254780436

254780436

hypothetical protein CLIBASIA_01605

GeneID in NCBI database:8209422Locus tag:CLIBASIA_01605
Protein GI in NCBI database:254780436Protein Accession:YP_003064849.1
Gene range:-(343577, 344473)Protein Length:298aa
Gene description:hypothetical protein
COG prediction:[R] FOG: TPR repeat
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM1 TM-Helix
TOPPRED1 TM-Helix
HMMTOP1 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------30
MYLPSWISDKFGCGFLRSSKRRGYYSLLSVLVVSVILLIEGCSSLFPSMGRRVNIDSLTAVIRAHPSDPEGYNVRGVVYGMNGDFEKALLDFQSALDLNPRYYKVYANRALIRYKMGDVPMAIRDYGTALKINPDYDVAYIGRGNIYRDERYSDLQKAFADFDRAIQLKTSDGRAWYGRALVYQMRGEYEKSIEDFSQAISLYSSISPDYYNGRGISYLATKNYDSALEDFKFAINLDPKKASFWFNGGMVYEMQGSYANAVKYYKKALSVDSRYYRAKNGILRISQDLSSTVNEVNE
cccHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHcc
ccccHHHHHHHHcccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccHHHHHcc
mylpswisdkfgcgflrsskrrgyYSLLSVLVVSVILLIEGCsslfpsmgrrvniDSLTAVIRahpsdpegynvrgvvygMNGDFEKALLDFQSaldlnpryykVYANRALIRYKMGDVPMAIRDYGtalkinpdydvayigrgniyrderYSDLQKAFADFDRAIQLKTSDGRAWYGRALVYQMRGEYEKSIEDFSQAISLYssispdyyngrgisyLATKNYDSALEDFKFAinldpkkasfwfnGGMVYEMQGSYANAVKYYKKALSVDSRYYRAKNGILRISQDLsstvnevne
mylpswisdkfgCGFLRSSKRRGYYSLLSVLVVSVILLIEGCSSLFPSMGRRVNIDSLTAVIrahpsdpegynVRGVVYGMNGDFEKALLDFQSALDLNPRYYKVYANRALIRYKMGDVPMAIRDYGtalkinpdydVAYIGRGNIYRDERYSDLQKAFADFDRAIQlktsdgrawyGRALVYQMRGEYEKSIEDFSQAISLYSSISPDYYNGRGISYLATKNYDSALEDFKFAINLDPKKASFWFNGGMVYEMQGSYANAVKYYKKALSVDSRYYRAKNgilrisqdlsstvnevne
MYLPSWISDKFGCGFLRSSKRRGYYsllsvlvvsvilliEGCSSLFPSMGRRVNIDSLTAVIRAHPSDPEGYNVRGVVYGMNGDFEKALLDFQSALDLNPRYYKVYANRALIRYKMGDVPMAIRDYGTALKINPDYDVAYIGRGNIYRDERYSDLQKAFADFDRAIQLKTSDGRAWYGRALVYQMRGEYEKSIEDFSQAISLYSSISPDYYNGRGISYLATKNYDSALEDFKFAINLDPKKASFWFNGGMVYEMQGSYANAVKYYKKALSVDSRYYRAKNGILRISQDLSSTVNEVNE
MYLPSWISDKFGCGFLRSSKRRGYYSLLSVLVVSVILLIEGCSSLFPSMGRRVNIDSLTAVIRAHPSDPEGYNVRGVVYGMNGDFEKALLDFQSALDLNPRYYKVYANRALIRYKMGDVPMAIRDYGTALKINPDYDVAYIGRGNIYRDERYSDLQKAFADFDRAIQLKTSDGRAWYGRALVYQMRGEYEKSIEDFSQAISLYSSISPDYYNGRGISYLATKNYDSALEDFKFAINLDPKKASFWFNGGMVYEMQGSYANAVKYYKKALSVDSRYYRAKNGILRISQDLSSTVNEVNE
MYLPSWISDKFGCGFLRSSKRRGYYSLLSVLVVSVILLIEGCSSLFPSMGRRVNIDSLTAVIRAHPSDPEGYNVRGVVYGMNGDFEKALLDFQSALDLNPRYYKVYANRALIRYKMGDVPMAIRDYGTALKINPDYDVAYIGRGNIYRDERYSDLQKAFADFDRAIQLKTSDGRAWYGRALVYQMRGEYEKSIEDFSQAISLYSSISPDYYNGRGISYLATKNYDSALEDFKFAINLDPKKASFWFNGGMVYEMQGSYANAVKYYKKALSVDSRYYRAKNGILRISQD**********
*YLPSWISDKFGCGFLRSSKRRGYYSLLSVLVVSVILLIEGCSSLFPSMGRRVNIDSLTAVIRAHPSDPEGYNVRGVVYGMNGDFEKALLDFQSALDLNPRYYKVYANRALIRYKMGDVPMAIRDYGTALKINPDYDVAYIGRGNIYRDERYSDLQKAFADFDRAIQLKTSDGRAWYGRALVYQMRGEYEKSIEDFSQAISLYSSISPDYYNGRGISYLATKNYDSALEDFKFAINLDPKKASFWFNGGMVYEMQGSYANAVKYYKKALSVDSRYYRAKNGILRISQDLSSTVNEVNE
iiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYLPSWISDKFGCGFLRSSKRRGYYSLLSVLVVSVILLIEGCSSLFPSMGRRVNIDSLTAVIRAHPSDPEGYNVRGVVYGMNGDFEKALLDFQSALDLNPRYYKVYANRALIRYKMGDVPMAIRDYGTALKINPDYDVAYIGRGNIYRDERYSDLQKAFADFDRAIQLKTSDGRAWYGRALVYQMRGEYEKSIEDFSQAISLYSSISPDYYNGRGISYLATKNYDSALEDFKFAINLDPKKASFWFNGGMVYEMQGSYANAVKYYKKALSVDSRYYRAKNGILRISQDLSSTVNEVNE
MYLPSWISDKFGCGFLRSSKRRGYYSLLSVLVVSVILLIEGCSSLFPSMGRRVNIDSLTAVIRAHPSDPEGYNVRGVVYGMNGDFEKALLDFQSALDLNPRYYKVYANRALIRYKMGDVPMAIRDYGTALKINPDYDVAYIGRGNIYRDERYSDLQKAFADFDRAIQLKTSDGRAWYGRALVYQMRGEYEKSIEDFSQAISLYSSISPDYYNGRGISYLATKNYDSALEDFKFAINLDPKKASFWFNGGMVYEMQGSYANAVKYYKKALSVDSRYYRAKNGILRISQDLSSTVNEVNE

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target298 hypothetical protein CLIBASIA_01605 [Candidatus Liberib
254780592271 TPR repeat-containing protein [Candidatus Liberiba 0.003
>gi|254780592|ref|YP_003065005.1| TPR repeat-containing protein [Candidatus Liberibacter asiaticus str. psy62] Length = 271 Back     alignment
 Score = 33.9 bits (76), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 36/70 (51%), Gaps = 3/70 (4%)

Query: 56  DSLTAVIRAHPSDPEGYNV---RGVVYGMNGDFEKALLDFQSALDLNPRYYKVYANRALI 112
           + L A+ RA   D   + +   +G V    G   +AL++++ AL+L+P    + +N A+ 
Sbjct: 122 EGLDAINRAQRPDIPDWQLISAKGSVLAQMGKHSEALIEYERALELSPNESSIVSNIAMS 181

Query: 113 RYKMGDVPMA 122
              MGD+  A
Sbjct: 182 YLLMGDLKTA 191

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target298 hypothetical protein CLIBASIA_01605 [Candidatus Liberib
315122115296 hypothetical protein CKC_01825 [Candidatus Liberibacter 1 1e-107
15966610295 hypothetical protein SMc03935 [Sinorhizobium meliloti 1 1 2e-67
307319638307 TPR repeat-containing protein [Sinorhizobium meliloti A 1 3e-67
150397952295 TPR repeat-containing protein [Sinorhizobium medicae WS 1 4e-67
222149767269 O-linked GlcNAc transferase [Agrobacterium vitis S4] Le 1 8e-65
159186016298 O-linked GlcNAc transferase [Agrobacterium tumefaciens 1 1e-64
332716785298 O-linked GlcNAc transferase [Agrobacterium sp. H13-3] L 1 2e-64
209550939289 hypothetical protein Rleg2_3363 [Rhizobium leguminosaru 1 2e-64
86359198288 O-linked GlcNAc transferase protein [Rhizobium etli CFN 1 2e-64
327194865288 putative O-linked GlcNAc transferase protein [Rhizobium 1 3e-64
>gi|315122115|ref|YP_004062604.1| hypothetical protein CKC_01825 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 296 Back     alignment and organism information
 Score =  390 bits (1003), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 194/292 (66%), Positives = 236/292 (80%), Gaps = 6/292 (2%)

