254780435

254780435

peptidase S11, D-alanyl-D-alanine carboxypeptidase 1

GeneID in NCBI database:8209421Locus tag:CLIBASIA_01600
Protein GI in NCBI database:254780435Protein Accession:YP_003064848.1
Gene range:+(342347, 343357)Protein Length:336aa
Gene description:peptidase S11, D-alanyl-D-alanine carboxypeptidase 1
COG prediction:[M] D-alanyl-D-alanine carboxypeptidase
KEGG prediction:peptidase S11, D-alanyl-D-alanine carboxypeptidase 1; K01286 D-alanyl-D-alanine carboxypeptidase [EC:3.4.16.4]
SEED prediction:D-alanyl-D-alanine carboxypeptidase (EC 3.4.16.4)
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Murein Hydrolases; Peptidoglycan Biosynthesis
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED3 TM-Helix
HMMTOP1 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMyes
SignalP_NNyes
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330------
MRQFLVIIAMAMLSNIFPFLSIAETNKLPYYTLLDTNTGHVIAENYPDHPWNPASLTKLMTAYVVFSFLKEKKAMLTTPITISKNASEYPPSNSTFKKGSTMTLDNALKLLIVKSANDIAVAIAESLCKTEKKFVQHMNNTSKNLGLSATHFMNAHGVVQHGHYTTARDMAILSWRIKTDFPQYMHYFQIKGLEIKGKKYPNTNWAVGTFLGADGMKTGFTCASGFNIVASAIQGDQSLIAVILGALDRNTRNKVSASLLSMGFYNKTDRKKINYIIKDFYQQNLSNEVPNISEEVCTTQKEIINYNTQMKEAKDKESHFIDFEKITLLKNKITKK
cHHHHHHHHHHHHHHHHHHccccccccccEEEEEEcccccEEEEEccccccccHHHHHHHHHHHHHHHHHccccccccEEEccHHHHcccccEEEEccccEEEHHHHHHHHHHcccHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccEEEccccccccccEEcHHHHHHHHHHHHHHcHHHHHHHcEEEEEEccccEEEEEccccccccccEEEEEEEcccccEEEEEEEEccEEEEEEEccccccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEEccHHHHcc
ccHHHHHHHHHHHHHHccccccccccccccEEEEEccccEEEEcccccccccccHHHHHHHHHHHHHHHHcccccccccEEEcccHHcccccEEEEcccccEcHHHHHccEEEEcccHHHHHHHHHHcccHHHHHHHHHHHHHHHccccccEEcccccccccccccHHHHHHHHHHHHHcccHHHHHEEcEEEEccccEccccccEEEccccccccccccccccccEEEEEEcccccEEEEEEEccccHHHHHHHHHHHHHHccccEEEEEEccccccEEEEEEccccccccEEEEEcccccccccccccHHHHEcccccccccEEEEEEcccccc
MRQFLVIIAMAMLSNifpflsiaetnklpyytlldtntghviaenypdhpwnpaslTKLMTAYVVFSFLKEKKAmlttpitisknaseyppsnstfkkgstmTLDNALKLLIVKSANDIAVAIAESLCKTEKKFVQHMNNTSKNLGLSATHFmnahgvvqhghytTARDMAILSWRiktdfpqymHYFQIKGleikgkkypntnwavgtflgadgmktgftcasgFNIVASAIQGDQSLIAVILGALDRNTRNKVSASLLSmgfynktdrKKINYIIKDFYqqnlsnevpniseEVCTTQKEIINYNTQmkeakdkeshfidfEKITLLKNKITKK
MRQFLVIIAMAMLSNIFPFLSIAETNKLPYYTLLDTNTGHVIAENYPDHPWNPASLTKLMTAYVVFSFLKEKKAMLTTpitisknaseyppsnstfKKGSTMTLDNALKLLIVKSANDIAVAIAESLCKTEKKFVQHMNNTSKNLGLSATHFMNAHGVVQHGHYTTARDMAILSWRIKTDFPQYMHYFQIKGLeikgkkypNTNWAVGTFLGADGMKTGFTCASGFNIVASAIQGDQSLIAVILGALDRNTRNKVSAsllsmgfynktdRKKINYIIKDFYQQNLSNEVPNISEEVCTTQKEIINYNTQMkeakdkeshfidfekitllknkitkk
MRQFLVIIAMAMLSNIFPFLSIAETNKLPYYTLLDTNTGHVIAENYPDHPWNPASLTKLMTAYVVFSFLKEKKAMLTTPITISKNASEYPPSNSTFKKGSTMTLDNALKLLIVKSANDIAVAIAESLCKTEKKFVQHMNNTSKNLGLSATHFMNAHGVVQHGHYTTARDMAILSWRIKTDFPQYMHYFQIKGLEIKGKKYPNTNWAVGTFLGADGMKTGFTCASGFNIVASAIQGDQSLIAVILGALDRNTRNKVSASLLSMGFYNKTDRKKINYIIKDFYQQNLSNEVPNISEEVCTTQKEIINYNTQMKEAKDKESHFIDFEkitllknkitkk
*RQFLVIIAMAMLSNIFPFLSIAETNKLPYYTLLDTNTGHVIAENYPDHPWNPASLTKLMTAYVVFSFLKEKKAMLTTPITISKNASEYPP*NSTFKKGSTMTLDNALKLLIVKSANDIAVAIAESLCKTEKKFVQHMNNTSKNLGLSATHFMNAHGVVQHGHYTTARDMAILSWRIKTDFPQYMHYFQIKGLEIKGKKYPNTNWAVGTFLGADGMKTGFTCASGFNIVASAIQGDQSLIAVILGALDRNT**KVSASLLSMGFYNKTDRKKINYI***************I*****************************DFEKITLLKNKI***
MRQFLVIIAMAMLSNIFPFLSIAETNKLPYYTLLDTNTGHVIAENYPDHPWNPASLTKLMTAYVVFSFLKEKKAMLTTPITISKNASEYPPSNSTFKKGSTMTLDNALKLLIVKSANDIAVAIAESLCKTEKKFVQHMNNTSKNLGLSATHFMNAHGVVQHGHYTTARDMAILSWRIKTDFPQYMHYFQIKGLEIKGKKYPNTNWAVGTFLGADGMKTGFTCASGFNIVASAIQGDQSLIAVILGALDRNTRNKVSASLLSMGFYNKTDRKKINYIIKDFYQQNLSNEVPNISEEVCTTQKEIINYNTQMKEAKDKESHFIDFEKITLLKNKITKK
MRQFLVIIAMAMLSNIFPFLSIAETNKLPYYTLLDTNTGHVIAENYPDHPWNPASLTKLMTAYVVFSFLKEKKAMLTTPITISKNASEYPPSNSTFKKGSTMTLDNALKLLIVKSANDIAVAIAESLCKTEKKFVQHMNNTSKNLGLSATHFMNAHGVVQHGHYTTARDMAILSWRIKTDFPQYMHYFQIKGLEIKGKKYPNTNWAVGTFLGADGMKTGFTCASGFNIVASAIQGDQSLIAVILGALDRNTRNKVSASLLSMGFYNKTDRKKINYIIKDFYQQNLSNEVPNISEEVCTTQKEIINYNTQMKEAKDKESHFIDFEKITLLKNK****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
MRQFLVIIAMAMLSNIFPFLSIAETNKLPYYTLLDTNTGHVIAENYPDHPWNPASLTKLMTAYVVFSFLKEKKAMLTTPITISKNASEYPPSNSTFKKGSTMTLDNALKLLIVKSANDIAVAIAESLCKTEKKFVQHMNNTSKNLGLSATHFMNAHGVVQHGHYTTARDMAILSWRIKTDFPQYMHYFQIKGLEIKGKKYPNTNWAVGTFLGADGMKTGFTCASGFNIVASAIQGDQSLIAVILGALDRNTRNKVSASLLSMGFYNKTDRKKINYIIKDFYQQNLSNEVPNISEEVCTTQKEIINYNTQMKEAKDKESHFIDFEKITLLKNKITKK
MRQFLVIIAMAMLSNIFPFLSIAETNKLPYYTLLDTNTGHVIAENYPDHPWNPASLTKLMTAYVVFSFLKEKKAMLTTPITISKNASEYPPSNSTFKKGSTMTLDNALKLLIVKSANDIAVAIAESLCKTEKKFVQHMNNTSKNLGLSATHFMNAHGVVQHGHYTTARDMAILSWRIKTDFPQYMHYFQIKGLEIKGKKYPNTNWAVGTFLGADGMKTGFTCASGFNIVASAIQGDQSLIAVILGALDRNTRNKVSASLLSMGFYNKTDRKKINYIIKDFYQQNLSNEVPNISEEVCTTQKEIINYNTQMKEAKDKESHFIDFEKITLLKNKITKK
MRQFLVIIAMAMLSNIFPFLSIAETNKLPYYTLLDTNTGHVIAENYPDHPWNPASLTKLMTAYVVFSFLKEKKAMLTTPITISKNASEYPPSNSTFKKGSTMTLDNALKLLIVKSANDIAVAIAESLCKTEKKFVQHMNNTSKNLGLSATHFMNAHGVVQHGHYTTARDMAILSWRIKTDFPQYMHYFQIKGLEIKGKKYPNTNWAVGTFLGADGMKTGFTCASGFNIVASAIQGDQSLIAVILGALDRNTRNKVSASLLSMGFYNKTDRKKINYIIKDFYQQNLSNEVPNISEEVCTTQKEIINYNTQMKEAKDKESHFIDFEKITLLKNKITKK

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target336 peptidase S11, D-alanyl-D-alanine carboxypeptidase 1 [C
254780698336 D-alanyl-D-alanine carboxypeptidase 1 penicillin-b 3e-40
>gi|254780698|ref|YP_003065111.1| D-alanyl-D-alanine carboxypeptidase 1 penicillin-binding protein [Candidatus Liberibacter asiaticus str. psy62] Length = 336 Back     alignment
 Score =  157 bits (397), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 94/267 (35%), Positives = 141/267 (52%), Gaps = 12/267 (4%)

