887775|ref|NP_353456.1| bifunctional N-succinyldiaminopimelate- aminotransferase/acetylornithine transaminase protein [Agrobacterium tumefaciens str. C58] Length = 399 Back     alignment and organism information
>gi|239831153|ref|ZP_04679482.1| acetylornithine and succinylornithine aminotransferase [Ochrobactrum intermedium LMG 3301] Length = 403 Back     alignment and organism information
>gi|153007739|ref|YP_001368954.1| acetylornithine transaminase protein [Ochrobactrum anthropi ATCC 49188] Length = 403 Back     alignment and organism information
>gi|325291861|ref|YP_004277725.1| acetylornithine aminotransferase [Agrobacterium sp. H13-3] Length = 400 Back     alignment and organism information
>gi|163842586|ref|YP_001626990.1| bifunctional N-succinyldiaminopimelate- aminotransferase/acetylornithine transaminase protein [Brucella suis ATCC 23445] Length = 403 Back     alignment and organism information
>gi|17987904|ref|NP_540538.1| acetylornithine transaminase protein [Brucella melitensis bv. 1 str. 16M] Length = 403 Back     alignment and organism information
>gi|254718494|ref|ZP_05180305.1| acetylornithine transaminase protein [Brucella sp. 83/13] Length = 403 Back     alignment and organism information
>gi|254713118|ref|ZP_05174929.1| acetylornithine transaminase protein [Brucella ceti M644/93/1] Length = 403 Back     alignment and organism information
>gi|306844940|ref|ZP_07477521.1| acetylornithine and succinylornithine aminotransferase [Brucella sp. BO1] Length = 403 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target392 acetylornithine transaminase protein [Candidatus Liberi
PRK01278389 PRK01278, argD, acetylornithine transaminase protein; P 0.0
PRK02627396 PRK02627, PRK02627, acetylornithine aminotransferase; P 1e-145
TIGR00707379 TIGR00707, argD, acetylornithine and succinylornithine 1e-124
PRK05093403 PRK05093, argD, bifunctional N-succinyldiaminopimelate- 1e-116
cd00610413 cd00610, OAT_like, Acetyl ornithine aminotransferase fa 1e-114
TIGR03246397 TIGR03246, arg_catab_astC, succinylornithine transamina 1e-108
PRK02936377 PRK02936, argD, acetylornithine aminotransferase; Provi 1e-103
PRK12381406 PRK12381, PRK12381, bifunctional succinylornithine tran 1e-102
PRK03244398 PRK03244, argD, acetylornithine aminotransferase; Provi 1e-95
PTZ00125400 PTZ00125, PTZ00125, ornithine aminotransferase-like pro 2e-95
PLN00144382 PLN00144, PLN00144, acetylornithine transaminase 5e-95
COG0160447 COG0160, GabT, 4-aminobutyrate aminotransferase and rel 1e-91
PRK04260375 PRK04260, PRK04260, acetylornithine aminotransferase; P 2e-89
PRK03715395 PRK03715, argD, acetylornithine transaminase protein; P 7e-89
PRK05769441 PRK05769, PRK05769, 4-aminobutyrate aminotransferase; P 1e-86
PRK04612408 PRK04612, argD, acetylornithine transaminase protein; P 2e-83
TIGR01885401 TIGR01885, Orn_aminotrans, ornithine aminotransferase 5e-81
PRK08117433 PRK08117, PRK08117, 4-aminobutyrate aminotransferase; P 1e-80
PRK04073396 PRK04073, rocD, ornithine--oxo-acid transaminase; Provi 9e-78
KOG1401433 KOG1401, KOG1401, KOG1401, Acetylornithine aminotransfe 2e-77
KOG1402427 KOG1402, KOG1402, KOG1402, Ornithine aminotransferase [ 3e-77
PLN02624474 PLN02624, PLN02624, ornithine-delta-aminotransferase 7e-77
COG0161449 COG0161, BioA, Adenosylmethionine-8-amino-7-oxononanoat 9e-75
KOG1404442 KOG1404, KOG1404, KOG1404, Alanine-glyoxylate aminotran 1e-70
PRK11522459 PRK11522, PRK11522, putrescine--2-oxoglutarate aminotra 8e-70
PRK00854401 PRK00854, rocD, ornithine--oxo-acid transaminase; Revie 1e-67
PRK04013364 PRK04013, argD, acetylornithine/acetyl-lysine aminotran 7e-65
PRK07495425 PRK07495, PRK07495, 4-aminobutyrate aminotransferase; P 4e-64
TIGR00700420 TIGR00700, GABAtrnsam, 4-aminobutyrate aminotransferase 2e-60
PRK05964423 PRK05964, PRK05964, adenosylmethionine--8-amino-7-oxono 4e-60
PRK06777421 PRK06777, PRK06777, 4-aminobutyrate aminotransferase; P 1e-59
PRK08088425 PRK08088, PRK08088, 4-aminobutyrate aminotransferase; V 9e-59
TIGR03372442 TIGR03372, putres_am_tran, putrescine aminotransferase 4e-58
PRK06918451 PRK06918, PRK06918, 4-aminobutyrate aminotransferase; R 1e-57
PRK09264425 PRK09264, PRK09264, diaminobutyrate--2-oxoglutarate ami 4e-55
PRK08297443 PRK08297, PRK08297, L-lysine aminotransferase; Provisio 2e-54
PRK06058443 PRK06058, PRK06058, 4-aminobutyrate aminotransferase; P 2e-54
PRK08360443 PRK08360, PRK08360, 4-aminobutyrate aminotransferase; P 1e-51
TIGR02407412 TIGR02407, ectoine_ectB, diaminobutyrate--2-oxoglutarat 1e-51
TIGR00709442 TIGR00709, dat, 2,4-diaminobutyrate 4-transaminases 2e-51
PRK07483443 PRK07483, PRK07483, hypothetical protein; Provisional 1e-50
TIGR03251431 TIGR03251, LAT_fam, L-lysine 6-transaminase 7e-50
PRK06062451 PRK06062, PRK06062, hypothetical protein; Provisional 1e-49
PRK09792421 PRK09792, PRK09792, 4-aminobutyrate transaminase; Provi 2e-49
PRK06917447 PRK06917, PRK06917, hypothetical protein; Provisional 1e-48
PRK06916460 PRK06916, PRK06916, adenosylmethionine--8-amino-7-oxono 3e-48
PRK07481449 PRK07481, PRK07481, hypothetical protein; Provisional 4e-48
PRK05639457 PRK05639, PRK05639, 4-aminobutyrate aminotransferase; P 2e-47