Query: 1   MYLPSWIS----DKFGCGFLRSSKRRGYYSLLSVLVVSVILLIEGCSSLFPSMGRRVNID 56
           M   SWI      K+  GF  +SKR   +  LS LVVS+I LI+GC  L     +R NI 
Sbjct: 1   MSFLSWIRMLVLAKYSDGFFGNSKRVAGFFCLSFLVVSLISLIQGCFLLDGVRSKRANIS 60

Query: 57  SLTAVIRAHPSDPEGYNVRGVVYGMNGDFEKALLDFQSALDLNPRYYKVYANRALIRYKM 116
           SL +V+ AHPSDPE YNVRGVV+GMNGDFEK+L DFQSALDLNP YYK Y NRALI YKM
Sbjct: 61  SLNSVVHAHPSDPEVYNVRGVVHGMNGDFEKSLQDFQSALDLNPSYYKAYVNRALIEYKM 120

Query: 117 GDVPMAIRDYGTALKINPDYDVAYIGRGNIYRDERYSDLQKAFADFDRAIQLKTSDGRAW 176
           G+VPMAI+DY  ALKINP+YD+AYIGRGN+YRDE+Y D QKAFADFDRAIQLKTSDGRAW
Sbjct: 121 GNVPMAIKDYDAALKINPNYDIAYIGRGNVYRDEKYGDSQKAFADFDRAIQLKTSDGRAW 180

Query: 177 YGRALVYQMRGEYEKSIEDFSQAISLYSSISP-DYYNGRGISYLATKNYDSALEDFKFAI 235
           +GRALVYQ+R E++K+I DFS+AISL S+I+P DYYNGRG+SYLA KNYDSALEDFK AI
Sbjct: 181 FGRALVYQLRKEHQKAIGDFSRAISL-SAITPADYYNGRGVSYLAVKNYDSALEDFKLAI 239

Query: 236 NLDPKKASFWFNGGMVYEMQGSYANAVKYYKKALSVDSRYYRAKNGILRISQ 287
           + + K+A+FWFN G+ +EMQGSY +++  Y++AL +DS+YY+AK+GILR+ +
Sbjct: 240 HSNFKRATFWFNKGLAHEMQGSYKDSLASYQEALLIDSKYYKAKDGILRVKR 291


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|15966610|ref|NP_386963.1| hypothetical protein SMc03935 [Sinorhizobium meliloti 1021] Length = 295 Back     alignment and organism information
>gi|307319638|ref|ZP_07599064.1| TPR repeat-containing protein [Sinorhizobium meliloti AK83] Length = 307 Back     alignment and organism information
>gi|150397952|ref|YP_001328419.1| TPR repeat-containing protein [Sinorhizobium medicae WSM419] Length = 295 Back     alignment and organism information
>gi|222149767|ref|YP_002550724.1| O-linked GlcNAc transferase [Agrobacterium vitis S4] Length = 269 Back     alignment and organism information
>gi|159186016|ref|NP_356580.2| O-linked GlcNAc transferase [Agrobacterium tumefaciens str. C58] Length = 298 Back     alignment and organism information
>gi|332716785|ref|YP_004444251.1| O-linked GlcNAc transferase [Agrobacterium sp. H13-3] Length = 298 Back     alignment and organism information
>gi|209550939|ref|YP_002282856.1| hypothetical protein Rleg2_3363 [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 289 Back     alignment and organism information
>gi|86359198|ref|YP_471090.1| O-linked GlcNAc transferase protein [Rhizobium etli CFN 42] Length = 288 Back     alignment and organism information
>gi|327194865|gb|EGE61697.1| putative O-linked GlcNAc transferase protein [Rhizobium etli CNPAF512] Length = 288 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target298 hypothetical protein CLIBASIA_01605 [Candidatus Liberib
KOG4626 966 KOG4626, KOG4626, KOG4626, O-linked N-acetylglucosamine 3e-20
KOG0547606 KOG0547, KOG0547, KOG0547, Translocase of outer mitocho 3e-15
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR- 5e-15
KOG0547606 KOG0547, KOG0547, KOG0547, Translocase of outer mitocho 2e-13
TIGR00990615 TIGR00990, 3a0801s09, mitochondrial precursor proteins 2e-13
KOG4626 966 KOG4626, KOG4626, KOG4626, O-linked N-acetylglucosamine 3e-13
TIGR02917899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR- 1e-12
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR- 7e-12
KOG0547 606 KOG0547, KOG0547, KOG0547, Translocase of outer mitocho 4e-11
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR- 4e-11
KOG1126638 KOG1126, KOG1126, KOG1126, DNA-binding cell division cy 5e-11
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR- 2e-10
KOG0624 504 KOG0624, KOG0624, KOG0624, dsRNA-activated protein kina 3e-09
KOG1125579 KOG1125, KOG1125, KOG1125, TPR repeat-containing protei 6e-09
KOG1125579 KOG1125, KOG1125, KOG1125, TPR repeat-containing protei 9e-09
TIGR00990615 TIGR00990, 3a0801s09, mitochondrial precursor proteins 1e-08
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR- 2e-08
KOG1155559 KOG1155, KOG1155, KOG1155, Anaphase-promoting complex ( 1e-07
KOG1126638 KOG1126, KOG1126, KOG1126, DNA-binding cell division cy 3e-07
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR- 3e-07
COG3063250 COG3063, PilF, Tfp pilus assembly protein PilF [Cell mo 1e-06
KOG2002 1018 KOG2002, KOG2002, KOG2002, TPR-containing nuclear phosp 1e-06
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR- 1e-06
KOG0624 504 KOG0624, KOG0624, KOG0624, dsRNA-activated protein kina 2e-06
KOG0550486 KOG0550, KOG0550, KOG0550, Molecular chaperone (DnaJ su 2e-06
KOG2002 1018 KOG2002, KOG2002, KOG2002, TPR-containing nuclear phosp 8e-06
COG2956 389 COG2956, COG2956, Predicted N-acetylglucosaminyl transf 8e-06
KOG4648 536 KOG4648, KOG4648, KOG4648, Uncharacterized conserved pr 1e-05
KOG0495913 KOG0495, KOG0495, KOG0495, HAT repeat protein [RNA proc 2e-05
TIGR00990 615 TIGR00990, 3a0801s09, mitochondrial precursor proteins 2e-05
KOG2076 895 KOG2076, KOG2076, KOG2076, RNA polymerase III transcrip 3e-05
KOG1173611 KOG1173, KOG1173, KOG1173, Anaphase-promoting complex ( 5e-05
KOG1127 1238 KOG1127, KOG1127, KOG1127, TPR repeat-containing protei 0.002
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR- 0.002
KOG2076 895 KOG2076, KOG2076, KOG2076, RNA polymerase III transcrip 0.003
KOG1840508 KOG1840, KOG1840, KOG1840, Kinesin light chain [Cytoske 0.004
KOG4626 966 KOG4626, KOG4626, KOG4626, O-linked N-acetylglucosamine 2e-20