Query: 4   FLVIIAMAMLSNIFPFLSIAETNKLPYYT--LLDTNTGHVIAENYPDHPWNPASLTKLMT 61
           FL II ++M S         E +  P Y+  ++D N   +      D P  PASLTK+MT
Sbjct: 36  FLSIIMISMAS---------ELHAKPKYSSIVIDVNKNQMTGFK-QDEPRYPASLTKMMT 85

Query: 62  AYVVFSFLKEKKAMLTTPITISKNASEYPPSNSTFKKGSTMTLDNALKLLIVKSANDIAV 121
            Y++F +L+ KK  L T I +SK A+   PS    K+ +  T +  +  LI +SAND++ 
Sbjct: 86  LYIIFEYLQSKKLHLNTQIPVSKTAATQNPSKLYLKEKTYFTTEQGILALITRSANDVST 145

Query: 122 AIAESLCKTEKKFVQHMNNTSKNLGLSATHFMNAHGVVQHGHYTTARDMAILSWRIKTDF 181
           A  E +  +EKKF   M+N +K +G+  T + NA G+      TTARD AIL   ++ +F
Sbjct: 146 AFGEFISGSEKKFAILMSNKAKKIGMQNTIYKNASGLHDKNQITTARDQAILGILLRKNF 205

Query: 182 PQYMHYFQIKGLEIKGKKYPNTNWAVGTFLGADGMKTGFTCASGFNIVASAIQGDQSLIA 241
           PQY  YF I+    + +   N N  +      DG+KTG+T  SGFNIV S    D  ++A
Sbjct: 206 PQYYKYFSIRKFRYRNRIITNHNKLLNKMHNIDGIKTGYTRNSGFNIVTSLRYKDDPIVA 265

Query: 242 VILGALDRNTRNKVSASLLSMGFYNKT 268
           V++G      R++ +  L++     KT
Sbjct: 266 VVMGMPTSQERDQKALELITSFLEKKT 292

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target336 peptidase S11, D-alanyl-D-alanine carboxypeptidase 1 [C
315122117282 peptidase S11, D-alanyl-D-alanine carboxypeptidase 1 [C 1 1e-117
110635386382 peptidase S11, D-alanyl-D-alanine carboxypeptidase 1 [M 1 1e-65
222087386388 D-alanyl-D-alanine carboxypeptidase protein [Agrobacter 1 2e-61
159185835389 penicillin-binding protein dacf precursor [Agrobacteriu 1 2e-61
332716423372 penicillin-binding protein [Agrobacterium sp. H13-3] Le 1 1e-60
150397770376 Serine-type D-Ala-D-Ala carboxypeptidase [Sinorhizobium 1 7e-60
227823262372 putative D-alanyl-D-alanine carboxypeptidase [Sinorhizo 1 7e-60
327188719366 D-alanyl-D-alanine carboxypeptidase protein [Rhizobium 1 9e-60
15966442360 putative penicillin-binding protein [Sinorhizobium meli 1 1e-59
190893669366 D-alanyl-D-alanine carboxypeptidase [Rhizobium etli CIA 1 4e-59
>gi|315122117|ref|YP_004062606.1| peptidase S11, D-alanyl-D-alanine carboxypeptidase 1 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 282 Back     alignment and organism information
 Score =  426 bits (1095), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 205/270 (75%), Positives = 232/270 (85%), Gaps = 4/270 (1%)

Query: 4   FLVIIAMAMLSNIFPFLSIAETNKLPYYTLLDTNTGHVIAENYPDHPWNPASLTKLMTAY 63
           FL+ I   +L  I+PF +IAE N LPYYTLLD+NTGHVIAEN PD  WNPASLTKLMTAY
Sbjct: 11  FLIRITALILIGIYPFQAIAEENNLPYYTLLDSNTGHVIAENNPDKLWNPASLTKLMTAY 70

Query: 64  VVFSFLKEKKAMLTTPITISKNASEYPPSNSTFKKGSTMTLDNALKLLIVKSANDIAVAI 123
           VVFSFL++KK  L TPITISKNASE PPSNSTFKKGS +TLDNALKLLIVKSANDIAVAI
Sbjct: 71  VVFSFLEQKKITLETPITISKNASEQPPSNSTFKKGSILTLDNALKLLIVKSANDIAVAI 130

Query: 124 AESLCKTEKKFVQHMNNTSKNLGLSATHFMNAHGVVQHGHYTTARDMAILSWRIKTDFPQ 183
           AESLC TE++FV+HMN++++ LGL  T FMN+HGVVQ+GHYTTARDM ILSWRIKT F Q
Sbjct: 131 AESLCNTEEEFVKHMNDSAQTLGLLRTKFMNSHGVVQNGHYTTARDMTILSWRIKTHFSQ 190

Query: 184 YMHYFQIKGLEIKGKKYPNTNWAVGTFLGADGMKTGFTCASGFNIVASAIQGDQSLIAVI 243
           Y HYFQIKGL+IK KKYPNTNWA+G FLGADGMKTGFTCASGFNIVASA QG++SLI V+
Sbjct: 191 YAHYFQIKGLKIKNKKYPNTNWAIGIFLGADGMKTGFTCASGFNIVASASQGNRSLITVV 250

Query: 244 LGALDRNTRNKVSASLLSMGFYNKTDRKKI 273
           LGALDR++RN++S  LLS GF    D+K I
Sbjct: 251 LGALDRDSRNQISEKLLSAGF----DKKNI 276