PRK13360442 PRK13360, PRK13360, omega amino acid--pyruvate transami 3e-46
PRK06931459 PRK06931, PRK06931, diaminobutyrate--2-oxoglutarate ami 4e-46
PRK06082459 PRK06082, PRK06082, 4-aminobutyrate aminotransferase; P 2e-45
PRK07678451 PRK07678, PRK07678, aminotransferase; Validated 7e-45
PRK07030466 PRK07030, PRK07030, adenosylmethionine--8-amino-7-oxono 3e-44
PRK06541460 PRK06541, PRK06541, hypothetical protein; Provisional 3e-44
PRK06938464 PRK06938, PRK06938, diaminobutyrate--2-oxoglutarate ami 2e-43
PRK08593445 PRK08593, PRK08593, 4-aminobutyrate aminotransferase; P 2e-42
PRK06105460 PRK06105, PRK06105, aminotransferase; Provisional 6e-42
PRK061481013 PRK06148, PRK06148, hypothetical protein; Provisional 9e-41
PRK07480456 PRK07480, PRK07480, putative aminotransferase; Validate 1e-40
PLN02760504 PLN02760, PLN02760, 4-aminobutyrate:pyruvate transamina 1e-38
PRK05965459 PRK05965, PRK05965, hypothetical protein; Provisional 3e-38
PRK07036466 PRK07036, PRK07036, hypothetical protein; Provisional 5e-38
PRK06173429 PRK06173, PRK06173, adenosylmethionine--8-amino-7-oxono 4e-36
PRK08742472 PRK08742, PRK08742, adenosylmethionine--8-amino-7-oxono 7e-35
KOG1405484 KOG1405, KOG1405, KOG1405, 4-aminobutyrate aminotransfe 1e-34
KOG1403452 KOG1403, KOG1403, KOG1403, Predicted alanine-glyoxylate 6e-34
PRK06149972 PRK06149, PRK06149, hypothetical protein; Provisional 4e-33
TIGR00699464 TIGR00699, GABAtrns_euk, 4-aminobutyrate aminotransfera 1e-29
PRK06943453 PRK06943, PRK06943, adenosylmethionine--8-amino-7-oxono 2e-28
PRK07482461 PRK07482, PRK07482, hypothetical protein; Provisional 1e-25
COG4992404 COG4992, ArgD, Ornithine/acetylornithine aminotransfera 1e-139
pfam00202338 pfam00202, Aminotran_3, Aminotransferase class-III 4e-96
PRK09221445 PRK09221, PRK09221, beta alanine--pyruvate transaminase 3e-44
COG0001432 COG0001, HemL, Glutamate-1-semialdehyde aminotransferas 3e-42
PRK05630422 PRK05630, PRK05630, adenosylmethionine--8-amino-7-oxono 2e-39
TIGR00713423 TIGR00713, hemL, glutamate-1-semialdehyde-2,1-aminomuta 2e-39
PRK00062426 PRK00062, PRK00062, glutamate-1-semialdehyde aminotrans 1e-37
PRK12403460 PRK12403, PRK12403, putative aminotransferase; Provisio 3e-34
PRK12389428 PRK12389, PRK12389, glutamate-1-semialdehyde aminotrans 3e-29
PLN02482474 PLN02482, PLN02482, glutamate-1-semialdehyde 2,1-aminom 8e-26
PRK00615433 PRK00615, PRK00615, glutamate-1-semialdehyde aminotrans 1e-17
TIGR00508427 TIGR00508, bioA, adenosylmethionine-8-amino-7-oxononano 3e-41
PRK07986428 PRK07986, PRK07986, adenosylmethionine--8-amino-7-oxono 9e-36
PRK06209431 PRK06209, PRK06209, glutamate-1-semialdehyde 2,1-aminom 3e-16
PLN02974817 PLN02974, PLN02974, adenosylmethionine-8-amino-7-oxonon 6e-13
cd01494170 cd01494, AAT_I, Aspartate aminotransferase (AAT) superf 1e-10
PRK07046453 PRK07046, PRK07046, aminotransferase; Validated 1e-09
COG0436393 COG0436, COG0436, Aspartate/tyrosine/aromatic aminotran 8e-05
>gnl|CDD|179270 PRK01278, argD, acetylornithine transaminase protein; Provisional Back     alignment and domain information
>gnl|CDD|179453 PRK02627, PRK02627, acetylornithine aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|162005 TIGR00707, argD, acetylornithine and succinylornithine aminotransferases Back     alignment and domain information
>gnl|CDD|179933 PRK05093, argD, bifunctional N-succinyldiaminopimelate- aminotransferase/acetylornithine transaminase protein; Reviewed Back     alignment and domain information
>gnl|CDD|99735 cd00610, OAT_like, Acetyl ornithine aminotransferase family Back     alignment and domain information
>gnl|CDD|132290 TIGR03246, arg_catab_astC, succinylornithine transaminase family Back     alignment and domain information
>gnl|CDD|179505 PRK02936, argD, acetylornithine aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|183486 PRK12381, PRK12381, bifunctional succinylornithine transaminase/acetylornithine transaminase; Provisional Back     alignment and domain information
>gnl|CDD|179555 PRK03244, argD, acetylornithine aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|185461 PTZ00125, PTZ00125, ornithine aminotransferase-like protein; Provisional Back     alignment and domain information
>gnl|CDD|177748 PLN00144, PLN00144, acetylornithine transaminase Back     alignment and domain information
>gnl|CDD|30509 COG0160, GabT, 4-aminobutyrate aminotransferase and related aminotransferases [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|179803 PRK04260, PRK04260, acetylornithine aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|179636 PRK03715, argD, acetylornithine transaminase protein; Provisional Back     alignment and domain information
>gnl|CDD|180248 PRK05769, PRK05769, 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|179868 PRK04612, argD, acetylornithine transaminase protein; Provisional Back     alignment and domain information
>gnl|CDD|130940 TIGR01885, Orn_aminotrans, ornithine aminotransferase Back     alignment and domain information
>gnl|CDD|181234 PRK08117, PRK08117, 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|179736 PRK04073, rocD, ornithine--oxo-acid transaminase; Provisional Back     alignment and domain information