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typicall 4e-14
COG3063250 COG3063, PilF, Tfp pilus assembly protein PilF [Cell mo 8e-10
KOG0553304 KOG0553, KOG0553, KOG0553, TPR repeat-containing protei 3e-09
KOG0548539 KOG0548, KOG0548, KOG0548, Molecular co-chaperone STI1 6e-08
KOG1155 559 KOG1155, KOG1155, KOG1155, Anaphase-promoting complex ( 4e-07
KOG4648 536 KOG4648, KOG4648, KOG4648, Uncharacterized conserved pr 1e-06
KOG0553304 KOG0553, KOG0553, KOG0553, TPR repeat-containing protei 4e-06
KOG4234271 KOG4234, KOG4234, KOG4234, TPR repeat-containing protei 6e-06
COG4783484 COG4783, COG4783, Putative Zn-dependent protease, conta 9e-05
KOG0548 539 KOG0548, KOG0548, KOG0548, Molecular co-chaperone STI1 1e-04
KOG0376 476 KOG0376, KOG0376, KOG0376, Serine-threonine phosphatase 1e-04
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR- 1e-04
COG4785 297 COG4785, NlpI, Lipoprotein NlpI, contains TPR repeats [ 2e-04
COG5010257 COG5010, TadD, Flp pilus assembly protein TadD, contain 5e-04
KOG0547 606 KOG0547, KOG0547, KOG0547, Translocase of outer mitocho 0.002
KOG1128 777 KOG1128, KOG1128, KOG1128, Uncharacterized conserved pr 0.002
KOG4642 284 KOG4642, KOG4642, KOG4642, Chaperone-dependent E3 ubiqu 0.002
KOG1308 377 KOG1308, KOG1308, KOG1308, Hsp70-interacting protein Hi 0.003
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typicall 1e-12
KOG4626 966 KOG4626, KOG4626, KOG4626, O-linked N-acetylglucosamine 2e-10
KOG0548539 KOG0548, KOG0548, KOG0548, Molecular co-chaperone STI1 4e-08
KOG1308377 KOG1308, KOG1308, KOG1308, Hsp70-interacting protein Hi 9e-07
KOG0376 476 KOG0376, KOG0376, KOG0376, Serine-threonine phosphatase 2e-06
KOG4234271 KOG4234, KOG4234, KOG4234, TPR repeat-containing protei 2e-06
COG5010257 COG5010, TadD, Flp pilus assembly protein TadD, contain 3e-06
KOG0553304 KOG0553, KOG0553, KOG0553, TPR repeat-containing protei 4e-06
KOG0553304 KOG0553, KOG0553, KOG0553, TPR repeat-containing protei 2e-05
PRK11447 1157 PRK11447, PRK11447, cellulose synthase subunit BcsC; Pr 3e-05
KOG0548 539 KOG0548, KOG0548, KOG0548, Molecular co-chaperone STI1 5e-05
KOG0548 539 KOG0548, KOG0548, KOG0548, Molecular co-chaperone STI1 7e-05
COG4785297 COG4785, NlpI, Lipoprotein NlpI, contains TPR repeats [ 2e-04
KOG0547 606 KOG0547, KOG0547, KOG0547, Translocase of outer mitocho 6e-04
PLN03088 356 PLN03088, PLN03088, SGT1, suppressor of G2 allele of SK 6e-04
TIGR02521234 TIGR02521, type_IV_pilW, type IV pilus biogenesis/stabi 0.001
KOG3060289 KOG3060, KOG3060, KOG3060, Uncharacterized conserved pr 0.004
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typicall 2e-12
TIGR02552135 TIGR02552, LcrH_SycD, type III secretion low calcium re 2e-06
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR- 1e-04
COG5010257 COG5010, TadD, Flp pilus assembly protein TadD, contain 6e-04
KOG0548 539 KOG0548, KOG0548, KOG0548, Molecular co-chaperone STI1 0.002
TIGR02521234 TIGR02521, type_IV_pilW, type IV pilus biogenesis/stabi 5e-12
TIGR02521234 TIGR02521, type_IV_pilW, type IV pilus biogenesis/stabi 4e-11
KOG1127 1238 KOG1127, KOG1127, KOG1127, TPR repeat-containing protei 7e-11
KOG1128 777 KOG1128, KOG1128, KOG1128, Uncharacterized conserved pr 2e-07
KOG1173611 KOG1173, KOG1173, KOG1173, Anaphase-promoting complex ( 9e-05
KOG2002 1018 KOG2002, KOG2002, KOG2002, TPR-containing nuclear phosp 0.002
KOG4626 966 KOG4626, KOG4626, KOG4626, O-linked N-acetylglucosamine 1e-11
KOG1126638 KOG1126, KOG1126, KOG1126, DNA-binding cell division cy 1e-10
KOG4648 536 KOG4648, KOG4648, KOG4648, Uncharacterized conserved pr 8e-09
COG4785297 COG4785, NlpI, Lipoprotein NlpI, contains TPR repeats [ 2e-06
KOG1128777 KOG1128, KOG1128, KOG1128, Uncharacterized conserved pr 1e-05
PRK11189296 PRK11189, PRK11189, lipoprotein NlpI; Provisional 4e-05
KOG1156 700 KOG1156, KOG1156, KOG1156, N-terminal acetyltransferase 1e-04
COG4783484 COG4783, COG4783, Putative Zn-dependent protease, conta 3e-04
COG4235287 COG4235, COG4235, Cytochrome c biogenesis factor [Postt 3e-04
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typicall 1e-10
KOG0548539 KOG0548, KOG0548, KOG0548, Molecular co-chaperone STI1 6e-05
KOG0376 476 KOG0376, KOG0376, KOG0376, Serine-threonine phosphatase 0.001
PRK02603172 PRK02603, PRK02603, photosystem I assembly protein Ycf3 0.001
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typicall 2e-08
KOG0553 304 KOG0553, KOG0553, KOG0553, TPR repeat-containing protei 1e-06
KOG0547 606 KOG0547, KOG0547, KOG0547, Translocase of outer mitocho 5e-06
KOG0550 486 KOG0550, KOG0550, KOG0550, Molecular chaperone (DnaJ su 6e-06
COG3063 250 COG3063, PilF, Tfp pilus assembly protein PilF [Cell mo 0.002
TIGR02521 234 TIGR02521, type_IV_pilW, type IV pilus biogenesis/stabi 0.002
KOG1125579 KOG1125, KOG1125, KOG1125, TPR repeat-containing protei 3e-07
PRK11189296 PRK11189, PRK11189, lipoprotein NlpI; Provisional 7e-04
KOG2002 1018 KOG2002, KOG2002, KOG2002, TPR-containing nuclear phosp 1e-04
PRK11189 296 PRK11189, PRK11189, lipoprotein NlpI; Provisional 4e-04
pfam0051534 pfam00515, TPR_1, Tetratricopeptide repeat 0.002
pfam0051534 pfam00515, TPR_1, Tetratricopeptide repeat 0.002
pfam0051534 pfam00515, TPR_1, Tetratricopeptide repeat 0.002
TIGR03302235 TIGR03302, OM_YfiO, outer membrane assembly lipoprotein 0.003