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|110635386|ref|YP_675594.1| peptidase S11, D-alanyl-D-alanine carboxypeptidase 1 [Mesorhizobium sp. BNC1] Length = 382 Back     alignment and organism information
>gi|222087386|ref|YP_002545923.1| D-alanyl-D-alanine carboxypeptidase protein [Agrobacterium radiobacter K84] Length = 388 Back     alignment and organism information
>gi|159185835|ref|NP_356978.2| penicillin-binding protein dacf precursor [Agrobacterium tumefaciens str. C58] Length = 389 Back     alignment and organism information
>gi|332716423|ref|YP_004443889.1| penicillin-binding protein [Agrobacterium sp. H13-3] Length = 372 Back     alignment and organism information
>gi|150397770|ref|YP_001328237.1| Serine-type D-Ala-D-Ala carboxypeptidase [Sinorhizobium medicae WSM419] Length = 376 Back     alignment and organism information
>gi|227823262|ref|YP_002827234.1| putative D-alanyl-D-alanine carboxypeptidase [Sinorhizobium fredii NGR234] Length = 372 Back     alignment and organism information
>gi|327188719|gb|EGE55918.1| D-alanyl-D-alanine carboxypeptidase protein [Rhizobium etli CNPAF512] Length = 366 Back     alignment and organism information
>gi|15966442|ref|NP_386795.1| putative penicillin-binding protein [Sinorhizobium meliloti 1021] Length = 360 Back     alignment and organism information
>gi|190893669|ref|YP_001980211.1| D-alanyl-D-alanine carboxypeptidase [Rhizobium etli CIAT 652] Length = 366 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target336 peptidase S11, D-alanyl-D-alanine carboxypeptidase 1 [C
pfam00768241 pfam00768, Peptidase_S11, D-alanyl-D-alanine carboxypep 4e-43
PRK11397388 PRK11397, dacD, D-alanyl-D-alanine carboxypeptidase; Pr 2e-39
PRK10001400 PRK10001, PRK10001, D-alanyl-D-alanine carboxypeptidase 6e-39
PRK10793403 PRK10793, PRK10793, D-alanyl-D-alanine carboxypeptidase 2e-36
PRK11669306 PRK11669, pbpG, D-alanyl-D-alanine endopeptidase; Provi 2e-10
COG1686389 COG1686, DacC, D-alanyl-D-alanine carboxypeptidase [Cel 4e-61
>gnl|CDD|144388 pfam00768, Peptidase_S11, D-alanyl-D-alanine carboxypeptidase Back     alignment and domain information
>gnl|CDD|183117 PRK11397, dacD, D-alanyl-D-alanine carboxypeptidase; Provisional Back     alignment and domain information
>gnl|CDD|182189 PRK10001, PRK10001, D-alanyl-D-alanine carboxypeptidase fraction C; Provisional Back     alignment and domain information
>gnl|CDD|182736 PRK10793, PRK10793, D-alanyl-D-alanine carboxypeptidase fraction A; Provisional Back     alignment and domain information
>gnl|CDD|183269 PRK11669, pbpG, D-alanyl-D-alanine endopeptidase; Provisional Back     alignment and domain information
>gnl|CDD|31872 COG1686, DacC, D-alanyl-D-alanine carboxypeptidase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 336 peptidase S11, D-alanyl-D-alanine carboxypeptidase 1 [C
PRK11397390 dacD D-alanyl-D-alanine carboxypeptidase; Provisional 100.0
PRK10001400 D-alanyl-D-alanine carboxypeptidase fraction C; Provisi 100.0
PRK10793403 D-alanyl-D-alanine carboxypeptidase fraction A; Provisi 100.0
COG1686389 DacC D-alanyl-D-alanine carboxypeptidase [Cell envelope 100.0
PRK11669308 pbpG D-alanyl-D-alanine endopeptidase; Provisional 100.0
PRK10795619 penicillin-binding protein 2; Provisional 98.6
PRK13128 518 D-aminopeptidase; Reviewed 98.34
PRK09506839 mrcB penicillin-binding protein 1b; Reviewed 97.83
COG0768599 FtsI Cell division protein FtsI/penicillin-binding prot 96.99
TIGR02071742 PBP_1b penicillin-binding protein 1B; InterPro: IPR0118 95.91
COG2602254 Beta-lactamase class D [Defense mechanisms] 94.57
TIGR02214660 spoVD_pbp stage V sporulation protein D; InterPro: IPR0 91.74
pfam00768241 Peptidase_S11 D-alanyl-D-alanine carboxypeptidase. 100.0
COG2367329 PenP Beta-lactamase class A [Defense mechanisms] 99.66
PRK11113477 D-alanyl-D-alanine carboxypeptidase/endopeptidase; Prov 99.5
pfam02113383 Peptidase_S13 D-Ala-D-Ala carboxypeptidase 3 (S13) fami 98.82
COG2027470 DacB D-alanyl-D-alanine carboxypeptidase (penicillin-bi 98.33
PRK10662377 beta-lactamase/D-alanine carboxypeptidase; Provisional 99.09
PRK11289387 ampC beta-lactamase; Provisional 99.05
pfam00144327 Beta-lactamase Beta-lactamase. This family appears to b 98.91
pfam00905296 Transpeptidase Penicillin binding protein transpeptidas 98.71
COG1680390 AmpC Beta-lactamase class C and other penicillin bindin 97.84
TIGR02074700 PBP_1a_fam penicillin-binding protein, 1A family; Inter 96.56
COG0744661 MrcB Membrane carboxypeptidase (penicillin-binding prot 96.21
PRK11636 850 mrcA peptidoglycan synthetase; Provisional 95.3
PRK11240 770 penicillin-binding protein 1C; Provisional 91.14
TIGR03423592 pbp2_mrdA penicillin-binding protein 2. Members of this 98.71
PRK03642432 hypothetical protein; Provisional 98.06
COG2027 470 DacB D-alanyl-D-alanine carboxypeptidase (penicillin-bi 96.67
TIGR00666 427 PBP4 D-alanyl-D-alanine carboxypeptidase/D-alanyl-D-ala 96.0
TIGR00666427 PBP4 D-alanyl-D-alanine carboxypeptidase/D-alanyl-D-ala 97.76
>PRK11397 dacD D-alanyl-D-alanine carboxypeptidase; Provisional Back     alignment and domain information
>PRK10001 D-alanyl-D-alanine carboxypeptidase fraction C; Provisional Back     alignment and domain information
>PRK10793 D-alanyl-D-alanine carboxypeptidase fraction A; Provisional Back     alignment and domain information
>COG1686 DacC D-alanyl-D-alanine carboxypeptidase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK11669 pbpG D-alanyl-D-alanine endopeptidase; Provisional Back     alignment and domain information
>PRK10795 penicillin-binding protein 2; Provisional Back     alignment and domain information
>PRK13128 D-aminopeptidase; Reviewed Back     alignment and domain information
>PRK09506 mrcB penicillin-binding protein 1b; Reviewed Back     alignment and domain information
>COG0768 FtsI Cell division protein FtsI/penicillin-binding protein 2 [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR02071 PBP_1b penicillin-binding protein 1B; InterPro: IPR011813 Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task Back     alignment and domain information
>COG2602 Beta-lactamase class D [Defense mechanisms] Back     alignment and domain information
>TIGR02214 spoVD_pbp stage V sporulation protein D; InterPro: IPR011927 This entry describes the SpoVD family of homologs of the cell division protein FtsI, a penicillin binding protein Back     alignment and domain information
>pfam00768 Peptidase_S11 D-alanyl-D-alanine carboxypeptidase Back     alignment and domain information
>COG2367 PenP Beta-lactamase class A [Defense mechanisms] Back     alignment and domain information
>PRK11113 D-alanyl-D-alanine carboxypeptidase/endopeptidase; Provisional Back     alignment and domain information
>pfam02113 Peptidase_S13 D-Ala-D-Ala carboxypeptidase 3 (S13) family Back     alignment and domain information
>COG2027 DacB D-alanyl-D-alanine carboxypeptidase (penicillin-binding protein 4) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK10662 beta-lactamase/D-alanine carboxypeptidase; Provisional Back     alignment and domain information
>PRK11289 ampC beta-lactamase; Provisional Back     alignment and domain information
>pfam00144 Beta-lactamase Beta-lactamase Back     alignment and domain information
>pfam00905 Transpeptidase Penicillin binding protein transpeptidase domain Back     alignment and domain information
>COG1680 AmpC Beta-lactamase class C and other penicillin binding proteins [Defense mechanisms] Back     alignment and domain information
>TIGR02074 PBP_1a_fam penicillin-binding protein, 1A family; InterPro: IPR011816 Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task Back     alignment and domain information
>COG0744 MrcB Membrane carboxypeptidase (penicillin-binding protein) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK11636 mrcA peptidoglycan synthetase; Provisional Back     alignment and domain information
>PRK11240 penicillin-binding protein 1C; Provisional Back     alignment and domain information
>TIGR03423 pbp2_mrdA penicillin-binding protein 2 Back     alignment and domain information
>PRK03642 hypothetical protein; Provisional Back     alignment and domain information
>COG2027 DacB D-alanyl-D-alanine carboxypeptidase (penicillin-binding protein 4) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR00666 PBP4 D-alanyl-D-alanine carboxypeptidase/D-alanyl-D-alanine-endopeptidase; InterPro: IPR000667 Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes Back     alignment and domain information
>TIGR00666 PBP4 D-alanyl-D-alanine carboxypeptidase/D-alanyl-D-alanine-endopeptidase; InterPro: IPR000667 Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target336 peptidase S11, D-alanyl-D-alanine carboxypeptidase 1 [C
3it9_A352 Crystal Structure Of Penicillin-Binding Protein 6 ( 7e-52
1hd8_A363 Crystal Structure Of A Deacylation-Defective Mutant 3e-49
1nzo_A363 The Crystal Structure Of Wild Type Penicillin-Bindi 3e-49
3a3j_A344 Crystal Structures Of Penicillin Binding Protein 5 4e-47
1xp4_A379 Crystal Structure Of A Peptidoglycan Synthesis Regu 5e-34
3mfd_A334 The Structure Of The Beta-Lactamase Superfamily Dom 9e-31
2bcf_A276 Crystal Structure Of A Evolved Putative Penicillin- 1e-22
1tvf_A369 Crystal Structure Of Penicillin-Binding Protein 4 ( 1e-22
3hum_A453 Crystal Structure Of Penicillin Binding Protein 4 F 2e-22
1skf_A262 Crystal Structure Of The Streptomyces K15 Dd-Transp 8e-22
1es2_A262 S96a Mutant Of Streptomyces K15 Dd-Transpeptidase L 9e-22
1es5_A262 S216a Mutant Of Streptomyces K15 Dd-Transpeptidase 9e-22
1es4_A262 C98n Mutant Of Streptomyces K15 Dd-Transpeptidase L 2e-21
1es3_A262 C98a Mutant Of Streptomyces K15 Dd-Transpeptidase L 2e-21
1j9m_A262 K38h Mutant Of Streptomyces K15 Dd-Transpeptidase L 9e-21
1esi_A262 R248l Mutant Of Streptomyces K15 Dd-Transpeptidase 1e-20
1zg4_A286 Tem1 Beta Lactamase Length = 286 1e-05
3bfe_A262 Crystal Structure Of The Class A Beta-Lactamase Sed 2e-05
1fqg_A263 Molecular Structure Of The Acyl-Enzyme Intermediate 3e-05
3p98_A286 The Crystal Structure Of The Extended Spectrum Beta 4e-05
3cmz_A263 Tem-1 Class-A Beta-Lactamase L201p Mutant Apo Struc 4e-05
1li9_A263 Crystal Structure Of Tem-34 Beta-Lactamase At 1.5 A 5e-05
1jwv_A263 Crystal Structure Of G238a Mutant Of Tem-1 Beta-Lac 5e-05
1yt4_A263 Crystal Structure Of Tem-76 Beta-Lactamase At 1.4 A 5e-05
3bfd_A263 Crystal Structure Of The Class A Beta-Lactamase Sed 6e-05
1ero_A263 X-Ray Crystal Structure Of Tem-1 Beta Lactamase In 6e-05
3bfc_A262 Class A Beta-Lactamase Sed-G238c Complexed With Imi 6e-05
1erm_A263 X-Ray Crystal Structure Of Tem-1 Beta Lactamase In 6e-05
2b5r_A263 1b Lactamase B LACTAMASE INHIBITOR Length = 263 6e-05
1pzp_A263 Tem-1 Beta-Lactamase In Complex With A Novel, Core- 7e-05
1lhy_A263 Crystal Structure Of Tem-30 Beta-Lactamase At 2.0 A 7e-05
1esu_A263 S235a Mutant Of Tem1 Beta-Lactamase Length = 263 7e-05
3jyi_A263 Structural And Biochemical Evidence That A Tem-1 {b 7e-05
1jvj_A263 Crystal Structure Of N132a Mutant Of Tem-1 Beta-Lac 8e-05
2v1z_A291 Structure Of A Tem-1 Beta-Lactamase Insertant Allos 1e-04
1bt5_A263 Crystal Structure Of The Imipenem Inhibited Tem-1 B 1e-04
3gmw_A261 Crystal Structure Of Beta-Lactamse Inhibitory Prote 1e-04
1jtd_A263 Crystal Structure Of Beta-Lactamase Inhibitor Prote 1e-04
1xxm_A263 The Modular Architecture Of Protein-Protein Binding 1e-04
1ck3_A263 N276d Mutant Of Escherichia Coli Tem-1 Beta-Lactama 2e-04
3d4f_A286 Shv-1 Beta-Lactamase Complex With Ln1-255 Length = 2e-04
1zg6_A286 Tem1 Beta Lactamase Mutant S70g Length = 286 2e-04
3dtm_A263 Increased Folding Stability Of Tem-1 Beta-Lactamase 4e-04
2j9o_A298 Structure Of Pbp-A, L158e Mutant Length = 298 4e-04
1htz_A263 Crystal Structure Of Tem52 Beta-Lactamase Length = 4e-04
1jwp_A263 Structure Of M182t Mutant Of Tem-1 Beta-Lactamase L 5e-04
2j7v_A298 Structure Of Pbp-A Length = 298 5e-04
2zq8_A262 Apo Structure Of Class A Beta-Lactamase Toho-1 R274 5e-04
2xr0_A260 Room Temperature X-Ray Structure Of The Perdeuterat 5e-04
1li0_A263 Crystal Structure Of Tem-32 Beta-Lactamase At 1.6 A 6e-04
2zq7_A262 Apo Structure Of Class A Beta-Lactamase Toho-1 E166 7e-04
1jwz_A263 Crystal Structure Of Tem-64 Beta-Lactamase In Compl 8e-04
1we4_A262 Crystal Structure Of Class A Beta-Lactamase Toho-1 0.002
1iys_A262 Crystal Structure Of Class A Beta-Lactamase Toho-1 0.002
1iyo_A262 Toho-1 Beta-Lactamase In Complex With Cefotaxime Le 0.002
1ylt_A263 Atomic Resolution Structure Of Ctx-M-14 Beta-Lactam 0.002
2p74_A263 Ctx-M-9 Class A Beta-Lactamase Apo Crystal Structur 0.002
1ylj_A263 Atomic Resolution Structure Of Ctx-M-9 Beta-Lactama 0.002
3n4i_A265 Crystal Structure Of The Shv-1 D104e Beta-Lactamase 0.002
1ylw_A263 X-Ray Structure Of Ctx-M-16 Beta-Lactamase Length = 0.003
1n9b_A265 Ultrahigh Resolution Structure Of A Class A Beta-La 0.003
2g2w_A265 Crystal Structure Of The Shv D104k Beta-LactamaseBE 0.003
1ylp_A263 Atomic Resolution Structure Of Ctx-M-27 Beta-Lactam 0.004
1tdg_A265 Complex Of S130g Shv-1 Beta-Lactamase With Tazobact 0.004
1shv_A265 Structure Of Shv-1 Beta-Lactamase Length = 265 0.004
>gi|261825019|pdb|3IT9|A Chain A, Crystal Structure Of Penicillin-Binding Protein 6 (Pbp6) From E. Coli In Apo State Length = 352 Back     alignment and structure
 Score =  209 bits (530), Expect = 7e-52,   Method: Composition-based stats.
 Identities = 96/325 (29%), Positives = 148/325 (45%), Gaps = 11/325 (3%)