>gnl|CDD|36615 KOG1401, KOG1401, KOG1401, Acetylornithine aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|36616 KOG1402, KOG1402, KOG1402, Ornithine aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|178231 PLN02624, PLN02624, ornithine-delta-aminotransferase Back     alignment and domain information
>gnl|CDD|30510 COG0161, BioA, Adenosylmethionine-8-amino-7-oxononanoate aminotransferase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|36618 KOG1404, KOG1404, KOG1404, Alanine-glyoxylate aminotransferase AGT2 [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|183175 PRK11522, PRK11522, putrescine--2-oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|167080 PRK00854, rocD, ornithine--oxo-acid transaminase; Reviewed Back     alignment and domain information
>gnl|CDD|101376 PRK04013, argD, acetylornithine/acetyl-lysine aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|181002 PRK07495, PRK07495, 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|129783 TIGR00700, GABAtrnsam, 4-aminobutyrate aminotransferase, prokaryotic type Back     alignment and domain information
>gnl|CDD|180329 PRK05964, PRK05964, adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>gnl|CDD|180690 PRK06777, PRK06777, 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|181227 PRK08088, PRK08088, 4-aminobutyrate aminotransferase; Validated Back     alignment and domain information
>gnl|CDD|132415 TIGR03372, putres_am_tran, putrescine aminotransferase Back     alignment and domain information
>gnl|CDD|180748 PRK06918, PRK06918, 4-aminobutyrate aminotransferase; Reviewed Back     alignment and domain information
>gnl|CDD|181737 PRK09264, PRK09264, diaminobutyrate--2-oxoglutarate aminotransferase; Validated Back     alignment and domain information
>gnl|CDD|181363 PRK08297, PRK08297, L-lysine aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|180372 PRK06058, PRK06058, 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|181401 PRK08360, PRK08360, 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|162844 TIGR02407, ectoine_ectB, diaminobutyrate--2-oxoglutarate aminotransferase Back     alignment and domain information
>gnl|CDD|129792 TIGR00709, dat, 2,4-diaminobutyrate 4-transaminases Back     alignment and domain information
>gnl|CDD|180996 PRK07483, PRK07483, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|132295 TIGR03251, LAT_fam, L-lysine 6-transaminase Back     alignment and domain information
>gnl|CDD|180376 PRK06062, PRK06062, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|182078 PRK09792, PRK09792, 4-aminobutyrate transaminase; Provisional Back     alignment and domain information
>gnl|CDD|180747 PRK06917, PRK06917, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|180746 PRK06916, PRK06916, adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>gnl|CDD|168967 PRK07481, PRK07481, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|168145 PRK05639, PRK05639, 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|183999 PRK13360, PRK13360, omega amino acid--pyruvate transaminase; Provisional Back     alignment and domain information
>gnl|CDD|180758 PRK06931, PRK06931, diaminobutyrate--2-oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|180390 PRK06082, PRK06082, 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|181078 PRK07678, PRK07678, aminotransferase; Validated Back     alignment and domain information
>gnl|CDD|180800 PRK07030, PRK07030, adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>gnl|CDD|180611 PRK06541, PRK06541, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|180764 PRK06938, PRK06938, diaminobutyrate--2-oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|181493 PRK08593, PRK08593, 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|180401 PRK06105, PRK06105, aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|180426 PRK06148, PRK06148, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|180994 PRK07480, PRK07480, putative aminotransferase; Validated Back     alignment and domain information
>gnl|CDD|178360 PLN02760, PLN02760, 4-aminobutyrate:pyruvate transaminase Back     alignment and domain information
>gnl|CDD|180330 PRK05965, PRK05965, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|168777 PRK07036, PRK07036, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|180441 PRK06173, PRK06173, adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>gnl|CDD|181545 PRK08742, PRK08742, adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>gnl|CDD|36619 KOG1405, KOG1405, KOG1405, 4-aminobutyrate aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|36617 KOG1403, KOG1403, KOG1403, Predicted alanine-glyoxylate aminotransferase [General function prediction only] Back     alignment and domain information
>gnl|CDD|180427 PRK06149, PRK06149, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|129782 TIGR00699, GABAtrns_euk, 4-aminobutyrate aminotransferase, eukaryotic type Back     alignment and domain information