>gnl|CDD|39826 KOG4626, KOG4626, KOG4626, O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism, Posttranslational modification, protein turnover, chaperones, Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|35767 KOG0547, KOG0547, KOG0547, Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>gnl|CDD|163072 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|35767 KOG0547, KOG0547, KOG0547, Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>gnl|CDD|162147 TIGR00990, 3a0801s09, mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>gnl|CDD|39826 KOG4626, KOG4626, KOG4626, O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism, Posttranslational modification, protein turnover, chaperones, Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|163072 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|163072 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|35767 KOG0547, KOG0547, KOG0547, Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>gnl|CDD|163072 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|36341 KOG1126, KOG1126, KOG1126, DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>gnl|CDD|163072 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|35843 KOG0624, KOG0624, KOG0624, dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|36340 KOG1125, KOG1125, KOG1125, TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>gnl|CDD|36340 KOG1125, KOG1125, KOG1125, TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>gnl|CDD|162147 TIGR00990, 3a0801s09, mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>gnl|CDD|163072 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|36370 KOG1155, KOG1155, KOG1155, Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning, Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|36341 KOG1126, KOG1126, KOG1126, DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>gnl|CDD|163072 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|32877 COG3063, PilF, Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|37213 KOG2002, KOG2002, KOG2002, TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|163072 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|35843 KOG0624, KOG0624, KOG0624, dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|35770 KOG0550, KOG0550, KOG0550, Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|37213 KOG2002, KOG2002, KOG2002, TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|32776 COG2956, COG2956, Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|39847 KOG4648, KOG4648, KOG4648, Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>gnl|CDD|35716 KOG0495, KOG0495, KOG0495, HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|162147 TIGR00990, 3a0801s09, mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>gnl|CDD|37287 KOG2076, KOG2076, KOG2076, RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>gnl|CDD|36388 KOG1173, KOG1173, KOG1173, Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning, Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|36342 KOG1127, KOG1127, KOG1127, TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|163072 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|37287 KOG2076, KOG2076, KOG2076, RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>gnl|CDD|37051 KOG1840, KOG1840, KOG1840, Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>gnl|CDD|39826 KOG4626, KOG4626, KOG4626, O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism, Posttranslational modification, protein turnover, chaperones, Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|29151 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|32877 COG3063, PilF, Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|35773 KOG0553, KOG0553, KOG0553, TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>gnl|CDD|35768 KOG0548, KOG0548, KOG0548, Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|36370 KOG1155, KOG1155, KOG1155, Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning, Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|39847 KOG4648, KOG4648, KOG4648, Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>gnl|CDD|35773 KOG0553, KOG0553, KOG0553, TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>gnl|CDD|39435 KOG4234, KOG4234, KOG4234, TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>gnl|CDD|34394 COG4783, COG4783, Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>gnl|CDD|35768 KOG0548, KOG0548, KOG0548, Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|35597 KOG0376, KOG0376, KOG0376, Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>gnl|CDD|163072 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|34396 COG4785, NlpI, Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>gnl|CDD|34615 COG5010, TadD, Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|35767 KOG0547, KOG0547, KOG0547, Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>gnl|CDD|36343 KOG1128, KOG1128, KOG1128, Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>gnl|CDD|39841 KOG4642, KOG4642, KOG4642, Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|36522 KOG1308, KOG1308, KOG1308, Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones, Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|29151 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|39826 