Query: 19  FLSIAETNKLPYYTLLDTNTGHVIAENYPDHPWNPASLTKLMTAYVVFSFLKEKKAMLTT 78
               A +     + L+D  +G V+AE   D   +PASLTK+MT+YVV   LK  K  LT 
Sbjct: 4   QTVEAPSVDARAWILMDYASGKVLAEGNADEKLDPASLTKIMTSYVVGQALKADKIKLTD 63

Query: 79  PITISKNASEYPPS------NSTFKKGSTMTLDNALKLLIVKSANDIAVAIAESLCKTEK 132
            +T+ K+A                K G  +++ +  K +I++S ND  +A+A+ +  +++
Sbjct: 64  MVTVGKDAWATGNPALRGSSVMFLKPGDQVSVADLNKGVIIQSGNDACIALADYVAGSQE 123

Query: 133 KFVQHMNNTSKNLGLSATHFMNAHGVVQHGHYTTARDMAILSWRIKTDFPQYMHYFQIKG 192
            F+  MN  +K LGL+ T F   HG+   G ++TARDMA+L   +  D P+     + K 
Sbjct: 124 SFIGLMNGYAKKLGLTNTTFQTVHGLDAPGQFSTARDMALLGKALIHDVPEEYAIHKEKE 183

Query: 193 LEIKGKKYPNTNW-AVGTFLGADGMKTGFTCASGFNIVASAIQGDQSLIAVILGALDRNT 251
                 + PN N     + L  DGMKTG T  +G+N+VASA QGD  LI+V+LGA     
Sbjct: 184 FTFNKIRQPNRNRLLWSSNLNVDGMKTGTTAGAGYNLVASATQGDMRLISVVLGAKTDRI 243

Query: 252 RNKVSASLLSMGFYNKTDRKKINY----IIKDFYQQNLSNEVPNISEEVCTTQKEIINYN 307
           R   S  LL+ GF        I      + +  +  + S       E    T       N
Sbjct: 244 RFNESEKLLTWGFRFFETVTPIKPDATFVTQRVWFGDKSEVNLGAGEAGSVTIPRGQLKN 303