>gnl|CDD|180767 PRK06943, PRK06943, adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>gnl|CDD|180995 PRK07482, PRK07482, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|34597 COG4992, ArgD, Ornithine/acetylornithine aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|143959 pfam00202, Aminotran_3, Aminotransferase class-III Back     alignment and domain information
>gnl|CDD|181707 PRK09221, PRK09221, beta alanine--pyruvate transaminase; Provisional Back     alignment and domain information
>gnl|CDD|30350 COG0001, HemL, Glutamate-1-semialdehyde aminotransferase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|180174 PRK05630, PRK05630, adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>gnl|CDD|162007 TIGR00713, hemL, glutamate-1-semialdehyde-2,1-aminomutase Back     alignment and domain information
>gnl|CDD|178834 PRK00062, PRK00062, glutamate-1-semialdehyde aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|171472 PRK12403, PRK12403, putative aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|183493 PRK12389, PRK12389, glutamate-1-semialdehyde aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|178100 PLN02482, PLN02482, glutamate-1-semialdehyde 2,1-aminomutase Back     alignment and domain information
>gnl|CDD|134334 PRK00615, PRK00615, glutamate-1-semialdehyde aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|161905 TIGR00508, bioA, adenosylmethionine-8-amino-7-oxononanoate transaminase Back     alignment and domain information
>gnl|CDD|181189 PRK07986, PRK07986, adenosylmethionine--8-amino-7-oxononanoate transaminase; Validated Back     alignment and domain information
>gnl|CDD|180471 PRK06209, PRK06209, glutamate-1-semialdehyde 2,1-aminomutase; Provisional Back     alignment and domain information
>gnl|CDD|178557 PLN02974, PLN02974, adenosylmethionine-8-amino-7-oxononanoate transaminase Back     alignment and domain information
>gnl|CDD|99742 cd01494, AAT_I, Aspartate aminotransferase (AAT) superfamily (fold type I) of pyridoxal phosphate (PLP)-dependent enzymes Back     alignment and domain information
>gnl|CDD|180807 PRK07046, PRK07046, aminotransferase; Validated Back     alignment and domain information
>gnl|CDD|30785 COG0436, COG0436, Aspartate/tyrosine/aromatic aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 392 acetylornithine transaminase protein [Candidatus Liberi
TIGR00707402 argD acetylornithine and succinylornithine aminotransfe 100.0
TIGR01885426 Orn_aminotrans ornithine--oxo-acid transaminase; InterP 100.0
COG4992404 ArgD Ornithine/acetylornithine aminotransferase [Amino 100.0
PRK02627398 acetylornithine aminotransferase; Provisional 100.0
PRK12381406 bifunctional succinylornithine transaminase/acetylornit 100.0
PRK05093403 argD bifunctional N-succinyldiaminopimelate-aminotransf 100.0
PRK01278389 argD bifunctional N-succinyldiaminopimelate-aminotransf 100.0
TIGR03246397 arg_catab_astC succinylornithine transaminase family. M 100.0
PTZ00125415 ornithine aminotransferase; Provisional 100.0
PRK04073396 rocD ornithine--oxo-acid transaminase; Provisional 100.0
PRK04612408 argD bifunctional N-succinyldiaminopimelate-aminotransf 100.0
PRK02936377 argD acetylornithine aminotransferase; Provisional 100.0
PRK00854404 rocD ornithine--oxo-acid transaminase; Reviewed 100.0
PRK03244398 argD acetylornithine aminotransferase; Provisional 100.0
PRK07030467 adenosylmethionine--8-amino-7-oxononanoate transaminase 100.0
PRK03715395 argD bifunctional N-succinyldiaminopimelate-aminotransf 100.0
COG0160447 GabT 4-aminobutyrate aminotransferase and related amino 100.0
PRK05965459 hypothetical protein; Provisional 100.0
PRK08593448 4-aminobutyrate aminotransferase; Provisional 100.0
PRK04260375 acetylornithine aminotransferase; Provisional 100.0
PRK07678451 aminotransferase; Validated 100.0
PRK07482461 hypothetical protein; Provisional 100.0
PRK06541460 hypothetical protein; Provisional 100.0
PRK061481015 hypothetical protein; Provisional 100.0
PRK11522468 putrescine--2-oxoglutarate aminotransferase; Provisiona 100.0
PRK08742472 adenosylmethionine--8-amino-7-oxononanoate transaminase 100.0
PRK07481448 hypothetical protein; Provisional 100.0
PRK06105460 aminotransferase; Provisional 100.0
cd00610413 OAT_like Acetyl ornithine aminotransferase family. This 100.0
PRK07495422 4-aminobutyrate aminotransferase; Provisional 100.0
PRK13360441 omega amino acid--pyruvate transaminase; Provisional 100.0
PRK09221445 beta alanine--pyruvate transaminase; Provisional 100.0
PRK06916462 adenosylmethionine--8-amino-7-oxononanoate transaminase 100.0
PRK06943452 adenosylmethionine--8-amino-7-oxononanoate transaminase 100.0
PRK07323443 consensus 100.0
PRK07480459 putative aminotransferase; Validated 100.0
PRK08360443 4-aminobutyrate aminotransferase; Provisional 100.0
PRK05769442 4-aminobutyrate aminotransferase; Provisional 100.0
PRK05964421 adenosylmethionine--8-amino-7-oxononanoate transaminase 100.0
PRK08117429 4-aminobutyrate aminotransferase; Provisional 100.0
PRK07036466 hypothetical protein; Provisional 100.0
PRK06058446 4-aminobutyrate aminotransferase; Provisional 100.0
PRK06917447 hypothetical protein; Provisional 100.0
PRK06918454 4-aminobutyrate aminotransferase; Reviewed 100.0
COG0161449 BioA Adenosylmethionine-8-amino-7-oxononanoate aminotra 100.0