KOG4626, KOG4626, KOG4626, O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism, Posttranslational modification, protein turnover, chaperones, Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|35768 KOG0548, KOG0548, KOG0548, Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|36522 KOG1308, KOG1308, KOG1308, Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones, Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|35597 KOG0376, KOG0376, KOG0376, Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>gnl|CDD|39435 KOG4234, KOG4234, KOG4234, TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>gnl|CDD|34615 COG5010, TadD, Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|35773 KOG0553, KOG0553, KOG0553, TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>gnl|CDD|35773 KOG0553, KOG0553, KOG0553, TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>gnl|CDD|183140 PRK11447, PRK11447, cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>gnl|CDD|35768 KOG0548, KOG0548, KOG0548, Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|35768 KOG0548, KOG0548, KOG0548, Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|34396 COG4785, NlpI, Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>gnl|CDD|35767 KOG0547, KOG0547, KOG0547, Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>gnl|CDD|178637 PLN03088, PLN03088, SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>gnl|CDD|131573 TIGR02521, type_IV_pilW, type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>gnl|CDD|38270 KOG3060, KOG3060, KOG3060, Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>gnl|CDD|29151 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|162919 TIGR02552, LcrH_SycD, type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>gnl|CDD|163072 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|34615 COG5010, TadD, Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|35768 KOG0548, KOG0548, KOG0548, Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|131573 TIGR02521, type_IV_pilW, type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>gnl|CDD|131573 TIGR02521, type_IV_pilW, type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>gnl|CDD|36342 KOG1127, KOG1127, KOG1127, TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|36343 KOG1128, KOG1128, KOG1128, Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>gnl|CDD|36388 KOG1173, KOG1173, KOG1173, Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning, Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|37213 KOG2002, KOG2002, KOG2002, TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|39826 KOG4626, KOG4626, KOG4626, O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism, Posttranslational modification, protein turnover, chaperones, Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|36341 KOG1126, KOG1126, KOG1126, DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>gnl|CDD|39847 KOG4648, KOG4648, KOG4648, Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>gnl|CDD|34396 COG4785, NlpI, Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>gnl|CDD|36343 KOG1128, KOG1128, KOG1128, Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>gnl|CDD|183026 PRK11189, PRK11189, lipoprotein NlpI; Provisional Back     alignment and domain information
>gnl|CDD|36371 KOG1156, KOG1156, KOG1156, N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>gnl|CDD|34394 COG4783, COG4783, Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>gnl|CDD|33959 COG4235, COG4235, Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|29151 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|35768 KOG0548, KOG0548, KOG0548, Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|35597 KOG0376, KOG0376, KOG0376, Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>gnl|CDD|179448 PRK02603, PRK02603, photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>gnl|CDD|29151 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|35773 KOG0553, KOG0553, KOG0553, TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>gnl|CDD|35767 KOG0547, KOG0547, KOG0547, Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>gnl|CDD|35770 KOG0550, KOG0550, KOG0550, Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|32877 COG3063, PilF, Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|131573 TIGR02521, type_IV_pilW, type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>gnl|CDD|36340 KOG1125, KOG1125, KOG1125, TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>gnl|CDD|183026 PRK11189, PRK11189, lipoprotein NlpI; Provisional Back     alignment and domain information
>gnl|CDD|37213 KOG2002, KOG2002, KOG2002, TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|183026 PRK11189, PRK11189, lipoprotein NlpI; Provisional Back     alignment and domain information
>gnl|CDD|144197 pfam00515, TPR_1, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|144197 pfam00515, TPR_1, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|144197 pfam00515, TPR_1, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|163209 TIGR03302, OM_YfiO, outer membrane assembly lipoprotein YfiO Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 298 hypothetical protein CLIBASIA_01605 [Candidatus Liberib
KOG4626 966 consensus 100.0
KOG4626 966 consensus 99.97
TIGR02917 924 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipop 99.92