Query: 308 TQMKEAKDKESHFIDFEKITLLKNK 332
            +      +       +K  ++   
Sbjct: 304 LKASYTLTEPQLTAPLKKGQVVGTI 328


>gi|17942531|pdb|1HD8|A Chain A, Crystal Structure Of A Deacylation-Defective Mutant Of Penicillin-Binding Protein 5 At 2.3 A Resolution Length = 363 Back     alignment and structure
>gi|42543137|pdb|1NZO|A Chain A, The Crystal Structure Of Wild Type Penicillin-Binding Protein 5 From E. Coli Length = 363 Back     alignment and structure
>gi|281500691|pdb|3A3J|A Chain A, Crystal Structures Of Penicillin Binding Protein 5 From Haemophilus Influenzae Length = 344 Back     alignment and structure
>gi|56967192|pdb|1XP4|A Chain A, Crystal Structure Of A Peptidoglycan Synthesis Regulatory Factor (Pbp3) From Streptococcus Pneumoniae Length = 379 Back     alignment and structure
>gi|296278518|pdb|3MFD|A Chain A, The Structure Of The Beta-Lactamase Superfamily Domain Of D- Alanine Carboxypeptidase From Bacillus Subtilis Length = 334 Back     alignment and structure
>gi|82408083|pdb|2BCF|A Chain A, Crystal Structure Of A Evolved Putative Penicillin-Binding Protein Homolog, Rv2911, From Mycobacterium Tuberculosis Length = 276 Back     alignment and structure
>gi|50513810|pdb|1TVF|A Chain A, Crystal Structure Of Penicillin-Binding Protein 4 (Pbp4) From Staphylococcus Aureus Length = 369 Back     alignment and structure
>gi|266618633|pdb|3HUM|A Chain A, Crystal Structure Of Penicillin Binding Protein 4 From Staphylococcus Aureus Col In Complex With Cefotaxime Length = 453 Back     alignment and structure
>gi|157833819|pdb|1SKF|A Chain A, Crystal Structure Of The Streptomyces K15 Dd-Transpeptidase Length = 262 Back     alignment and structure
>gi|7766851|pdb|1ES2|A Chain A, S96a Mutant Of Streptomyces K15 Dd-Transpeptidase Length = 262 Back     alignment and structure
>gi|7766854|pdb|1ES5|A Chain A, S216a Mutant Of Streptomyces K15 Dd-Transpeptidase Length = 262 Back     alignment and structure
>gi|7766853|pdb|1ES4|A Chain A, C98n Mutant Of Streptomyces K15 Dd-Transpeptidase Length = 262 Back     alignment and structure
>gi|7766852|pdb|1ES3|A Chain A, C98a Mutant Of Streptomyces K15 Dd-Transpeptidase Length = 262 Back     alignment and structure
>gi|14719796|pdb|1J9M|A Chain A, K38h Mutant Of Streptomyces K15 Dd-Transpeptidase Length = 262 Back     alignment and structure
>gi|7766855|pdb|1ESI|A Chain A, R248l Mutant Of Streptomyces K15 Dd-Transpeptidase Length = 262 Back     alignment and structure
gi|67464382|pdb|1ZG4|A Chain A, Tem1 Beta Lactamase Length = 286 Back     alignment and structure
>gi|163311075|pdb|3BFE|A Chain A, Crystal Structure Of The Class A Beta-Lactamase Sed-1 From Citrobacter Sedlakii Length = 262 Back     alignment and structure
>gi|11514176|pdb|1FQG|A Chain A, Molecular Structure Of The Acyl-Enzyme Intermediate In Tem- 1 Beta-Lactamase Length = 263 Back     alignment and structure
>gi|325533970|pdb|3P98|A Chain A, The Crystal Structure Of The Extended Spectrum Beta-Lactamase Tem-72 Reveals Inhibition By Citrate Length = 286 Back     alignment and structure
>gi|215261172|pdb|3CMZ|A Chain A, Tem-1 Class-A Beta-Lactamase L201p Mutant Apo Structure Length = 263 Back     alignment and structure
>gi|24158844|pdb|1LI9|A Chain A, Crystal Structure Of Tem-34 Beta-Lactamase At 1.5 Angstrom Length = 263 Back     alignment and structure
>gi|21465759|pdb|1JWV|A Chain A, Crystal Structure Of G238a Mutant Of Tem-1 Beta-Lactamase In Complex With A Boronic Acid Inhibitor (Sefb4) Length = 263 Back     alignment and structure
>gi|73535720|pdb|1YT4|A Chain A, Crystal Structure Of Tem-76 Beta-Lactamase At 1.4 Angstrom Resolution Length = 263 Back     alignment and structure
>gi|163311071|pdb|3BFD|A Chain A, Crystal Structure Of The Class A Beta-Lactamase Sed-G238c Mutant From Citrobacter Sedlakii Length = 263 Back     alignment and structure
>gi|8569630|pdb|1ERO|A Chain A, X-Ray Crystal Structure Of Tem-1 Beta Lactamase In Complex With A Designed Boronic Acid Inhibitor (1r)-2- Phenylacetamido-2-(3-Carboxyphenyl)ethyl Boronic Acid Length = 263 Back     alignment and structure
>gi|163311067|pdb|3BFC|A Chain A, Class A Beta-Lactamase Sed-G238c Complexed With Imipenem Length = 262 Back     alignment and structure
>gi|8569629|pdb|1ERM|A Chain A, X-Ray Crystal Structure Of Tem-1 Beta Lactamase In Complex With A Designed Boronic Acid Inhibitor (1r)-1-Acetamido-2- (3-Carboxyphenyl)ethane Boronic Acid Length = 263 Back     alignment and structure
>gi|99031866|pdb|2B5R|A Chain A, 1b Lactamase B LACTAMASE INHIBITOR Length = 263 Back     alignment and structure
>gi|47168592|pdb|1PZP|A Chain A, Tem-1 Beta-Lactamase In Complex With A Novel, Core- Disrupting, Allosteric Inhibitor Length = 263 Back     alignment and structure
>gi|24158842|pdb|1LHY|A Chain A, Crystal Structure Of Tem-30 Beta-Lactamase At 2.0 Angstrom Length = 263 Back     alignment and structure
>gi|7766856|pdb|1ESU|A Chain A, S235a Mutant Of Tem1 Beta-Lactamase Length = 263 Back     alignment and structure
>gi|260656432|pdb|3JYI|A Chain A, Structural And Biochemical Evidence That A Tem-1 {beta}- Lactamase Asn170gly Active Site Mutant Acts Via Substrate- Assisted Catalysis Length = 263 Back     alignment and structure
>gi|20150560|pdb|1JVJ|A Chain A, Crystal Structure Of N132a Mutant Of Tem-1 Beta-Lactamase In Complex With A N-Formimidoyl-Thienamycine Length = 263 Back     alignment and structure
>gi|192988211|pdb|2V1Z|A Chain A, Structure Of A Tem-1 Beta-Lactamase Insertant Allosterically Regulated By Kanamycin And Anions. Length = 291 Back     alignment and structure
>gi|6137619|pdb|1BT5|A Chain A, Crystal Structure Of The Imipenem Inhibited Tem-1 Beta- Lactamase From Escherichia Coli Length = 263 Back     alignment and structure
>gi|226192761|pdb|3GMW|A Chain A, Crystal Structure Of Beta-Lactamse Inhibitory Protein-I (Blip-I) In Complex With Tem-1 Beta-Lactamase Length = 261 Back     alignment and structure
>gi|15988093|pdb|1JTD|A Chain A, Crystal Structure Of Beta-Lactamase Inhibitor Protein-Ii In Complex With Tem-1 Beta-Lactamase Length = 263 Back     alignment and structure
>gi|60594088|pdb|1XXM|A Chain A, The Modular Architecture Of Protein-Protein Binding Site Length = 263 Back     alignment and structure
>gi|9257166|pdb|1CK3|A Chain A, N276d Mutant Of Escherichia Coli Tem-1 Beta-Lactamase Length = 263 Back     alignment and structure
gi|223365818|pdb|3D4F|A Chain A, Shv-1 Beta-Lactamase Complex With Ln1-255 Length = 286 Back     alignment and structure
>gi|67464385|pdb|1ZG6|A Chain A, Tem1 Beta Lactamase Mutant S70g Length = 286 Back     alignment and structure
>gi|195927602|pdb|3DTM|A Chain A, Increased Folding Stability Of Tem-1 Beta-Lactamase By In- Vitro Selection Length = 263 Back     alignment and structure
>gi|162329895|pdb|2J9O|A Chain A, Structure Of Pbp-A, L158e Mutant Length = 298 Back     alignment and structure
>gi|13786975|pdb|1HTZ|A Chain A, Crystal Structure Of Tem52 Beta-Lactamase Length = 263 Back     alignment and structure
>gi|21465758|pdb|1JWP|A Chain A, Structure Of M182t Mutant Of Tem-1 Beta-Lactamase Length = 263 Back     alignment and structure
>gi|160285591|pdb|2J7V|A Chain A, Structure Of Pbp-A Length = 298 Back     alignment and structure
>gi|254839213|pdb|2ZQ8|A Chain A, Apo Structure Of Class A Beta-Lactamase Toho-1 R274nR276N Double Mutant Length = 262 Back     alignment and structure
>gi|315364376|pdb|2XR0|A Chain A, Room Temperature X-Ray Structure Of The Perdeuterated Toho-1 R274n R276n Double Mutant Beta-Lactamase Length = 260 Back     alignment and structure
>gi|24158843|pdb|1LI0|A Chain A, Crystal Structure Of Tem-32 Beta-Lactamase At 1.6 Angstrom Length = 263 Back     alignment and structure
>gi|254839212|pdb|2ZQ7|A Chain A, Apo Structure Of Class A Beta-Lactamase Toho-1 E166aR274NR276N TRIPLE MUTANT Length = 262 Back     alignment and structure
>gi|21465760|pdb|1JWZ|A Chain A, Crystal Structure Of Tem-64 Beta-Lactamase In Complex With A Boronic Acid Inhibitor (105) Length = 263 Back     alignment and structure
>gi|62738242|pdb|1WE4|A Chain A, Crystal Structure Of Class A Beta-Lactamase Toho-1 G238c Mutant Length = 262 Back     alignment and structure
>gi|38492412|pdb|1IYS|A Chain A, Crystal Structure Of Class A Beta-Lactamase Toho-1 Length = 262 Back     alignment and structure
>gi|27573660|pdb|1IYO|A Chain A, Toho-1 Beta-Lactamase In Complex With Cefotaxime Length = 262 Back     alignment and structure
>gi|66361079|pdb|1YLT|A Chain A, Atomic Resolution Structure Of Ctx-M-14 Beta-Lactamase Length = 263 Back     alignment and structure
>gi|146387089|pdb|2P74|A Chain A, Ctx-M-9 Class A Beta-Lactamase Apo Crystal Structure At 0.88 Angstrom Resolution Length = 263 Back     alignment and structure
>gi|66361077|pdb|1YLJ|A Chain A, Atomic Resolution Structure Of Ctx-M-9 Beta-Lactamase Length = 263 Back     alignment and structure
>gi|325533930|pdb|3N4I|A Chain A, Crystal Structure Of The Shv-1 D104e Beta-LactamaseBETA-Lactamase Inhibitor Protein (Blip) Complex Length = 265 Back     alignment and structure
>gi|66361080|pdb|1YLW|A Chain A, X-Ray Structure Of Ctx-M-16 Beta-Lactamase Length = 263 Back     alignment and structure
>gi|30749600|pdb|1N9B|A Chain A, Ultrahigh Resolution Structure Of A Class A Beta-Lactamase: On The Mechanism And Specificity Of The Extended-Spectrum Shv-2 Enzyme Length = 265 Back     alignment and structure
>gi|110590178|pdb|2G2W|A Chain A, Crystal Structure Of The Shv D104k Beta-LactamaseBETA- Lactamase Inhibitor Protein (Blip) Complex Length = 265 Back     alignment and structure
>gi|66361078|pdb|1YLP|A Chain A, Atomic Resolution Structure Of Ctx-M-27 Beta-Lactamase Length = 263 Back     alignment and structure
>gi|56966062|pdb|1TDG|A Chain A, Complex Of S130g Shv-1 Beta-Lactamase With Tazobactam Length = 265 Back     alignment and structure
>gi|5107689|pdb|1SHV|A Chain A, Structure Of Shv-1 Beta-Lactamase Length = 265 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target336 peptidase S11, D-alanyl-D-alanine carboxypeptidase 1 [C
1es5_A262 DD-transpeptidase; penicillin-binding, serine peptidase 7e-47
3a3j_A344 PBP5; penicillin binding protein 5, DACA, hydrolase; 2. 1e-41
3mfd_A334 D-alanyl-D-alanine carboxypeptidase DACB; penicillin-bi 7e-41
3ita_A352 D-alanyl-D-alanine carboxypeptidase DACC; ppenicillin-b 3e-38
1n9b_A265 Penicillinase, beta-lactamase SHV-2; beta-lactam hydrol 4e-37
3hun_A453 Penicillin-binding protein 4; ampicillin, beta-lactamas 4e-36
1z6f_A363 Penicillin-binding protein 5; peptidoglycan synthesis, 7e-36
1m40_A263 TEM-1, beta-lactamase TEM; acylation mechanism, ultra- 2e-35
1o7e_A276 L2 beta lactamase; hydrolase, class A; 1.51A {Stenotrop 2e-34
1tvf_A369 PBP4, penicillin binding protein 4; structural genomics 1e-33
1g6a_A271 Beta-lactamase PSE-4; class A beta-lactamase, carbenici 5e-33
3cg5_A265 Beta-lactamase, penicillinase; alpha-beta structure, co 2e-32
3m6b_A265 Beta-lactamase, penicillinase; alpha-beta structure, an 1e-31
3lez_A260 Beta-lactamase; antibiotic resistance, halotolerant, DE 2e-31
1hzo_A271 Beta-lactamase; mixed alpha/beta, cephalosporinase, hyd 4e-31
2p74_A263 Beta-lactamase CTX-M-9A; ultra-high resolution, acylati 2e-30
3dw0_A294 Class A carbapenemase KPC-2; beta-lactamase, antibiotic 3e-30
1bue_A265 Protein (imipenem-hydrolysing beta-lactamase); hydrolas 9e-30
1xp4_A379 D-alanyl-D-alanine carboxypeptidase; five-stranded anti 9e-29
3c5a_A264 Class A carbapenemase KPC-2; beta-lactamase, C-terminal 2e-28
2cc1_A262 Beta-lactamase, penicillinase; hydrolase, antibiotic re 6e-28
1ghp_A258 Beta-lactamase, penicillinase; hydrolase, antibiotic re 2e-27
2wk0_A265 Beta-lactamase; hydrolase, iodopenicillanate, antibioti 4e-27
1e25_A282 Extended-spectrum beta-lactamase PER-1; hydrolase, anti 4e-27
1bsg_A266 Beta lactamase, penicillinase; hydrolase, antibiotic re 1e-26
2bcf_A276 Probable D-alanyl-D-alanine carboxypeptidase DACB2; pen 2e-26
3p09_A290 Beta-lactamase; structural genomics, center for structu 4e-25
3cjm_A282 Putative beta-lactamase; NP_815223.1, structural genomi 7e-25
2qpn_A287 Beta-lactamase GES-1; APO-enzyme, plasmid, hydrolase; 1 2e-24
1w7f_A307 Beta-lactamase; hydrolase, isocitrate, bacillus licheni 8e-22
2j9o_A298 TLL2115 protein; penicillin-binding protein, hydrolase, 3e-26
1alq_A266 CP254 beta-lactamase; hydrolase, circular permuted, ant 4e-20
2wuq_A318 BLAB, beta-lactamase regulatory protein BLAB; class A b 4e-10
1w79_A 489 D-alanyl-D-alanine carboxypeptidase; penicillin-binding 7e-04
1w5d_A 462 Penicillin-binding protein; D-Ala-D-Ala-carboxypeptidas 0.002
3a3d_A 453 PBP4, penicillin-binding protein 4; DACB, hydrolase; 1. 0.002
>1es5_A DD-transpeptidase; penicillin-binding, serine peptidase, beta-lactamase, hydrolase carboxypeptidase; 1.40A {Streptomyces SP} SCOP: e.3.1.1 PDB: 1skf_A 1es2_A 1j9m_A 1esi_A 1es3_A 1es4_A Length = 262 Back     alignment and structure
 Score =  182 bits (464), Expect = 7e-47
 Identities = 63/254 (24%), Positives = 109/254 (42%), Gaps = 24/254 (9%)

Query: 31  YTLLDTNTGHVIAENYPDHPWNPASLTKLMTAYVVFSFLKEKKAMLTTPITISKNASEY- 89
              ++  TG  +     D   +  S TK+MTA VV   L +    L   +TI K  S+Y 
Sbjct: 11  GYAMNNGTGTTLYTKAADTRRSTGSTTKIMTAKVV---LAQSNLNLDAKVTIQKAYSDYV 67

Query: 90  ---PPSNSTFKKGSTMTLDNALKLLIVKSANDIAVAIAESL------CKTEKKFVQHMNN 140
                S +    G  +T+   L  L++ S  D A A+A+            K F+  MN 
Sbjct: 68  VANNASQAHLIVGDKVTVRQLLYGLMLPSGCDAAYALADKYGSGSTRAARVKSFIGKMNT 127

Query: 141 TSKNLGLSATHFMNAHGVVQHGHYTTARDMAILSWRIKTDFPQYMHYFQIK--------- 191
            + NLGL  THF +  G+    +Y+T RD+  ++     +   +    + K         
Sbjct: 128 AATNLGLHNTHFDSFDGIGNGANYSTPRDLTKIASSAMKN-STFRTVVKTKAYTAKTVTK 186

Query: 192 -GLEIKGKKYPNTNWAVGTFLGADGMKTGFTCASGFNIVASAIQGDQSLIAVILGALDRN 250
            G       + NTN  + ++ GA G+KTG    + + +V +A +G +++I  +L +    
Sbjct: 187 TGSIRTMDTWKNTNGLLSSYSGAIGVKTGAGPEAKYCLVFAATRGGKTVIGTVLASTSIP 246

Query: 251 TRNKVSASLLSMGF 264
            R   +  +++ GF
Sbjct: 247 ARESDATKIMNYGF 260


>3a3j_A PBP5; penicillin binding protein 5, DACA, hydrolase; 2.15A {Haemophilus influenzae} Length = 344 Back     alignment and structure
>3mfd_A D-alanyl-D-alanine carboxypeptidase DACB; penicillin-binding protein 5*, beta-lactamase, structural GE PSI-2, protein structure initiative; HET: CIT; 1.75A {Bacillus subtilis} Length = 334 Back     alignment and structure
>3ita_A D-alanyl-D-alanine carboxypeptidase DACC; ppenicillin-binding protein, BP6, DD-carboxypeptidase, peptidoglycan, ampicillin, acyl-enzyme complex; HET: AIX AIC; 1.80A {Escherichia coli} PDB: 3it9_A* 3itb_A* Length = 352 Back     alignment and structure
>1n9b_A Penicillinase, beta-lactamase SHV-2; beta-lactam hydrolase, detergent binding, drug design, radiation damage; HET: MA4 EPE; 0.90A {Klebsiella pneumoniae} SCOP: e.3.1.1 PDB: 3d4f_A* 2zd8_A* 1q2p_A* 1shv_A* 1vm1_A* 2g2u_A 2h5s_A* 1ong_A* 3c4o_A 3c4p_A 2a3u_A* 1tdg_A* 1tdl_A* 2a49_A* 2g2w_A 1rcj_A* 2h0t_A* 2h0y_A* 2h10_A* Length = 265 Back     alignment and structure
>3hun_A Penicillin-binding protein 4; ampicillin, beta-lactamase, serine type D-Ala, D-Ala-carboxypeptidase, hydrolase; HET: ZZ7; 2.00A {Staphylococcus aureus} PDB: 3hum_A* Length = 453 Back     alignment and structure
>1z6f_A Penicillin-binding protein 5; peptidoglycan synthesis, DD- carboxypeptidase, hydrolase, boronic acid; HET: BO9; 1.60A {Escherichia coli} SCOP: b.105.1.1 e.3.1.1 PDB: 1nzu_A 1nzo_A* 3beb_A* 3bec_A* 1nj4_A 1hd8_A 1sdn_A Length = 363 Back     alignment and structure
>1m40_A TEM-1, beta-lactamase TEM; acylation mechanism, ultra- high resolution, hydrolase; HET: CB4; 0.85A {Escherichia coli} SCOP: e.3.1.1 PDB: 1jwp_A* 1nxy_A* 1ny0_A* 1nym_A* 1nyy_A* 1pzo_A* 1erm_A* 1ero_A* 1erq_A* 1s0w_A 1xpb_A 1li0_A 1htz_A 1jtd_A 1esu_A 1jwz_A* 1li9_A 1jwv_A* 1jtg_A 1axb_A* ... Length = 263 Back     alignment and structure
>1o7e_A L2 beta lactamase; hydrolase, class A; 1.51A {Stenotrophomonas maltophilia} SCOP: e.3.1.1 PDB: 1n4o_A Length = 276 Back     alignment and structure
>1tvf_A PBP4, penicillin binding protein 4; structural genomics, nysgxrc target, SAV0642, PSI, protein structure initiative; 2.00A {Staphylococcus aureus} SCOP: b.105.1.2 e.3.1.1 Length = 369 Back     alignment and structure
>1g6a_A Beta-lactamase PSE-4; class A beta-lactamase, carbenicillinase, R234K mutant, hydrolase; 1.75A {Pseudomonas aeruginosa} SCOP: e.3.1.1 PDB: 1g68_A Length = 271 Back     alignment and structure
>3cg5_A Beta-lactamase, penicillinase; alpha-beta structure, covalent adduct, antibiotic resistance, hydrolase, lipoprotein, membrane; HET: ISS; 1.70A {Mycobacterium tuberculosis} PDB: 3dwz_A* 2gdn_A Length = 265 Back     alignment and structure
>3m6b_A Beta-lactamase, penicillinase; alpha-beta structure, antibiotic resistance, cell membrane, hydrolase, lipoprotein, membrane; HET: 1RG; 1.30A {Mycobacterium tuberculosis} PDB: 3dwz_A* 3iqa_A* 3cg5_A* 3m6h_A* 2gdn_A Length = 265 Back     alignment and structure
>3lez_A Beta-lactamase; antibiotic resistance, halotolerant, DEEP- SEA bacterium, hydrolase; HET: EPE; 1.25A {Oceanobacillus iheyensis} Length = 260 Back     alignment and structure
>1hzo_A Beta-lactamase; mixed alpha/beta, cephalosporinase, hydrolase; HET: MES; 1.75A {Proteus vulgaris} SCOP: e.3.1.1 Length = 271 Back     alignment and structure
>2p74_A Beta-lactamase CTX-M-9A; ultra-high resolution, acylation, ESBL, hydrolase; HET: PO4; 0.88A {Escherichia coli} PDB: 3g2y_A* 1ylj_A* 1yly_A* 1ym1_A* 1yms_A* 1ymx_A* 3g2z_A* 3g30_A* 3g31_A* 3g32_A* 3g34_A* 3g35_A* 1ylt_A* 1ylz_A* 1ylw_A 1ylp_A* 1iys_A 2zq8_A* 1we4_A 1bza_A ... Length = 263 Back     alignment and structure
>3dw0_A Class A carbapenemase KPC-2; beta-lactamase, antibiotic resistance, hydrolase; 1.60A {Escherichia coli} Length = 294 Back     alignment and structure
>1bue_A Protein (imipenem-hydrolysing beta-lactamase); hydrolase, antibiotic resistance, class A carbapenemase; 1.64A {Enterobacter cloacae} SCOP: e.3.1.1 PDB: 1bul_A* 1dy6_A Length = 265 Back     alignment and structure
>1xp4_A D-alanyl-D-alanine carboxypeptidase; five-stranded antiparallel beta-sheet, omega-like loop, hydrolase; 2.80A {Streptococcus pneumoniae R6} SCOP: b.105.1.1 e.3.1.1 Length = 379 Back     alignment and structure
>3c5a_A Class A carbapenemase KPC-2; beta-lactamase, C-terminal deleted mutant, plasmid, hydrolase; HET: CIT; 1.23A {Escherichia coli} PDB: 2ods_A 2ov5_A* 3e2k_A 3e2l_A* Length = 264 Back     alignment and structure
>2cc1_A Beta-lactamase, penicillinase; hydrolase, antibiotic resistance, broad-spectrum; 2.13A {Mycobacterium fortuitum} SCOP: e.3.1.1 Length = 262 Back     alignment and structure
>1ghp_A Beta-lactamase, penicillinase; hydrolase, antibiotic resistance, beta-lactam hydrolysis, benzylpenicillin, cephaloridine; HET: PNM; 1.76A {Staphylococcus aureus} SCOP: e.3.1.1 PDB: 1ghi_A* 1ghm_A* 1kgf_A 1kge_A 1ome_A 1kgg_A 1dja_A 3blm_A 1blh_A* 1blc_A 1djc_A 1djb_A 1blp_A 1pio_A Length = 258 Back     alignment and structure
>2wk0_A Beta-lactamase; hydrolase, iodopenicillanate, antibiotic resistance; HET: BIY CIT; 1.65A {Bacillus licheniformis} PDB: 3b3x_A* 1i2s_A* 1i2w_A* 2blm_A 4blm_A 1mbl_A Length = 265 Back     alignment and structure
>1e25_A Extended-spectrum beta-lactamase PER-1; hydrolase, antibiotic resistance, class A cephalosporinase; 1.9A {Pseudomonas aeruginosa} SCOP: e.3.1.1 Length = 282 Back     alignment and structure
>1bsg_A Beta lactamase, penicillinase; hydrolase, antibiotic resistance; 1.85A {Streptomyces albus G} SCOP: e.3.1.1 Length = 266 Back     alignment and structure
>2bcf_A Probable D-alanyl-D-alanine carboxypeptidase DACB2; penicillin-binding protein, DD-2 carboxypeptidase, directed evolution; 2.30A {Mycobacterium tuberculosis} Length = 276 Back     alignment and structure
>3p09_A Beta-lactamase; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta sandwich, cytosol; HET: MSE; 1.90A {Francisella tularensis subsp} Length = 290 Back     alignment and structure
>3cjm_A Putative beta-lactamase; NP_815223.1, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; HET: MSE; 1.50A {Enterococcus faecalis V583} Length = 282 Back     alignment and structure
>2qpn_A Beta-lactamase GES-1; APO-enzyme, plasmid, hydrolase; 1.10A {Klebsiella pneumoniae} Length = 287 Back     alignment and structure
>1w7f_A Beta-lactamase; hydrolase, isocitrate, bacillus licheniformis hydrolase; HET: ICT; 1.80A {Bacillus licheniformis} Length = 307 Back     alignment and structure
>2j9o_A TLL2115 protein; penicillin-binding protein, hydrolase, lactamase, thioesterase, DD-peptidase; 1.50A {Synechococcus elongatus} PDB: 2jbf_A* 2j7v_A 2j8y_A* Length = 298 Back     alignment and structure
>1alq_A CP254 beta-lactamase; hydrolase, circular permuted, antibiotic resistance; 1.80A {Staphylococcus aureus} SCOP: e.3.1.1 Length = 266 Back     alignment and structure
>2wuq_A BLAB, beta-lactamase regulatory protein BLAB; class A beta-lactamase fold, transcription regulation, beta-lactamase induction, transcription; 1.80A {Streptomyces cacaoi} Length = 318 Back     alignment and structure
>1w79_A D-alanyl-D-alanine carboxypeptidase; penicillin-binding, peptidoglycan, transpeptidase, antibiotic resistance, hydrolase; 1.8A {Actinomadura SP} SCOP: e.3.1.3 PDB: 1w8q_A 1w8y_A* 2vgj_A* 2vgk_A* Length = 489 Back     alignment and structure
>1w5d_A Penicillin-binding protein; D-Ala-D-Ala-carboxypeptidase, peptidoglycan, beta-lactam, hydrolase, peptidoglycan synthesis; 2.1A {Bacillus subtilis} SCOP: e.3.1.3 PDB: 2j9p_A* Length = 462 Back     alignment and structure
>3a3d_A PBP4, penicillin-binding protein 4; DACB, hydrolase; 1.60A {Haemophilus influenzae} PDB: 3a3e_A* 3a3f_A* 3a3i_A* Length = 453 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target336 peptidase S11, D-alanyl-D-alanine carboxypeptidase 1 [C
3ita_A352 D-alanyl-D-alanine carboxypeptidase DACC; ppenicillin-b 100.0
1z6f_A363 Penicillin-binding protein 5; peptidoglycan synthesis, 100.0
3a3j_A344 PBP5; penicillin binding protein 5, DACA, hydrolase; 2. 100.0
1xp4_A379 D-alanyl-D-alanine carboxypeptidase; five-stranded anti 100.0
3hun_A453 Penicillin-binding protein 4; ampicillin, beta-lactamas 100.0
3mfd_A334 D-alanyl-D-alanine carboxypeptidase DACB; penicillin-bi 100.0
1tvf_A369 PBP4, penicillin binding protein 4; structural genomics 100.0
1es5_A262 DD-transpeptidase; penicillin-binding, serine peptidase 100.0
2bcf_A276 Probable D-alanyl-D-alanine carboxypeptidase DACB2; pen 100.0
2cc1_A262 Beta-lactamase, penicillinase; hydrolase, antibiotic re 100.0
3dw0_A294 Class A carbapenemase KPC-2; beta-lactamase, antibiotic 100.0
2j9o_A298 TLL2115 protein; penicillin-binding protein, hydrolase, 100.0
1n9b_A265 Penicillinase, beta-lactamase SHV-2; beta-lactam hydrol 100.0
2wk0_A265 Beta-lactamase; hydrolase, iodopenicillanate, antibioti 100.0
1o7e_A276 L2 beta lactamase; hydrolase, class A; 1.51A {Stenotrop 100.0
3p09_A290 Beta-lactamase; structural genomics, center for structu 100.0
1hzo_A271 Beta-lactamase; mixed alpha/beta, cephalosporinase, hyd 100.0
1g6a_A271 Beta-lactamase PSE-4; class A beta-lactamase, carbenici 100.0
1e25_A282 Extended-spectrum beta-lactamase PER-1; hydrolase, anti 100.0
3cjm_A282 Putative beta-lactamase; NP_815223.1, structural genomi 100.0
1ghp_A258 Beta-lactamase, penicillinase; hydrolase, antibiotic re 99.97
1k38_A254 Penicillinase, beta-lactamase OXA-2; serine beta-lactam 99.18
1ei5_A 520 D-aminopeptidase, DAP; penicillin binding protein, alph 98.9
3equ_A542 PBP-2, penicillin-binding protein 2; class B transpepti 98.5
1w7f_A307 Beta-lactamase; hydrolase, isocitrate, bacillus licheni 100.0
2qpn_A287 Beta-lactamase GES-1; APO-enzyme, plasmid, hydrolase; 1 100.0
1m40_A263 TEM-1, beta-lactamase TEM; acylation mechanism, ultra- 100.0
3m6b_A265 Beta-lactamase, penicillinase; alpha-beta structure, an 100.0
2p74_A263 Beta-lactamase CTX-M-9A; ultra-high resolution, acylati 100.0
3c5a_A264 Class A carbapenemase KPC-2; beta-lactamase, C-terminal 100.0
1bue_A265 Protein (imipenem-hydrolysing beta-lactamase); hydrolas 100.0
1bsg_A266 Beta lactamase, penicillinase; hydrolase, antibiotic re 100.0
3lez_A260 Beta-lactamase; antibiotic resistance, halotolerant, DE 100.0
1alq_A266 CP254 beta-lactamase; hydrolase, circular permuted, ant 99.96
2wuq_A318 BLAB, beta-lactamase regulatory protein BLAB; class A b 99.91
3hbr_A265 OXA-48; class D beta-lactamase, antibiotic, dimer, hydr 99.34
2iwb_A246 Methicillin resistance MECR1 protein; antibiotic resist 99.19
1nrf_A262 Regulatory protein BLAR1; penicillin-receptor, beta-lac 99.18
1k55_A246 Beta lactamase OXA-10; antibiotic resistance, carbamyla 99.02
3g4p_A244 Beta-lactamase OXA-24; plasmid, B-lactamases, enzyme me 99.02
3isg_A251 Penicillinase, beta-lactamase OXA-1; hydrolase, lysine 99.0
1xkz_A255 Regulatory protein BLAR1; beta-lactam receptor, signal 98.98
3fwm_A751 Penicillin-binding protein 1B; bacterial cell WALL synt 98.33
3a3d_A453 PBP4, penicillin-binding protein 4; DACB, hydrolase; 1. 99.71
1w5d_A462 Penicillin-binding protein; D-Ala-D-Ala-carboxypeptidas 99.61
2ex2_A458 Penicillin-binding protein 4; cephem, penem, D- alanyl- 99.57
1w79_A489 D-alanyl-D-alanine carboxypeptidase; penicillin-binding 99.52
1zkj_A359 CMY-10, extended-spectrum beta-lactamase; plasmid, clas 99.07
2ffy_A358 Beta-lactamase; AMPC, deacylation, transition state, bo 99.06
2wzx_A371 Beta-lactamase; inhibitor, hydrolase, antibiotic resist 99.04
3i7j_A280 Beta-lactamase MB2281C; alpha-beta protein., structural 99.04
2qmi_A447 PBP related beta-lactamase; PAB87, octamer, LU-HPDO3A, 99.01
2drw_A363 DAA, D-amino acid amidase; penicillin recognizing prote 98.95
1yqs_A349 D-alanyl-D-alanine carboxypeptidase; cell well biosynth 98.93
3ozh_A351 Beta-lactamase/D-alanine carboxypeptidase; structural g 98.81
3hlc_A432 Transesterase, LOVD; alpha/beta hydrolase fold, transfe 98.73
2qz6_A358 Beta-lactamase; psychrophIle, cold adaptation, antibiot 98.71
2dcf_A392 6-aminohexanoate-dimer hydrolase; HET: ACA MES; 1.40A { 98.66
3lo7_A483 PBPA, penicillin-binding protein A; transpeptidase doma 98.54
2wad_A680 Penicillin-binding protein 2B; peptidoglycan synthesis, 98.52
1qme_A 702 Penicillin-binding protein 2X; peptidoglycan synthesis, 98.5
2v2f_F390 Penicillin binding protein 1A; transpeptidase activity, 98.47
3oc2_A564 Penicillin-binding protein 3; structu genomics, oxford 98.47
1vqq_A646 Saupbp2A, penicillin-binding protein MECA, low-affinity 97.78
2olv_A669 Penicillin-binding protein 2; transpeptidase fold, glyc 96.75
2bg1_A494 PBP1B, penicillin-binding protein 1B; peptidoglycan, pe 96.72
2jch_A720 Penicillin-binding protein 1B; peptidoglycan synthesis 94.99
1ci9_A392 ESTB, protein (carboxylesterase); hydrolase, caboxylest 98.85
>3ita_A D-alanyl-D-alanine carboxypeptidase DACC; ppenicillin-binding protein, BP6, DD-carboxypeptidase, peptidoglycan, ampicillin, acyl-enzyme complex; HET: AIX AIC; 1.80A {Escherichia coli} PDB: 3it9_A* 3itb_A* Back     alignment and structure
Probab=100.00  E-value=0  Score=566.61  Aligned_cols=316  Identities=31%  Similarity=0.356  Sum_probs=267.1

Q ss_pred             CCCCCCCCCCCEEEEEECCCCEEEEEECCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCEEEECHHHHH------CCCC
Q ss_conf             3578754478568999978962977643998307526989999999985135777787660351787720------0366
Q gi|254780435|r   19 FLSIAETNKLPYYTLLDTNTGHVIAENYPDHPWNPASLTKLMTAYVVFSFLKEKKAMLTTPITISKNASE------YPPS   92 (336)
Q Consensus        19 ~~~~~~~~~a~~~i~~d~~tG~iL~~kn~~~~~~~AS~tKlmTa~~~~~~i~~g~~~ld~~v~vs~~~~~------~~~s   92 (336)
                      ....+|.+.|++|+|||++||+|||+||+|+++||||+|||||+|+++|+++.|+++||++|++|++++.      .++|
T Consensus         4 ~~~~~P~i~a~aaiv~d~~tG~iL~~kn~~~~~~pASlTKlMTa~v~~e~i~~~~~~l~~~v~vs~~a~~~~~~~~~~~s   83 (352)
T 3ita_A            4 QTVEAPSVDARAWILMDYASGKVLAEGNADEKLDPASLTKIMTSYVVGQALKADKIKLTDMVTVGKDAWATGNPALRGSS   83 (352)
T ss_dssp             -CCCCCCCCSSEEEEEETTTCCEEEEESTTCCBCCGGGHHHHHHHHHHHHHHTTSSCTTCEEECCGGGSTTTCGGGTTSS
T ss_pred             CCCCCCCCCEEEEEEEECCCCCCHHHCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCEEEECHHHHHHCCCCCCCCC
T ss_conf             88889973215999999999979632590998622899999999999998763899978669946999851044556873


Q ss_pred             CCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCCCEEECCCCCCCCCCCCCHHHHHH
Q ss_conf             44345101234677767677742358999997640111789999999999870983534412357646222256999999
Q gi|254780435|r   93 NSTFKKGSTMTLDNALKLLIVKSANDIAVAIAESLCKTEKKFVQHMNNTSKNLGLSATHFMNAHGVVQHGHYTTARDMAI  172 (336)
Q Consensus        93 ~~~l~~g~~~tv~dll~~~li~S~Ndaa~aLAe~i~Gs~~~Fv~~MN~~a~~lG~~~T~f~n~~Gl~~~~~~tTa~Dla~  172 (336)
                      .++|++|+++|++|||++||++|+||||++|||+++||+++||++||++|++|||+||||.|||||++++|||||+||++
T Consensus        84 ~~~l~~g~~~tv~dLL~~~li~SaNdAA~aLA~~i~Gs~~~Fv~~MN~kAkelG~~~T~f~np~Gl~~~~~~tta~Dla~  163 (352)
T 3ita_A           84 VMFLKPGDQVSVADLNKGVIIQSGNDACIALADYVAGSQESFIGLMNGYAKKLGLTNTTFQTVHGLDAPGQFSTARDMAL  163 (352)
T ss_dssp             CCCCCTTCEEEHHHHHHHHHTTCCHHHHHHHHHHHHSSHHHHHHHHHHHHHHTTCTTCBCCCSSCCCCTTCBBCHHHHHH
T ss_pred             EEEECCCCEEEHHHHHHHHHHHCCCHHHHHHHHHCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCHHHHHH
T ss_conf             35413899999999999988751529999998752899999999999999984899821557777787556346999999


Q ss_pred             HHHHHHHHHHHHHCCCCEEECCCCCEEEEECCCCCCCC-CCEEEEEEECCHHHHHEEEEEEEECCEEEEEEEECCCCHHH
Q ss_conf             98987631233110123020001744786014565668-97115332124112000234564288689999837898667
Q gi|254780435|r  173 LSWRIKTDFPQYMHYFQIKGLEIKGKKYPNTNWAVGTF-LGADGMKTGFTCASGFNIVASAIQGDQSLIAVILGALDRNT  251 (336)
Q Consensus       173 l~~~~~~~~p~~~~~~~~~~~~~~~~~~~N~N~ll~~~-~gv~G~KTG~t~~AG~~lv~~a~~~g~~li~Vvlg~~~~~~  251 (336)
                      |++++++++|++..+++.+.+.+.++.+.|+|++|+.+ ++++|+|||||++||+||+++++|||+|+|+||||+++...
T Consensus       164 l~~~~~~~~~~~~~~~~~~~~~~~~~~~~N~n~ll~~~~~~i~G~KTG~t~~aG~~lv~~a~~~g~~~i~Vvlg~~~~~~  243 (352)
T 3ita_A          164 LGKALIHDVPEEYAIHKEKEFTFNKIRQPNRNRLLWSSNLNVDGMKTGTTAGAGYNLVASATQGDMRLISVVLGAKTDRI  243 (352)
T ss_dssp             HHHHHHHHCHHHHGGGGCCEEEETTEEEECCCGGGGCSSCEEEEEEEEEETTTEEEEEEEEEETTEEEEEEEEEESSHHH
T ss_pred             HHHHHHHCCCCEEEEEEEEEEECCCEECCCCCCHHCCCCCEEEEEEEEEECCCCCEEEEEEEECCEEEEEEEECCCCHHH
T ss_conf             99997336821077500678704861136767001167827556998874147860899998599069999967998778


Q ss_pred             HHHHHHHHHHHHHHHCCCCCCCCCCCCCC---CCCCCCCCCCC-CCCCEEECCCCCCCCCCCCCCCCCCCCCCCCCEEEE
Q ss_conf             89999999999985145320234554552---01455542346-543202113455432332113444454426811200
Q gi|254780435|r  252 RNKVSASLLSMGFYNKTDRKKINYIIKDF---YQQNLSNEVPN-ISEEVCTTQKEIINYNTQMKEAKDKESHFIDFEKIT  327 (336)
Q Consensus       252 r~~~~~~Ll~~~f~~f~~~~~~~~~~~~~---~~~~~~~~~~~-~~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~ki~  327 (336)
                      ||.++++|+||+|++|....++.+.....   .+.+....++. ...++..............+.........+|+++++
T Consensus       244 r~~d~~~Ll~~~f~~~~~~~~~~~~~~~~~~~V~~g~~~~v~l~~~~~~~~~lpk~~~~~~~~~i~~~~~~l~APVkkG~  323 (352)
T 3ita_A          244 RFNESEKLLTWGFRFFETVTPIKPDATFVTQRVWFGDKSEVNLGAGEAGSVTIPRGQLKNLKASYTLTEPQLTAPLKKGQ  323 (352)
T ss_dssp             HHHHHHHHHHHHHHHEEEECSSCTTCCSEEEEEESBSSSEEEEECGGGCCEEEETTCGGGEEEEEEESSSSEESCBCTTC
T ss_pred             HHHHHHHHHHHHHHHEEEEEEECCCCCCCCEEEECCCCCEEEEEECCCEEEEEECCCCCCEEEEEEECCCCEEECCCCCC
T ss_conf             89999999999975348865301444443104753765389999788779999889756628999987883440568998


Q ss_pred             ECCCEEC
Q ss_conf             0133010
Q gi|254780435|r  328 LLKNKIT  334 (336)
Q Consensus       328 ~~~~~i~  334 (336)
                      .+|+...
T Consensus       324 ~VG~l~v  330 (352)
T 3ita_A          324 VVGTIDF  330 (352)
T ss_dssp             EEEEEEE
T ss_pred             EEEEEEE
T ss_conf             9999999



>1z6f_A Penicillin-binding protein 5; peptidoglycan synthesis, DD- carboxypeptidase, hydrolase, boronic acid; HET: BO9; 1.60A {Escherichia coli} SCOP: b.105.1.1 e.3.1.1 PDB: 1nzu_A 1nzo_A* 3beb_A* 3bec_A* 1nj4_A 1hd8_A 1sdn_A Back     alignment and structure
>3a3j_A PBP5; penicillin binding protein 5, DACA, hydrolase; 2.15A {Haemophilus influenzae} Back     alignment and structure
>1xp4_A D-alanyl-D-alanine carboxypeptidase; five-stranded antiparallel beta-sheet, omega-like loop, hydrolase; 2.80A {Streptococcus pneumoniae R6} SCOP: b.105.1.1 e.3.1.1 Back     alignment and structure
>3hun_A Penicillin-binding protein 4; ampicillin, beta-lactamase, serine type D-Ala, D-Ala-carboxypeptidase, antibiotics; HET: ZZ7; 2.00A {Staphylococcus aureus} PDB: 3hum_A* Back     alignment and structure
>3mfd_A D-alanyl-D-alanine carboxypeptidase DACB; penicillin-binding protein 5*, beta-lactamase, structural GE PSI-2, protein structure initiative; HET: CIT; 1.75A {Bacillus subtilis} Back     alignment and structure
>1tvf_A PBP4, penicillin binding protein 4; structural genomics, nysgxrc target, SAV0642, PSI, protein structure initiative; 2.00A {Staphylococcus aureus} SCOP: b.105.1.2 e.3.1.1 Back     alignment and structure
>1es5_A DD-transpeptidase; penicillin-binding, serine peptidase, beta-lactamase, hydrolase carboxypeptidase; 1.40A {Streptomyces SP} SCOP: e.3.1.1 PDB: 1skf_A 1es2_A 1j9m_A 1esi_A 1es3_A 1es4_A Back     alignment and structure
>2bcf_A Probable D-alanyl-D-alanine carboxypeptidase DACB2; penicillin-binding protein, DD-2 carboxypeptidase, directed evolution; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>2cc1_A Beta-lactamase, penicillinase; hydrolase, antibiotic resistance, broad-spectrum; 2.13A {Mycobacterium fortuitum} SCOP: e.3.1.1 Back     alignment and structure
>3dw0_A Class A carbapenemase KPC-2; beta-lactamase, antibiotic resistance, hydrolase; 1.60A {Escherichia coli} Back     alignment and structure