PRK08088426 4-aminobutyrate aminotransferase; Validated 100.0
PRK06777421 4-aminobutyrate aminotransferase; Provisional 100.0
PRK07894430 consensus 100.0
PRK07483443 hypothetical protein; Provisional 100.0
PRK06082460 4-aminobutyrate aminotransferase; Provisional 100.0
PRK05639457 4-aminobutyrate aminotransferase; Provisional 100.0
PRK06173429 adenosylmethionine--8-amino-7-oxononanoate transaminase 100.0
PRK06931454 diaminobutyrate--2-oxoglutarate aminotransferase; Provi 100.0
PRK06149972 hypothetical protein; Provisional 100.0
PRK09044418 consensus 100.0
PRK09264426 diaminobutyrate--2-oxoglutarate aminotransferase; Valid 100.0
PRK08555443 consensus 100.0
PRK06062434 hypothetical protein; Provisional 100.0
PRK08466430 consensus 100.0
PRK06938464 diaminobutyrate--2-oxoglutarate aminotransferase; Provi 100.0
PRK05630423 adenosylmethionine--8-amino-7-oxononanoate transaminase 100.0
PRK09792421 PLP-dependent GABA aminotransferase; Provisional 100.0
PRK12403460 putative aminotransferase; Provisional 100.0
PRK07986428 adenosylmethionine--8-amino-7-oxononanoate transaminase 100.0
PRK04013364 argD acetylornithine/acetyl-lysine aminotransferase; Pr 100.0
TIGR03372442 putres_am_tran putrescine aminotransferase. Members of 100.0
TIGR02407413 ectoine_ectB diaminobutyrate--2-oxoglutarate aminotrans 100.0
PRK08297449 L-lysine aminotransferase; Provisional 100.0
KOG1402427 consensus 100.0
TIGR00700427 GABAtrnsam 4-aminobutyrate transaminase; InterPro: IPR0 100.0
TIGR03251431 LAT_fam L-lysine 6-transaminase. Characterized members 100.0
PRK00062429 glutamate-1-semialdehyde aminotransferase; Provisional 100.0
KOG1404442 consensus 100.0
PRK12389429 glutamate-1-semialdehyde aminotransferase; Provisional 100.0
PRK06942425 glutamate-1-semialdehyde 2,1-aminomutase; Validated 100.0
PRK00615433 glutamate-1-semialdehyde aminotransferase; Provisional 100.0
PRK07046452 aminotransferase; Validated 100.0
KOG1401433 consensus 100.0
PRK06209431 glutamate-1-semialdehyde 2,1-aminomutase; Provisional 100.0
TIGR00713434 hemL glutamate-1-semialdehyde-2,1-aminomutase; InterPro 100.0
TIGR00709445 dat 2,4-diaminobutyrate 4-transaminase; InterPro: IPR00 100.0
COG0001432 HemL Glutamate-1-semialdehyde aminotransferase [Coenzym 100.0
KOG1403452 consensus 100.0
TIGR00699469 GABAtrns_euk 4-aminobutyrate aminotransferase; InterPro 100.0
KOG1405484 consensus 100.0
TIGR00508466 bioA adenosylmethionine-8-amino-7-oxononanoate transami 100.0
PRK06939395 2-amino-3-ketobutyrate coenzyme A ligase; Provisional 99.97
PRK05958387 8-amino-7-oxononanoate synthase; Reviewed 99.97
TIGR00858378 bioF 8-amino-7-oxononanoate synthase; InterPro: IPR0047 99.96
PRK13392410 5-aminolevulinate synthase; Provisional 99.96
PRK07505405 hypothetical protein; Provisional 99.95
PRK13393404 5-aminolevulinate synthase; Provisional 99.95
PRK09064406 5-aminolevulinate synthase; Validated 99.95
PRK07179408 hypothetical protein; Provisional 99.95
TIGR01821427 5aminolev_synth 5-aminolevulinic acid synthase; InterPr 99.94
COG0156388 BioF 7-keto-8-aminopelargonate synthetase and related e 99.93
TIGR01825392 gly_Cac_T_rel pyridoxal phosphate-dependent acyltransfe 99.92
PRK05937370 8-amino-7-oxononanoate synthase; Provisional 99.91
TIGR01822395 2am3keto_CoA 2-amino-3-ketobutyrate coenzyme A ligase; 99.91
PRK07212378 consensus 99.77
PRK05764389 aspartate aminotransferase; Provisional 99.76
PRK07367385 consensus 99.75
PRK05957389 aspartate aminotransferase; Provisional 99.74
PRK08361390 aspartate aminotransferase; Provisional 99.73
TIGR03392398 FeS_syn_CsdA cysteine desulfurase, catalytic subunit Cs 99.73
PRK06056402 consensus 99.72
PRK10874401 cysteine sulfinate desulfinase; Provisional 99.72
PRK05794397 consensus 99.72
KOG1359417 consensus 99.72
PRK07778386 consensus 99.72
PRK05942394 aspartate aminotransferase; Provisional 99.72
PRK07683387 aminotransferase A; Validated 99.72
PRK08443388 consensus 99.72
PRK06375381 consensus 99.71
PRK08362389 consensus 99.71
PRK08069390 consensus 99.7
PRK06107402 aspartate aminotransferase; Provisional 99.69
PRK07337388 aminotransferase; Validated 99.69
PRK07550387 hypothetical protein; Provisional 99.68
PRK06108382 aspartate aminotransferase; Provisional 99.68
PRK07682378 hypothetical protein; Validated 99.68
PRK09276385 aspartate aminotransferase; Provisional 99.68
PRK07568396 aspartate aminotransferase; Provisional 99.68
PRK06575399 consensus 99.68
PRK07681399 aspartate aminotransferase; Provisional 99.67
PRK07543400 consensus 99.67
PRK07366388 succinyldiaminopimelate transaminase; Validated 99.67
PRK09148406 aminotransferase; Validated 99.67
PRK06290411 aspartate aminotransferase; Provisional 99.67
PRK05166374 histidinol-phosphate aminotransferase; Provisional 99.67
PRK08912387 hypothetical protein; Provisional 99.66
PRK09295406 selenocysteine lyase; Validated 99.66
PRK08960387 hypothetical protein; Provisional 99.66
PRK07310395 consensus 99.66
TIGR03540383 DapC_direct LL-diaminopimelate aminotransferase. This c 99.66
PRK08068389 transaminase; Reviewed 99.65
PRK00950369 histidinol-phosphate aminotransferase; Validated 99.65
PRK06207406 aspartate aminotransferase; Provisional 99.65