KOG0547 606 consensus 99.88
KOG1125579 consensus 99.87
KOG1126638 consensus 99.86
KOG1173611 consensus 99.82
KOG1173611 consensus 99.79
KOG0624 504 consensus 99.78
KOG0550 486 consensus 99.75
KOG0548539 consensus 99.74
KOG2002 1018 consensus 99.72
KOG1155559 consensus 99.71
KOG1125579 consensus 99.65
PRK11447 1158 cellulose synthase subunit BcsC; Provisional 99.63
KOG1129478 consensus 99.61
TIGR02521247 type_IV_pilW type IV pilus biogenesis/stability protein 99.61
KOG0548 539 consensus 99.57
KOG1174564 consensus 99.54
KOG2076 895 consensus 99.52
KOG1127 1238 consensus 99.51
PRK11788 389 hypothetical protein; Provisional 99.5
KOG0495913 consensus 99.47
KOG0550 486 consensus 99.46
PRK11189297 lipoprotein NlpI; Provisional 99.44
KOG1840508 consensus 99.44
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motility and 99.42
KOG4648 536 consensus 99.38
KOG4162799 consensus 99.38
PRK10747398 putative protoheme IX biogenesis protein; Provisional 99.26
PRK11788389 hypothetical protein; Provisional 99.23
KOG1840508 consensus 99.15
KOG1156 700 consensus 99.03
KOG1130 639 consensus 98.97
PRK10049 818 pgaA outer membrane protein PgaA; Provisional 98.97
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [Coenz 98.9
pfam04733290 Coatomer_E Coatomer epsilon subunit. This family repres 98.68
COG2956389 Predicted N-acetylglucosaminyl transferase [Carbohydrat 98.62
PRK12370553 invasion protein regulator; Provisional 98.55
COG0457291 NrfG FOG: TPR repeat [General function prediction only] 98.3
KOG3785 557 consensus 98.11
PRK10866243 outer membrane protein assembly complex subunit YfiO; P 98.09
COG4105254 ComL DNA uptake lipoprotein [General function predictio 98.07
KOG3081299 consensus 98.03
COG0457291 NrfG FOG: TPR repeat [General function prediction only] 98.02
KOG1130 639 consensus 97.46
KOG1550552 consensus 94.54
COG3898 531 Uncharacterized membrane-bound protein [Function unknow 93.6
KOG3783546 consensus 93.55
TIGR02917 924 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipop 99.93
KOG1126638 consensus 99.88
KOG1155559 consensus 99.78
KOG2002 1018 consensus 99.75
TIGR00990649 3a0801s09 mitochondrial precursor proteins import recep 99.7
KOG4162799 consensus 99.57
TIGR02521247 type_IV_pilW type IV pilus biogenesis/stability protein 99.45
KOG2003 840 consensus 99.38
KOG0624 504 consensus 99.31
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motility and 99.31
KOG1174 564 consensus 99.24
COG2956 389 Predicted N-acetylglucosaminyl transferase [Carbohydrat 99.08
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [General fu 98.84
KOG3060289 consensus 98.81
PRK10370206 formate-dependent nitrite reductase complex subunit Nrf 98.56
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. Membe 98.31
pfam04733290 Coatomer_E Coatomer epsilon subunit. This family repres 98.08
KOG2053 932 consensus 97.8
KOG10701710 consensus 97.34
PRK10866243 outer membrane protein assembly complex subunit YfiO; P 97.2
KOG3081299 consensus 96.36
COG4105254 ComL DNA uptake lipoprotein [General function predictio 95.83
COG4700251 Uncharacterized protein conserved in bacteria containin 95.82
KOG0547 606 consensus 99.87
KOG4642284 consensus 98.26
KOG0376 476 consensus 97.79
KOG0551390 consensus 97.71
KOG3824472 consensus 97.44
KOG4507 886 consensus 97.43
KOG2053 932 consensus 96.08
KOG1310758 consensus 95.99
COG4976287 Predicted methyltransferase (contains TPR repeat) [Gene 95.79
KOG2396 568 consensus 95.13
KOG2076 895 consensus 99.83
TIGR00990 649 3a0801s09 mitochondrial precursor proteins import recep 99.75
PRK02603172 photosystem I assembly protein Ycf3; Provisional 99.52
KOG2003 840 consensus 99.49
PRK11447 1158 cellulose synthase subunit BcsC; Provisional 99.46
CHL00033165 ycf3 photosystem I assembly protein Ycf3 99.43
KOG0553304 consensus 99.38
KOG1127 1238 consensus 99.32
cd00189100 TPR Tetratricopeptide repeat domain; typically contains 99.31
KOG0543397 consensus 99.02
KOG0543397 consensus 98.91
KOG1128 777 consensus 98.87
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR repe 98.75
TIGR02552137 LcrH_SycD type III secretion low calcium response chape 98.66
KOG1128 777 consensus 98.66
KOG4234271 consensus 98.59
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF; InterPro: IPR 98.52
PRK10803262 hypothetical protein; Provisional 98.41
PRK10803262 hypothetical protein; Provisional 98.21
COG1729262 Uncharacterized protein conserved in bacteria [Function 98.13
COG4235287 Cytochrome c biogenesis factor [Posttranslational modif 98.12
KOG4555175 consensus 97.94
pfam09295 395 ChAPs ChAPs (Chs5p-Arf1p-binding proteins). ChAPs (Chs5 97.76
KOG1308 377 consensus 97.7
PRK10941269 putative transcriptional regulator; Provisional 97.49
KOG0545329 consensus 97.15
KOG1915 677 consensus 97.04
KOG1915 677 consensus 97.04
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; Prov 96.69
KOG2796366 consensus 96.58
COG2912269 Uncharacterized conserved protein [Function unknown] 96.39
PRK11906458 transcriptional regulator; Provisional 96.22
KOG1941 518 consensus 95.73
KOG0546372 consensus 95.68
KOG1310 758 consensus 94.61
PRK11906458 transcriptional regulator; Provisional 93.94
pfam09986214 DUF2225 Uncharacterized protein conserved in bacteria ( 93.09