PRK07777386 aminotransferase; Validated 99.65
PRK08175395 aminotransferase; Validated 99.65
PRK06220384 consensus 99.65
TIGR03538394 DapC_gpp succinyldiaminopimelate transaminase. This fam 99.64
PRK08636403 aspartate aminotransferase; Provisional 99.64
PRK06507400 consensus 99.64
PRK09147397 aminotransferase; Provisional 99.63
PRK06358354 threonine-phosphate decarboxylase; Provisional 99.59
PRK04152364 consensus 99.59
PRK07309390 aromatic amino acid aminotransferase; Validated 99.58
PRK08363398 alanine aminotransferase; Validated 99.58
TIGR03539357 DapC_actino succinyldiaminopimelate transaminase. This 99.57
PRK01533366 histidinol-phosphate aminotransferase; Validated 99.56
PRK07865364 N-succinyldiaminopimelate aminotransferase; Reviewed 99.54
PRK07392358 threonine-phosphate decarboxylase; Validated 99.53
PRK12414384 putative aminotransferase; Provisional 99.53
PRK09265404 aminotransferase AlaT; Validated 99.52
PRK08056356 threonine-phosphate decarboxylase; Provisional 99.51
PRK09105374 putative aminotransferase; Provisional 99.49
COG0520405 csdA Selenocysteine lyase/Cysteine desulfurase [Posttra 99.47
PRK07590409 L,L-diaminopimelate aminotransferase; Validated 99.47
PRK04870356 histidinol-phosphate aminotransferase; Provisional 99.45
PRK05839376 hypothetical protein; Provisional 99.45
TIGR03542402 DAPAT_plant LL-diaminopimelate aminotransferase. This c 99.43
PRK02610369 histidinol-phosphate aminotransferase; Provisional 99.42
PRK05387353 histidinol-phosphate aminotransferase; Provisional 99.41
PRK13355518 bifunctional HTH-domain containing protein/aminotransfe 99.32
PRK07908346 hypothetical protein; Provisional 99.28
PRK06959339 putative threonine-phosphate decarboxylase; Provisional 99.23
PRK06855433 aminotransferase; Validated 99.22
KOG1358467 consensus 99.22
PRK05664330 threonine-phosphate decarboxylase; Reviewed 99.21
COG1168388 MalY Bifunctional PLP-dependent enzyme with beta-cystat 99.19
COG1167459 ARO8 Transcriptional regulators containing a DNA-bindin 99.16
PRK03967337 histidinol-phosphate aminotransferase; Provisional 99.11
KOG1549428 consensus 98.88
TIGR01979409 sufS cysteine desulfurases, SufS subfamily; InterPro: I 98.68
cd00617431 Tnase_like Tryptophanase family (Tnase). This family be 98.68
COG3844407 Kynureninase [Amino acid transport and metabolism] 98.63
PRK13237459 tyrosine phenol-lyase; Provisional 98.61
PRK13238461 tnaA tryptophanase; Provisional 98.52
COG3033471 TnaA Tryptophanase [Amino acid transport and metabolism 98.09
TIGR01140349 CobD L-threonine-O-3-phosphate decarboxylase, putative; 97.82
TIGR01437391 selA_rel pyridoxal phosphate-dependent enzyme, putative 97.15
KOG1383491 consensus 96.44
TIGR02617468 tnaA_trp_ase tryptophanase; InterPro: IPR013440 Protein 95.89
pfam00202338 Aminotran_3 Aminotransferase class-III. 100.0
TIGR03235354 DNA_S_dndA cysteine desulfurase DndA. This model descri 98.99
KOG0257420 consensus 98.08
cd06454349 KBL_like KBL_like; this family belongs to the pyridoxal 99.96
PRK06225375 aspartate aminotransferase; Provisional 99.78
cd06453373 SufS_like Cysteine desulfurase (SufS)-like. This family 99.74
pfam00155351 Aminotran_1_2 Aminotransferase class I and II. 99.72
PRK06348383 aspartate aminotransferase; Provisional 99.71
PRK03566365 consensus 99.7
PRK02731367 histidinol-phosphate aminotransferase; Validated 99.69
KOG1360570 consensus 99.68
PRK03321352 putative aminotransferase; Provisional 99.68
TIGR03537350 DapC succinyldiaminopimelate transaminase. Note: the de 99.68
PRK03158359 histidinol-phosphate aminotransferase; Provisional 99.66
pfam00266371 Aminotran_5 Aminotransferase class-V. This domain is fo 99.64
PRK09440416 avtA valine--pyruvate transaminase; Provisional 99.62
TIGR03403382 nifS_epsilon cysteine desulfurase, NifS family, epsilon 99.61
cd00609350 AAT_like Aspartate aminotransferase family. This family 99.61
PRK09082386 putative aminotransferase; Validated 99.61
cd06502338 TA_like Low-specificity threonine aldolase (TA). This f 99.59
PRK06836396 aspartate aminotransferase; Provisional 99.54
TIGR03402379 FeS_nifS cysteine desulfurase NifS. Members of this pro 99.54
PRK10534333 L-threonine aldolase; Provisional 99.53
COG0436393 Aspartate/tyrosine/aromatic aminotransferase [Amino aci 99.52
PRK08153370 histidinol-phosphate aminotransferase; Provisional 99.51
PRK02948381 cysteine desulfurase; Provisional 99.5
PRK03317369 histidinol-phosphate aminotransferase; Provisional 99.49
COG1104386 NifS Cysteine sulfinate desulfinase/cysteine desulfuras 99.46
cd06452361 SepCysS Sep-tRNA:Cys-tRNA synthase. This family belongs 99.37
PRK13479368 2-aminoethylphosphonate--pyruvate transaminase; Provisi 99.34
PRK08354312 putative aminotransferase; Provisional 99.33
TIGR03301355 PhnW-AepZ 2-aminoethylphosphonate aminotransferase. Thi 99.32
TIGR01141377 hisC histidinol-phosphate aminotransferase; InterPro: I 99.29
KOG1368384 consensus 99.29
COG2008342 GLY1 Threonine aldolase [Amino acid transport and metab 99.29
COG0079356 HisC Histidinol-phosphate/aromatic aminotransferase and 99.27
TIGR03588380 PseC UDP-4-keto-6-deoxy-N-acetylglucosamine 4-aminotran 99.23
TIGR01977384 am_tr_V_EF2568 cysteine desulfurase family protein; Int 99.19
PRK11706375 TDP-4-oxo-6-deoxy-D-glucose transaminase; Provisional 99.19
PRK06425332 histidinol-phosphate aminotransferase; Validated 99.17
PRK04311465 selenocysteine synthase; Provisional 99.16
PRK11658379 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotran 99.16
PRK04366490 glycine dehydrogenase subunit 2; Validated 99.15
pfam01041363 DegT_DnrJ_EryC1 DegT/DnrJ/EryC1/StrS aminotransferase f 99.13
TIGR01265424 tyr_nico_aTase tyrosine/nicotianamine aminotransferases 99.13
PRK07504397 O-succinylhomoserine sulfhydrylase; Reviewed 99.1
cd00616352 AHBA_syn 3-amino-5-hydroxybenzoic acid synthase family 99.1
COG0075383 Serine-pyruvate aminotransferase/archaeal aspartate ami 99.07
COG2873426 MET17 O-acetylhomoserine sulfhydrylase [Amino acid tran 99.07
PRK00451449 glycine dehydrogenase subunit 1; Validated 98.99
PRK09331386 Sep-tRNA:Cys-tRNA synthetase; Provisional 98.94
PRK13520375 L-tyrosine decarboxylase; Provisional 98.93
COG0399374 WecE Predicted pyridoxal phosphate-dependent enzyme app 98.83
KOG0259447 consensus 98.7
cd00613398 GDC-P Glycine cleavage system P-protein, alpha- and bet 98.68
KOG2862385 consensus 98.57
TIGR01264415 tyr_amTase_E tyrosine aminotransferase; InterPro: IPR00 98.52
COG0403450 GcvP Glycine cleavage system protein P (pyridoxal-bindi 98.15
TIGR02080383 O_succ_thio_ly O-succinylhomoserine (thiol)-lyase; Inte 97.86
COG1103382 Archaea-specific pyridoxal phosphate-dependent enzymes 97.63
KOG3846465 consensus 97.6
COG0112413 GlyA Glycine/serine hydroxymethyltransferase [Amino aci 97.54
PRK09257397 aromatic amino acid aminotransferase; Provisional 97.51
TIGR02006404 IscS cysteine desulfurase IscS; InterPro: IPR010240 Thi 97.22
TIGR01814444 kynureninase kynureninase; InterPro: IPR010111 This ent 96.93
pfam02347429 GDC-P Glycine cleavage system P-protein. This family co 96.51
TIGR01976410 am_tr_V_VC1184 cysteine desulfurase family protein; Int 95.88
PRK12566 954 glycine dehydrogenase; Provisional 93.29
PRK07324373 transaminase; Validated 99.74
cd06451356 AGAT_like Alanine-glyoxylate aminotransferase (AGAT) fa 99.53
PRK08247366 cystathionine gamma-synthase; Reviewed 99.21
PRK08249398 cystathionine gamma-synthase; Provisional 99.18
PRK05967392 cystathionine beta-lyase; Provisional 99.17
PRK09028394 cystathionine beta-lyase; Provisional 99.17
TIGR01326434 OAH_OAS_sulfhy O-acetylhomoserine aminocarboxypropyltra 99.17
PRK04781362 histidinol-phosphate aminotransferase; Provisional 99.16
PRK04635346 histidinol-phosphate aminotransferase; Provisional 99.16
PRK07503403 methionine gamma-lyase; Provisional 99.16
PRK06176379 cystathionine gamma-synthase/cystathionine beta-lyase; 99.13
PRK06460375 hypothetical protein; Provisional 99.11
PRK07811386 cystathionine gamma-synthase; Provisional 99.11
PRK06234399 methionine gamma-lyase; Provisional 99.1
PRK08045386 cystathionine gamma-synthase; Provisional 99.1
PRK08064390 cystathionine beta-lyase; Provisional 99.09
cd00614369 CGS_like CGS_like: Cystathionine gamma-synthase is a PL 99.08
PRK07671377 cystathionine beta-lyase; Provisional 99.08
PRK08861388 cystathionine gamma-synthase; Provisional 99.06
PRK08114395 cystathionine beta-lyase; Provisional 99.05
PRK06767386 methionine gamma-lyase; Provisional 99.03
PRK08133391 O-succinylhomoserine sulfhydrylase; Validated 99.02
PRK07050394 cystathionine beta-lyase; Provisional 99.01
PRK07582370 cystathionine gamma-lyase; Validated 99.0
PRK01688355 histidinol-phosphate aminotransferase; Provisional 99.0
PRK05968389 hypothetical protein; Provisional 99.0
PRK07269364 cystathionine gamma-synthase; Reviewed 98.99
pfam01053381 Cys_Met_Meta_PP Cys/Met metabolism PLP-dependent enzyme 98.94
PRK03262355 consensus 98.92
PRK08574384 cystathionine gamma-synthase; Provisional 98.88
PRK07049427 methionine gamma-lyase; Validated 98.75
COG1003496 GcvP Glycine cleavage system protein P (pyridoxal-bindi 98.6
COG0626396 MetC Cystathionine beta-lyases/cystathionine gamma-synt 98.56
PRK12566954 glycine dehydrogenase; Provisional 98.56
PRK05367955 glycine dehydrogenase; Provisional 98.54
cd06450345 DOPA_deC_like DOPA decarboxylase family. This family be 98.48
PRK06434384 cystathionine gamma-lyase; Validated 98.47
KOG0256471 consensus 98.27
PTZ00094450 serine hydroxymethyltransferase; Provisional 98.26
PRK13034422 serine hydroxymethyltransferase; Reviewed 98.11
cd00378402 SHMT Serine-glycine hydroxymethyltransferase (SHMT). Th 98.08
PRK00011415 glyA serine hydroxymethyltransferase; Reviewed 98.05
pfam01276417 OKR_DC_1 Orn/Lys/Arg decarboxylase, major domain. 98.01
pfam00464380 SHMT Serine hydroxymethyltransferase. 97.93
KOG20401001 consensus 97.92
PRK13580493 serine hydroxymethyltransferase; Provisional 97.92
TIGR01328392 met_gam_lyase methionine gamma-lyase; InterPro: IPR0062 97.84
TIGR02326366 transamin_PhnW 2-aminoethylphosphonate--pyruvate transa 97.79
TIGR02539381 SepCysS Sep-tRNA:Cys-tRNA synthase; InterPro: IPR013375 97.75
KOG0633375 consensus 96.43
TIGR00461965 gcvP glycine dehydrogenase; InterPro: IPR003437 This fa 93.05
PRK05367 955 glycine dehydrogenase; Provisional 92.24
cd01494170 AAT_I Aspartate aminotransferase (AAT) superfamily (fol 99.33