COG2976207 Uncharacterized protein conserved in bacteria [Function 91.52
pfam10300 446 IML2 Putative mitochondrial outer membrane protein. Thi 90.75
PRK02603172 photosystem I assembly protein Ycf3; Provisional 99.51
cd00189100 TPR Tetratricopeptide repeat domain; typically contains 99.36
CHL00033165 ycf3 photosystem I assembly protein Ycf3 98.91
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR repe 98.79
KOG2376 652 consensus 98.73
TIGR02552137 LcrH_SycD type III secretion low calcium response chape 98.68
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF; InterPro: IPR 98.53
KOG4234271 consensus 98.48
KOG4340 459 consensus 98.46
PRK10370206 formate-dependent nitrite reductase complex subunit Nrf 98.43
KOG4642284 consensus 98.37
KOG3785 557 consensus 98.27
KOG1308377 consensus 98.02
KOG4555175 consensus 97.98
PRK10049 818 pgaA outer membrane protein PgaA; Provisional 97.97
KOG0551390 consensus 97.84
KOG2376 652 consensus 97.79
pfam0051534 TPR_1 Tetratricopeptide repeat. 97.3
KOG4340459 consensus 97.03
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 4 or 96.86
cd05804355 StaR_like StaR_like; a well-conserved protein found in 96.41
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; Prov 96.23
COG4976287 Predicted methyltransferase (contains TPR repeat) [Gene 96.23
pfam03704146 BTAD Bacterial transcriptional activator domain. Found 95.89
pfam06552186 TOM20_plant Plant specific mitochondrial import recepto 95.89
KOG4814 872 consensus 95.84
PRK06330 906 transcript cleavage factor/unknown domain fusion protei 95.5
pfam06552186 TOM20_plant Plant specific mitochondrial import recepto 95.28
KOG1550552 consensus 95.02
KOG2610 491 consensus 94.96
KOG4507 886 consensus 94.85
COG3914 620 Spy Predicted O-linked N-acetylglucosamine transferase, 93.93
KOG3783546 consensus 93.58
KOG2396 568 consensus 91.35
PRK13184 933 pknD serine/threonine-protein kinase; Reviewed 91.09
KOG0553304 consensus 99.47
KOG1156 700 consensus 99.39
PRK11189297 lipoprotein NlpI; Provisional 98.84
KOG0376 476 consensus 98.6
KOG3060289 consensus 98.14
pfam09295395 ChAPs ChAPs (Chs5p-Arf1p-binding proteins). ChAPs (Chs5 97.84
KOG2471 696 consensus 95.79
KOG0530318 consensus 95.26
COG4700251 Uncharacterized protein conserved in bacteria containin 94.64
KOG0530318 consensus 93.65
KOG1129478 consensus 99.4
KOG0495913 consensus 99.34
KOG4648 536 consensus 98.53
KOG10701710 consensus 96.51
PRK10747398 putative protoheme IX biogenesis protein; Provisional 98.95
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. Membe 98.84
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [Coenz 98.38
COG4783484 Putative Zn-dependent protease, contains TPR repeats [G 98.71
COG4235287 Cytochrome c biogenesis factor [Posttranslational modif 98.6
COG4783484 Putative Zn-dependent protease, contains TPR repeats [G 98.44
COG1729262 Uncharacterized protein conserved in bacteria [Function 98.02
KOG0545329 consensus 97.35
KOG2796366 consensus 97.35
PRK12370553 invasion protein regulator; Provisional 98.71
pfam0051534 TPR_1 Tetratricopeptide repeat. 98.17
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 4 or 97.88
pfam0771934 TPR_2 Tetratricopeptide repeat. This Pfam entry include 97.62
PRK10941269 putative transcriptional regulator; Provisional 97.08
KOG2471696 consensus 96.23
COG3118304 Thioredoxin domain-containing protein [Posttranslationa 95.63
KOG3617 1416 consensus 95.56
KOG3364149 consensus 94.56
COG2912269 Uncharacterized conserved protein [Function unknown] 93.61
COG3947361 Response regulator containing CheY-like receiver and SA 93.33
pfam11207203 DUF2989 Protein of unknown function (DUF2989). Some mem 92.49
pfam02259351 FAT FAT domain. The FAT domain is named after FRAP, ATM 92.07
KOG0890 2382 consensus 90.8
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [General fu 97.84
KOG3824 472 consensus 97.25
cd05804355 StaR_like StaR_like; a well-conserved protein found in 97.06
pfam03704146 BTAD Bacterial transcriptional activator domain. Found 94.59
KOG1941 518 consensus 91.67
pfam0771934 TPR_2 Tetratricopeptide repeat. This Pfam entry include 96.2
KOG2047 835 consensus 94.2
>KOG4626 consensus Back     alignment and domain information
>KOG4626 consensus Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein; InterPro: IPR014266 This protein family occurs in strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system , analogous to the LPXTG/sortase system common in Gram-positive bacteria Back     alignment and domain information
>KOG0547 consensus Back     alignment and domain information
>KOG1125 consensus Back     alignment and domain information
>KOG1126 consensus Back     alignment and domain information
>KOG1173 consensus Back     alignment and domain information
>KOG1173 consensus Back     alignment and domain information
>KOG0624 consensus Back     alignment and domain information
>KOG0550 consensus Back     alignment and domain information
>KOG0548 consensus Back     alignment and domain information
>KOG2002 consensus Back     alignment and domain information
>KOG1155 consensus Back     alignment and domain information
>KOG1125 consensus Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>KOG1129 consensus Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW; InterPro: IPR013360 Proteins in this entry are designated PilF and PilW Back     alignment and domain information