PRK08134433 O-acetylhomoserine aminocarboxypropyltransferase; Valid 99.04
PRK05994426 O-acetylhomoserine aminocarboxypropyltransferase; Valid 99.04
PRK08248431 O-acetylhomoserine aminocarboxypropyltransferase; Valid 98.97
PRK07812436 O-acetylhomoserine aminocarboxypropyltransferase; Valid 98.94
PRK05613437 O-acetylhomoserine aminocarboxypropyltransferase; Valid 98.9
PRK06084424 O-acetylhomoserine aminocarboxypropyltransferase; Valid 98.88
PRK06702432 O-acetylhomoserine aminocarboxypropyltransferase; Valid 98.84
PRK05939396 hypothetical protein; Provisional 98.8
pfam00282370 Pyridoxal_deC Pyridoxal-dependent decarboxylase conserv 96.52
KOG1357519 consensus 99.19
COG3977417 Alanine-alpha-ketoisovalerate (or valine-pyruvate) amin 98.24
TIGR03531444 selenium_SpcS O-phosphoseryl-tRNA(Sec) selenium transfe 97.45
pfam05889389 SLA_LP_auto_ag Soluble liver antigen/liver pancreas ant 97.17
COG1448396 TyrB Aspartate/tyrosine/aromatic aminotransferase [Amin 96.69
pfam04864363 Alliinase_C Allinase. Allicin is a thiosulphinate that 91.8
KOG0258475 consensus 91.01
PRK07810406 O-succinylhomoserine sulfhydrylase; Provisional 99.06
TIGR01325386 O_suc_HS_sulf O-succinylhomoserine sulfhydrylase; Inter 98.54
COG0076460 GadB Glutamate decarboxylase and related PLP-dependent 97.87
PRK08776405 cystathionine gamma-synthase; Provisional 99.04
TIGR03576346 pyridox_MJ0158 pyridoxal phosphate enzyme, MJ0158 famil 96.94
pfam01212288 Beta_elim_lyase Beta-eliminating lyase. 99.03
pfam03841367 SelA L-seryl-tRNA selenium transferase. 98.5
cd00615294 Orn_deC_like Ornithine decarboxylase family. This famil 97.68
COG1921395 SelA Selenocysteine synthase [seryl-tRNASer selenium tr 96.22
PRK08637386 hypothetical protein; Provisional 98.79
PRK02769380 histidine decarboxylase; Provisional 98.42
KOG0629510 consensus 91.15
KOG0053409 consensus 98.57
KOG0634472 consensus 96.65
KOG2467477 consensus 94.87
PRK13578 720 ornithine decarboxylase; Provisional 96.1
>TIGR00707 argD acetylornithine and succinylornithine aminotransferases; InterPro: IPR004636 This family of proteins, for which ornithine aminotransferases form an outgroup, consists mostly of proteins designated acetylornithine aminotransferase Back     alignment and domain information
>TIGR01885 Orn_aminotrans ornithine--oxo-acid transaminase; InterPro: IPR010164 Ornithine aminotransferase catalyses the conversion of L-ornithine and a 2-oxo acid to L-glutamate 5-semialdehyde and an L-amino acid Back     alignment and domain information
>COG4992 ArgD Ornithine/acetylornithine aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK02627 acetylornithine aminotransferase; Provisional Back     alignment and domain information
>PRK12381 bifunctional succinylornithine transaminase/acetylornithine transaminase; Provisional Back     alignment and domain information
>PRK05093 argD bifunctional N-succinyldiaminopimelate-aminotransferase/acetylornithine transaminase protein; Reviewed Back     alignment and domain information
>PRK01278 argD bifunctional N-succinyldiaminopimelate-aminotransferase/acetylornithine transaminase protein; Provisional Back     alignment and domain information
>TIGR03246 arg_catab_astC succinylornithine transaminase family Back     alignment and domain information
>PTZ00125 ornithine aminotransferase; Provisional Back     alignment and domain information
>PRK04073 rocD ornithine--oxo-acid transaminase; Provisional Back     alignment and domain information
>PRK04612 argD bifunctional N-succinyldiaminopimelate-aminotransferase/acetylornithine transaminase protein; Provisional Back     alignment and domain information
>PRK02936 argD acetylornithine aminotransferase; Provisional Back     alignment and domain information
>PRK00854 rocD ornithine--oxo-acid transaminase; Reviewed Back     alignment and domain information
>PRK03244 argD acetylornithine aminotransferase; Provisional Back     alignment and domain information
>PRK07030 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK03715 argD bifunctional N-succinyldiaminopimelate-aminotransferase/acetylornithine transaminase protein; Provisional Back     alignment and domain information
>COG0160 GabT 4-aminobutyrate aminotransferase and related aminotransferases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05965 hypothetical protein; Provisional Back     alignment and domain information
>PRK08593 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK04260 acetylornithine aminotransferase; Provisional Back     alignment and domain information
>PRK07678 aminotransferase; Validated Back     alignment and domain information
>PRK07482 hypothetical protein; Provisional Back     alignment and domain information
>PRK06541 hypothetical protein; Provisional Back     alignment and domain information
>PRK06148 hypothetical protein; Provisional Back     alignment and domain information
>PRK11522 putrescine--2-oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>PRK08742 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK07481 hypothetical protein; Provisional Back     alignment and domain information
>PRK06105 aminotransferase; Provisional Back     alignment and domain information