>KOG0548 consensus Back     alignment and domain information
>KOG1174 consensus Back     alignment and domain information
>KOG2076 consensus Back     alignment and domain information
>KOG1127 consensus Back     alignment and domain information
>PRK11788 hypothetical protein; Provisional Back     alignment and domain information
>KOG0495 consensus Back     alignment and domain information
>KOG0550 consensus Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG1840 consensus Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG4648 consensus Back     alignment and domain information
>KOG4162 consensus Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PRK11788 hypothetical protein; Provisional Back     alignment and domain information
>KOG1840 consensus Back     alignment and domain information
>KOG1156 consensus Back     alignment and domain information
>KOG1130 consensus Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>pfam04733 Coatomer_E Coatomer epsilon subunit Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>KOG3785 consensus Back     alignment and domain information
>PRK10866 outer membrane protein assembly complex subunit YfiO; Provisional Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>KOG3081 consensus Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>KOG1130 consensus Back     alignment and domain information
>KOG1550 consensus Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>KOG3783 consensus Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein; InterPro: IPR014266 This protein family occurs in strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system , analogous to the LPXTG/sortase system common in Gram-positive bacteria Back     alignment and domain information
>KOG1126 consensus Back     alignment and domain information
>KOG1155 consensus Back     alignment and domain information
>KOG2002 consensus Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor; InterPro: IPR005687 The mitochondrial protein translocase (MPT) family, which brings nuclearly encoded preproteins into mitochondria, is very complex with 19 currently identified protein constituents Back     alignment and domain information
>KOG4162 consensus Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW; InterPro: IPR013360 Proteins in this entry are designated PilF and PilW Back     alignment and domain information
>KOG2003 consensus Back     alignment and domain information
>KOG0624 consensus Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1174 consensus Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG3060 consensus Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>pfam04733 Coatomer_E Coatomer epsilon subunit Back     alignment and domain information
>KOG2053 consensus Back     alignment and domain information
>KOG1070 consensus Back     alignment and domain information
>PRK10866 outer membrane protein assembly complex subunit YfiO; Provisional Back     alignment and domain information
>KOG3081 consensus Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>KOG0547 consensus Back     alignment and domain information
>KOG4642 consensus Back     alignment and domain information
>KOG0376 consensus Back     alignment and domain information
>KOG0551 consensus Back     alignment and domain information
>KOG3824 consensus Back     alignment and domain information
>KOG4507 consensus Back     alignment and domain information
>KOG2053 consensus Back     alignment and domain information
>KOG1310 consensus Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>KOG2396 consensus Back     alignment and domain information
>KOG2076 consensus Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor; InterPro: IPR005687 The mitochondrial protein translocase (MPT) family, which brings nuclearly encoded preproteins into mitochondria, is very complex with 19 currently identified protein constituents Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>KOG2003 consensus Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>KOG0553 consensus Back     alignment and domain information
>KOG1127 consensus Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>KOG0543 consensus Back     alignment and domain information
>KOG0543 consensus Back     alignment and domain information
>KOG1128 consensus Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD; InterPro: IPR005415 The type III secretion system of Gram-negative bacteria is used to transport virulence factors from the pathogen directly into the host cell and is only triggered when the bacterium comes into close contact with the host Back     alignment and domain information
>KOG1128 consensus Back     alignment and domain information
>KOG4234 consensus Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF; InterPro: IPR014162 Members of this protein family are the product of one of seven genes regularly clustered in operons to encode the proteins of the tol-pal system, which is critical for maintaining the integrity of the bacterial outer membrane Back     alignment and domain information
>PRK10803 hypothetical protein; Provisional Back     alignment and domain information
>PRK10803 hypothetical protein; Provisional Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown]