254780438

254780438

pyridoxine 5'-phosphate synthase

GeneID in NCBI database:8209424Locus tag:CLIBASIA_01615
Protein GI in NCBI database:254780438Protein Accession:YP_003064851.1
Gene range:+(345013, 345798)Protein Length:261aa
Gene description:pyridoxine 5'-phosphate synthase
COG prediction:none
KEGG prediction:pdxJ; pyridoxine 5'-phosphate synthase; K03474 pyridoxine 5-phosphate synthase [EC:2.6.99.2]
SEED prediction:Pyridoxine-phosphate synthase (EC 2.6.99.2)
Pathway involved in KEGG:Vitamin B6 metabolism [PATH:las00750]
Subsystem involved in SEED:Pyridoxin (Vitamin B6) Biosynthesis
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-
MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRRACGQHLDNTMRLTHPVK
ccccccEEEHHHHHHHHccccccccHHHHHHHHHHccccEEEEEcccccccccHHHHHHHHHHHHcccccccEEccccccHHHHHHHHHccccEEEEccccHHHcccccccHHHccHHHHHHHHHHHHHcccEEEEEEcccccHHHHHHHHHccccEEEEEcccHHHHcccHHHHHHHHHHHHHHHHHHHHcccEEEEcccccHHHHHHHHHHccccEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccc
ccccEEEEcHHHHHHHHccccccccHHHHHHHHHcccccEEEEEcccccccccHHHHHHHHHHccHHHHcccccccccccHHHHHHHHHHccccEEEcccccccccccccccHHHHHHHHHHHHHHHHHcccEEEEEEcccccHHHHHHHHHccccEEEEcccccccccccHHHHHHHHHHHHHHHHHHHHcccEEEccccccccccHHHHHHcccHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHcccccccccccc
MSTSVSVNLNAVAVLRnrrnlpwpnlvHIGKIAlqsgasgltvhprpdqrhirytdlPEIRRLIDeqfpkaelniegypnetFLNLCerykpeqitlvpddphqltsdhgwdfLQNQALLTKTVARLHNLGSRislfadgngnehSLQAAKLTgadcielytgpygacynnpqqERIFLNKLAITAQLAQKMDLQinaghdltiqnipnlinaipyiseisvGHAFAATALECGVKEAVFCFRRACGqhldntmrlthpvk
MSTSVSVNLNAVAVlrnrrnlpwpnLVHIGKIALQSgasgltvhprpdqrhirytdLPEIRRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRRACGqhldntmrlthpvk
MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRRACGQHLDNTMRLTHPVK
MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRRACGQHL***********
MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRRACGQHLDNTMRLTHPVK
*STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRRACGQHLDNTMRLTH***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRRACGQHLDNTMRLTHPVK
MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRRACGQHLDNTMRLTHPVK
MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRRACGQHLDNTMRLTHPVK

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target261 pyridoxine 5'-phosphate synthase [Candidatus Liberibact
254781094 702 glycyl-tRNA synthetase subunit beta [Candidatus Li 0.008
>gi|254781094|ref|YP_003065507.1| glycyl-tRNA synthetase subunit beta [Candidatus Liberibacter asiaticus str. psy62] Length = 702 Back     alignment
 Score = 32.3 bits (72), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 29/57 (50%), Gaps = 7/57 (12%)

Query: 142 GNEHS-LQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAITAQLAQKMDLQIN 197
           G E++ LQ   ++  D IE +  P G   N P       NK++IT  LA K+D  IN
Sbjct: 438 GKEYAVLQNENISCCDAIEEHLKPRGPLENVPT------NKISITVSLADKLDTLIN 488

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target261 pyridoxine 5'-phosphate synthase [Candidatus Liberibact
315122113251 pyridoxine 5'-phosphate synthase [Candidatus Liberibact 1 1e-116
222149066250 pyridoxine 5'-phosphate synthase [Agrobacterium vitis S 1 7e-90
86358373250 pyridoxal phosphate biosynthetic protein PdxJ [Rhizobiu 1 5e-89
218682862250 pyridoxine 5'-phosphate synthase [Rhizobium etli CIAT 8 1 3e-88
241205472250 pyridoxine 5'-phosphate synthase [Rhizobium leguminosar 1 1e-87
116252964250 pyridoxine 5'-phosphate synthase [Rhizobium leguminosar 1 1e-87
327191455250 pyridoxine 5'-phosphate synthase [Rhizobium etli CNPAF5 1 6e-87
218462778250 pyridoxine 5'-phosphate synthase [Rhizobium etli Kim 5] 1 8e-87
209550095250 pyridoxine 5'-phosphate synthase [Rhizobium leguminosar 1 1e-86
325293390251 Pyridoxine 5'-phosphate synthase [Agrobacterium sp. H13 1 1e-86
>gi|315122113|ref|YP_004062602.1| pyridoxine 5'-phosphate synthase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 251 Back     alignment and organism information
 Score =  421 bits (1081), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 198/248 (79%), Positives = 221/248 (89%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           MST+VS+NLNAVA+LRNRRNLPWP+LVHIG+IALQSGASGLTVHPRPDQRHIRYTDLP+I
Sbjct: 1   MSTNVSINLNAVAMLRNRRNLPWPDLVHIGRIALQSGASGLTVHPRPDQRHIRYTDLPKI 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R+LIDE+FPKAELNIEGYPNE FL LCE YKPEQ TLVPDDP+QLTSDHGWDF+ NQ LL
Sbjct: 61  RQLIDEEFPKAELNIEGYPNEKFLFLCENYKPEQATLVPDDPNQLTSDHGWDFVNNQKLL 120

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
           T+TV++LH+LG R+SLFADG+G++  LQ AKLTGADCIELYTGPYGACY+NPQQE I L 
Sbjct: 121 TRTVSKLHDLGCRVSLFADGDGHKDCLQRAKLTGADCIELYTGPYGACYDNPQQESILLE 180

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
           KLA+TA LAQ M  +INAGHDLTIQNIP L+ +IPYISEISVGHAF   ALE G KEAV 
Sbjct: 181 KLALTAHLAQDMHFKINAGHDLTIQNIPQLVASIPYISEISVGHAFTVAALEYGTKEAVL 240

Query: 241 CFRRACGQ 248
            FR ACGQ
Sbjct: 241 RFRHACGQ 248


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222149066|ref|YP_002550023.1| pyridoxine 5'-phosphate synthase [Agrobacterium vitis S4] Length = 250 Back     alignment and organism information
>gi|86358373|ref|YP_470265.1| pyridoxal phosphate biosynthetic protein PdxJ [Rhizobium etli CFN 42] Length = 250 Back     alignment and organism information
>gi|218682862|ref|ZP_03530463.1| pyridoxine 5'-phosphate synthase [Rhizobium etli CIAT 894] Length = 250 Back     alignment and organism information
>gi|241205472|ref|YP_002976568.1| pyridoxine 5'-phosphate synthase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 250 Back     alignment and organism information
>gi|116252964|ref|YP_768802.1| pyridoxine 5'-phosphate synthase [Rhizobium leguminosarum bv. viciae 3841] Length = 250 Back     alignment and organism information
>gi|327191455|gb|EGE58477.1| pyridoxine 5'-phosphate synthase [Rhizobium etli CNPAF512] Length = 250 Back     alignment and organism information
>gi|218462778|ref|ZP_03502869.1| pyridoxine 5'-phosphate synthase [Rhizobium etli Kim 5] Length = 250 Back     alignment and organism information
>gi|209550095|ref|YP_002282012.1| pyridoxine 5'-phosphate synthase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 250 Back     alignment and organism information
>gi|325293390|ref|YP_004279254.1| Pyridoxine 5'-phosphate synthase [Agrobacterium sp. H13-3] Length = 251 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target261 pyridoxine 5'-phosphate synthase [Candidatus Liberibact
PRK05265239 PRK05265, PRK05265, pyridoxine 5'-phosphate synthase; P 3e-84
COG0854243 COG0854, PdxJ, Pyridoxal phosphate biosynthesis protein 6e-70
pfam03740239 pfam03740, PdxJ, Pyridoxal phosphate biosynthesis prote 1e-66
TIGR00559237 TIGR00559, pdxJ, pyridoxine 5'-phosphate synthase 3e-48
cd00003234 cd00003, PNPsynthase, Pyridoxine 5'-phosphate (PNP) syn 1e-71
>gnl|CDD|179983 PRK05265, PRK05265, pyridoxine 5'-phosphate synthase; Provisional Back     alignment and domain information
>gnl|CDD|31195 COG0854, PdxJ, Pyridoxal phosphate biosynthesis protein [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|112550 pfam03740, PdxJ, Pyridoxal phosphate biosynthesis protein PdxJ Back     alignment and domain information
>gnl|CDD|129650 TIGR00559, pdxJ, pyridoxine 5'-phosphate synthase Back     alignment and domain information
>gnl|CDD|58644 cd00003, PNPsynthase, Pyridoxine 5'-phosphate (PNP) synthase domain; pyridoxal 5'-phosphate is the active form of vitamin B6 that acts as an essential, ubiquitous coenzyme in amino acid metabolism Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 261 pyridoxine 5'-phosphate synthase [Candidatus Liberibact
PRK05265240 pyridoxine 5'-phosphate synthase; Provisional 100.0
pfam03740239 PdxJ Pyridoxal phosphate biosynthesis protein PdxJ. Mem 100.0
cd00003234 PNPsynthase Pyridoxine 5'-phosphate (PNP) synthase doma 100.0
TIGR00559265 pdxJ pyridoxal phosphate biosynthetic protein PdxJ; Int 100.0
COG0854243 PdxJ Pyridoxal phosphate biosynthesis protein [Coenzyme 100.0
PRK08745223 ribulose-phosphate 3-epimerase; Provisional 96.88
PRK08883220 ribulose-phosphate 3-epimerase; Provisional 96.05
pfam00834201 Ribul_P_3_epim Ribulose-phosphate 3 epimerase family. T 95.82
PRK13209283 L-xylulose 5-phosphate 3-epimerase; Reviewed 95.62
PRK05581220 ribulose-phosphate 3-epimerase; Validated 95.6
PRK08005210 ribulose-phosphate 3-epimerase; Validated 94.7
cd00429211 RPE Ribulose-5-phosphate 3-epimerase (RPE). This enzyme 93.83
TIGR02631 390 xylA_Arthro xylose isomerase; InterPro: IPR013453 This 90.64
pfam05853274 DUF849 Prokaryotic protein of unknown function (DUF849) 97.13
PRK05301375 pyrroloquinoline quinone biosynthesis protein PqqE; Pro 93.43
cd00429211 RPE Ribulose-5-phosphate 3-epimerase (RPE). This enzyme 91.23
PTZ00170224 D-ribulose-5-phosphate 3-epimerase; Provisional 96.61
PRK09722227 allulose-6-phosphate 3-epimerase; Provisional 94.57
pfam01261201 AP_endonuc_2 Xylose isomerase-like TIM barrel. This TIM 93.13
pfam01207309 Dus Dihydrouridine synthase (Dus). Members of this fami 92.67
cd02801231 DUS_like_FMN Dihydrouridine synthase-like (DUS-like) FM 90.58
COG1082274 IolE Sugar phosphate isomerases/epimerases [Carbohydrat 95.84
PRK11815333 tRNA-dihydrouridine synthase A; Provisional 94.21
COG0269217 SgbH 3-hexulose-6-phosphate synthase and related protei 94.05
PRK07094323 biotin synthase; Provisional 92.59
PRK08745223 ribulose-phosphate 3-epimerase; Provisional 95.05
PRK09389 487 (R)-citramalate synthase; Provisional 93.46
PRK05581220 ribulose-phosphate 3-epimerase; Validated 93.41
PTZ00170224 D-ribulose-5-phosphate 3-epimerase; Provisional 93.25
pfam00682237 HMGL-like HMGL-like. This family contains a diverse set 92.84
PRK04452322 acetyl-CoA decarbonylase/synthase complex subunit delta 91.14
cd04734343 OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN bind 94.42
cd02933338 OYE_like_FMN Old yellow enzyme (OYE)-like FMN binding d 92.71
cd02930353 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-binding dom 90.44
PRK09856276 fructoselysine 3-epimerase; Provisional 93.76
cd02803327 OYE_like_FMN_family Old yellow enzyme (OYE)-like FMN bi 93.62
TIGR03471472 HpnJ hopanoid biosynthesis associated radical SAM prote 93.47
TIGR02090 371 LEU1_arch isopropylmalate/citramalate/homocitrate synth 92.88
COG3142241 CutC Uncharacterized protein involved in copper resista 91.48
pfam03932202 CutC CutC family. Copper transport in Escherichia coli 93.43
COG5012227 Predicted cobalamin binding protein [General function p 92.02
PRK13306216 ulaD 3-keto-L-gulonate-6-phosphate decarboxylase; Provi 91.23
>PRK05265 pyridoxine 5'-phosphate synthase; Provisional Back     alignment and domain information
>pfam03740 PdxJ Pyridoxal phosphate biosynthesis protein PdxJ Back     alignment and domain information
>cd00003 PNPsynthase Pyridoxine 5'-phosphate (PNP) synthase domain; pyridoxal 5'-phosphate is the active form of vitamin B6 that acts as an essential, ubiquitous coenzyme in amino acid metabolism Back     alignment and domain information
>TIGR00559 pdxJ pyridoxal phosphate biosynthetic protein PdxJ; InterPro: IPR004569 Pyridoxal phosphate is the active form of vitamin B6 (pyridoxine or pyridoxal) Back     alignment and domain information
>COG0854 PdxJ Pyridoxal phosphate biosynthesis protein [Coenzyme metabolism] Back     alignment and domain information
>PRK08745 ribulose-phosphate 3-epimerase; Provisional Back     alignment and domain information
>PRK08883 ribulose-phosphate 3-epimerase; Provisional Back     alignment and domain information
>pfam00834 Ribul_P_3_epim Ribulose-phosphate 3 epimerase family Back     alignment and domain information
>PRK13209 L-xylulose 5-phosphate 3-epimerase; Reviewed Back     alignment and domain information
>PRK05581 ribulose-phosphate 3-epimerase; Validated Back     alignment and domain information
>PRK08005 ribulose-phosphate 3-epimerase; Validated Back     alignment and domain information
>cd00429 RPE Ribulose-5-phosphate 3-epimerase (RPE) Back     alignment and domain information
>TIGR02631 xylA_Arthro xylose isomerase; InterPro: IPR013453 This is an enzyme which as well as interconverting D-xylose and D-xylulose, is also active as a D-glucose isomerase Back     alignment and domain information
>pfam05853 DUF849 Prokaryotic protein of unknown function (DUF849) Back     alignment and domain information
>PRK05301 pyrroloquinoline quinone biosynthesis protein PqqE; Provisional Back     alignment and domain information
>cd00429 RPE Ribulose-5-phosphate 3-epimerase (RPE) Back     alignment and domain information
>PTZ00170 D-ribulose-5-phosphate 3-epimerase; Provisional Back     alignment and domain information
>PRK09722 allulose-6-phosphate 3-epimerase; Provisional Back     alignment and domain information
>pfam01261 AP_endonuc_2 Xylose isomerase-like TIM barrel Back     alignment and domain information
>pfam01207 Dus Dihydrouridine synthase (Dus) Back     alignment and domain information
>cd02801 DUS_like_FMN Dihydrouridine synthase-like (DUS-like) FMN-binding domain Back     alignment and domain information
>COG1082 IolE Sugar phosphate isomerases/epimerases [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11815 tRNA-dihydrouridine synthase A; Provisional Back     alignment and domain information
>COG0269 SgbH 3-hexulose-6-phosphate synthase and related proteins [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK07094 biotin synthase; Provisional Back     alignment and domain information
>PRK08745 ribulose-phosphate 3-epimerase; Provisional Back     alignment and domain information
>PRK09389 (R)-citramalate synthase; Provisional Back     alignment and domain information
>PRK05581 ribulose-phosphate 3-epimerase; Validated Back     alignment and domain information
>PTZ00170 D-ribulose-5-phosphate 3-epimerase; Provisional Back     alignment and domain information
>pfam00682 HMGL-like HMGL-like Back     alignment and domain information
>PRK04452 acetyl-CoA decarbonylase/synthase complex subunit delta; Provisional Back     alignment and domain information
>cd04734 OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 3 Back     alignment and domain information
>cd02933 OYE_like_FMN Old yellow enzyme (OYE)-like FMN binding domain Back     alignment and domain information
>cd02930 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-binding domain Back     alignment and domain information
>PRK09856 fructoselysine 3-epimerase; Provisional Back     alignment and domain information
>cd02803 OYE_like_FMN_family Old yellow enzyme (OYE)-like FMN binding domain Back     alignment and domain information
>TIGR03471 HpnJ hopanoid biosynthesis associated radical SAM protein HpnJ Back     alignment and domain information
>TIGR02090 LEU1_arch isopropylmalate/citramalate/homocitrate synthases; InterPro: IPR011830 Methanogenic archaea contain three closely related homologs of the 2-isopropylmalate synthases (LeuA) represented by IPR005671 from INTERPRO Back     alignment and domain information
>COG3142 CutC Uncharacterized protein involved in copper resistance [Inorganic ion transport and metabolism] Back     alignment and domain information
>pfam03932 CutC CutC family Back     alignment and domain information
>COG5012 Predicted cobalamin binding protein [General function prediction only] Back     alignment and domain information
>PRK13306 ulaD 3-keto-L-gulonate-6-phosphate decarboxylase; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target261 pyridoxine 5'-phosphate synthase [Candidatus Liberibact
1ho1_A242 Crystal Structure Of Pyridoxine 5'-Phosphate Syntha 5e-70
1m5w_A243 1.96 A Crystal Structure Of Pyridoxine 5'-Phosphate 8e-70
3f4n_A246 Crystal Structure Of Pyridoxal Phosphate Biosynthet 1e-66
3gk0_A278 Crystal Structure Of Pyridoxal Phosphate Biosynthet 1e-61
3o6c_A260 Pyridoxal Phosphate Biosynthetic Protein Pdxj From 2e-51
>gi|13786833|pdb|1HO1|A Chain A, Crystal Structure Of Pyridoxine 5'-Phosphate Synthase Length = 242 Back     alignment and structure
 Score =  268 bits (685), Expect = 5e-70,   Method: Composition-based stats.
 Identities = 80/246 (32%), Positives = 127/246 (51%), Gaps = 9/246 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R   
Sbjct: 5   LGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILR--- 61

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q     +N+E    E  L +    KP    LVP+   ++T++ G D    +  +    
Sbjct: 62  --QTLDTRMNLEMAVTEEMLAIAVETKPHFCCLVPEKRQEVTTEGGLDVAGQRDKMRDAC 119

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL + G ++SLF D +  +   +AA   GA  IE++TG Y     +  ++   L ++A 
Sbjct: 120 KRLADAGIQVSLFIDADEEQI--KAAAEVGAPFIEIHTGCYADAKTD-AEQAQELARIAK 176

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH LT  N+   I AIP + E+++GHA    A+  G+K+AV   +R
Sbjct: 177 AATFAASLGLKVNAGHGLTYHNV-KAIAAIPEMHELNIGHAIIGRAVMTGLKDAVAEMKR 235

Query: 245 ACGQHL 250
              +  
Sbjct: 236 LMLEAR 241


gi|34811392|pdb|1M5W|A Chain A, 1.96 A Crystal Structure Of Pyridoxine 5'-Phosphate Synthase In Complex With 1-Deoxy-D-Xylulose Phosphate Length = 243 Back     alignment and structure
>gi|215261426|pdb|3F4N|A Chain A, Crystal Structure Of Pyridoxal Phosphate Biosynthetic Protein Pdxj From Yersinia Pestis Length = 246 Back     alignment and structure
>gi|225698152|pdb|3GK0|A Chain A, Crystal Structure Of Pyridoxal Phosphate Biosynthetic Protein From Burkholderia Pseudomallei Length = 278 Back     alignment and structure
>gi|302566287|pdb|3O6C|A Chain A, Pyridoxal Phosphate Biosynthetic Protein Pdxj From Campylobacter Jejuni Length = 260 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target261 pyridoxine 5'-phosphate synthase [Candidatus Liberibact
1m5w_A243 Pyridoxal phosphate biosynthetic protein PDXJ; TIM barr 4e-56
3o6c_A260 PNP synthase, pyridoxine 5'-phosphate synthase; structu 3e-54
3gk0_A278 PNP synthase, pyridoxine 5'-phosphate synthase; decode, 2e-48
>1m5w_A Pyridoxal phosphate biosynthetic protein PDXJ; TIM barrel, protein-substrate complex, multi-binding states; HET: DXP; 1.96A {Escherichia coli} SCOP: c.1.24.1 PDB: 1ho1_A 1ho4_A* 1ixn_A* 1ixo_A* 1ixp_A 1ixq_A 3f4n_A* Length = 243 Back     alignment and structure
 Score =  212 bits (542), Expect = 4e-56
 Identities = 82/240 (34%), Positives = 129/240 (53%), Gaps = 9/240 (3%)

Query: 6   SVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLID 65
            VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R+ +D
Sbjct: 7   GVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILRQTLD 66

Query: 66  EQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTVA 125
            +      N+E    E  L +    KP    LVP+   ++T++ G D    +  +     
Sbjct: 67  TRM-----NLEMAVTEEMLAIAVETKPHFCCLVPEKRQEVTTEGGLDVAGQRDKMRDACK 121

Query: 126 RLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAIT 185
           RL + G ++SLF D   +E  ++AA   GA  IE++TG Y     + +Q +  L ++A  
Sbjct: 122 RLADAGIQVSLFID--ADEEQIKAAAEVGAPFIEIHTGCYADAKTDAEQAQE-LARIAKA 178

Query: 186 AQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRRA 245
           A  A  + L++NAGH LT  N+   I AIP + E+++GHA    A+  G+K+AV   +R 
Sbjct: 179 ATFAASLGLKVNAGHGLTYHNVK-AIAAIPEMHELNIGHAIIGRAVMTGLKDAVAEMKRL 237


>3o6c_A PNP synthase, pyridoxine 5'-phosphate synthase; structural genomics, IDP90671, center for structural genomic infectious diseases; HET: MSE; 1.87A {Campylobacter jejuni subsp} PDB: 3o6d_A* Length = 260 Back     alignment and structure
>3gk0_A PNP synthase, pyridoxine 5'-phosphate synthase; decode, ssgcid, niaid, SBRI, cytoplasm, pyridoxine biosynthesis, transferase; HET: DXP; 2.28A {Burkholderia pseudomallei} Length = 278 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target261 pyridoxine 5'-phosphate synthase [Candidatus Liberibact
3gk0_A278 PNP synthase, pyridoxine 5'-phosphate synthase; decode, 100.0
1m5w_A243 Pyridoxal phosphate biosynthetic protein PDXJ; TIM barr 100.0
3o6c_A260 PNP synthase, pyridoxine 5'-phosphate synthase; structu 100.0
3inp_A246 D-ribulose-phosphate 3-epimerase; IDP02542, isomerase, 95.43
1rpx_A230 Protein (ribulose-phosphate 3-epimerase); chloroplast, 95.26
2fli_A220 Ribulose-phosphate 3-epimerase; (beta/alpha)8-barrel, D 95.11
3igs_A232 N-acetylmannosamine-6-phosphate 2-epimerase 2; energy m 95.03
3ajx_A207 3-hexulose-6-phosphate synthase; HPS, OMPDC suprafamily 94.7
1tqj_A230 Ribulose-phosphate 3-epimerase; beta-alpha barrel epime 94.36
3exr_A221 RMPD (hexulose-6-phosphate synthase); beta barrel, lyas 93.85
3ctl_A231 D-allulose-6-phosphate 3-epimerase; D-glucitol 6-phosph 93.77
3kws_A287 Putative sugar isomerase; structural genomics, joint ce 93.43
1q6o_A216 Humps, 3-keto-L-gulonate 6-phosphate decarboxylase, D-; 93.4
3f4w_A211 Putative hexulose 6 phosphate synthase; humps, malonate 93.05
1h1y_A228 D-ribulose-5-phosphate 3-epimerase; oxidative pentose p 92.89
2zvr_A290 Uncharacterized protein TM_0416; hyperthermophIle, keto 92.59
1i60_A278 IOLI protein; beta barrel, structural genomics, PSI, pr 91.97
1twd_A256 Copper homeostasis protein CUTC; TIM-like protein, stru 91.11
3jr2_A218 Hexulose-6-phosphate synthase SGBH; 3-keto-L-gulonate-6 90.6
3c6c_A316 3-keto-5-aminohexanoate cleavage enzyme; YP_293392.1, p 97.05
3no5_A275 Uncharacterized protein; PFAM DUF849 domain containing 96.22
3chv_A284 Prokaryotic domain of unknown function (DUF849) W barre 96.1
3dx5_A286 Uncharacterized protein ASBF; beta-alpha barrel, petrob 95.8
3e02_A311 Uncharacterized protein DUF849; structural genomics, jo 95.52
3lot_A314 Uncharacterized protein; protein of unknown function, s 95.38
3e49_A311 Uncharacterized protein DUF849 with A TIM barrel fold; 95.22
2qul_A290 D-tagatose 3-epimerase; beta/alpha barrel, isomerase; 1 93.51
3ju2_A284 Uncharacterized protein SMC04130; structural genomics, 91.06
3iwp_A287 Copper homeostasis protein CUTC homolog; conserved sequ 95.53
2bdq_A224 Copper homeostasis protein CUTC; alpha beta protein, st 95.39
3cqj_A295 L-ribulose-5-phosphate 3-epimerase ULAE; TIM-barrel, is 94.98
2hk0_A309 D-psicose 3-epimerase; TIM-barrel, isomerase; 2.00A {Ag 93.69
3iix_A348 Biotin synthetase, putative; adoMet radical, SAM radica 95.06
1qwg_A251 PSL synthase;, (2R)-phospho-3-sulfolactate synthase; be 90.46
2fli_A220 Ribulose-phosphate 3-epimerase; (beta/alpha)8-barrel, D 95.06
3inp_A246 D-ribulose-phosphate 3-epimerase; IDP02542, isomerase, 94.84
1h1y_A228 D-ribulose-5-phosphate 3-epimerase; oxidative pentose p 92.37
2x7v_A287 Probable endonuclease 4; DNA repair protein, metal-bind 92.95
1z41_A338 YQJM, probable NADH-dependent flavin oxidoreductase YQJ 92.55
1r30_A369 Biotin synthase; SAM radical protein, TIM barrel, FES c 91.47
3ju2_A284 Uncharacterized protein SMC04130; structural genomics, 91.04
>3gk0_A PNP synthase, pyridoxine 5'-phosphate synthase; decode, ssgcid, niaid, SBRI, cytoplasm, pyridoxine biosynthesis, transferase; HET: DXP; 2.28A {Burkholderia pseudomallei} Back     alignment and structure
Probab=100.00  E-value=0  Score=724.35  Aligned_cols=247  Identities=30%  Similarity=0.462  Sum_probs=236.1

Q ss_pred             CCCCCCCCHHHHHHHHCCCCCCCCHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEECCCH
Q ss_conf             84533221443223220788689989999999974998999824788334888999998874000136741588834856
Q gi|254780438|r    2 STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLIDEQFPKAELNIEGYPNE   81 (261)
Q Consensus         2 ~t~LsVNidhiAtLRnaRg~~~P~~~~~a~~~~~~GadgITvH~R~DrRHI~~~Dv~~l~~~~~~~~~~~elNiEg~p~~   81 (261)
                      ++|||||||||||||||||+++|||++||.+|+++||||||||||||||||||+||++|++.+     ++||||||+|++
T Consensus        31 ~~rL~VNIdhVAtLRnaRg~~~Pd~~~aA~~~~~~GAdgITvHlReDrRHI~d~Dv~~l~~~~-----~~~lNlE~a~~~  105 (278)
T 3gk0_A           31 AIDLGVNIDHVATLRNARGTAYPDPVRAALAAEDAGADAITLHLREDRRHIVDADVRTLRPRV-----KTRMNLECAVTP  105 (278)
T ss_dssp             GSEEEEECHHHHHHHHHHSSSCSCHHHHHHHHHHTTCSEEEEECCTTCSSSCHHHHHHHHHHC-----SSCEEEEECSSH
T ss_pred             CEEEEEEECCEEEECCCCCCCCCCHHHHHHHHHHCCCCEEEECCCCCCCCCCHHHHHHHHHHH-----CCCCCCCCCCCH
T ss_conf             248866411154201058989999999999999829986895268875657589999999873-----775577888709


Q ss_pred             HHHHHHHHHCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHCCCCEEEEC
Q ss_conf             89999985072128971016555333578221333788999998620269638997254444147999974066146511
Q gi|254780438|r   82 TFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELY  161 (261)
Q Consensus        82 e~i~ia~~ikP~qvtLVPe~r~elTTegGldv~~~~~~L~~~i~~l~~~girvSLFIDpd~~q~~i~~a~~~Gad~VElh  161 (261)
                      +|+++|+++||+|||||||+|+|+|||||||+.++.++|+++|++|+++|||||||||||++|  |++|+++|+|+||||
T Consensus       106 e~i~ia~~~kP~qvtLVPE~r~elTTegGlDv~~~~~~L~~~i~~Lk~~gIrVSLFIDPd~~q--i~~A~~~Gad~IELh  183 (278)
T 3gk0_A          106 EMLDIACEIRPHDACLVPEKRSELTTEGGLDVVGHFDAVRAACKQLADAGVRVSLFIDPDEAQ--IRAAHETGAPVIELH  183 (278)
T ss_dssp             HHHHHHHHHCCSEEEECCCSGGGBCSSSSBCTTTTHHHHHHHHHHHHHTTCEEEEEECSCHHH--HHHHHHHTCSEEEEC
T ss_pred             HHHHHHHHCCCCEEEECCCCCCCCCCCCCEEEHHHHHHHHHHHHHHHHCCCCEEEEECCCHHH--HHHHHHCCCCEEEEE
T ss_conf             999999966998799888885554555766206259999999999997498179983698789--999850599979972


Q ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEECCCCCHHHHHHHHHHCCCCEEEEEHHHHHHHHHHHHHHHHHHH
Q ss_conf             21110244435643366688999876654156235207898987799999736996388425999999999409999999
Q gi|254780438|r  162 TGPYGACYNNPQQERIFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC  241 (261)
Q Consensus       162 TG~Ya~a~~~~~~~~~el~~i~~aa~~A~~lgL~VnAGHgLn~~Nl~~~i~~Ip~I~EvsIGHaiIseAl~~GL~~aI~~  241 (261)
                      ||+||++|+..+ ...||++|+.++++|+++||+|||||||||+|++. +++||+|+||||||||||||||+||++||++
T Consensus       184 TG~YA~a~~~~~-~~~el~~i~~aa~~A~~lGL~VnAGHgLn~~Nl~~-i~~ip~i~EvnIGHaIIseAl~~Gl~~aV~~  261 (278)
T 3gk0_A          184 TGRYADAHDAAE-QQREFERIATGVDAGIALGLKVNAGHGLHYTNVQA-IAALPGIAELNIGHAIVAHAVFVGWDNAVRE  261 (278)
T ss_dssp             CHHHHTCSSHHH-HHHHHHHHHHHHHHHHHTTCEEEECTTCCTTTHHH-HHTCTTEEEEEECHHHHHHHHHHCHHHHHHH
T ss_pred             CHHHHCCCCCCC-CHHHHHHHHHHHHHHHHHCCEEECCCCCCHHHHHH-HHCCCCCEEEECCHHHHHHHHHHHHHHHHHH
T ss_conf             335533254320-07999999999999997187574678988667899-8618997698567999999999729999999


Q ss_pred             HHHHHHHHHHHHHHHC
Q ss_conf             9999974105655403
Q gi|254780438|r  242 FRRACGQHLDNTMRLT  257 (261)
Q Consensus       242 ~~~ii~~~~~~~~~~~  257 (261)
                      |+++|+++|..++++-
T Consensus       262 m~~ii~~aR~~~~~~~  277 (278)
T 3gk0_A          262 MKAIMVAARVAALHGG  277 (278)
T ss_dssp             HHHHHHHHHHHHHC--
T ss_pred             HHHHHHHHHHHHCCCC
T ss_conf             9999999844242179



>1m5w_A Pyridoxal phosphate biosynthetic protein PDXJ; TIM barrel, protein-substrate complex, multi-binding states; HET: DXP; 1.96A {Escherichia coli} SCOP: c.1.24.1 PDB: 1ho1_A 1ho4_A* 1ixn_A* 1ixo_A* 1ixp_A 1ixq_A 3f4n_A* Back     alignment and structure
>3o6c_A PNP synthase, pyridoxine 5'-phosphate synthase; structural genomics, IDP90671, center for structural genomic infectious diseases; HET: MSE; 1.87A {Campylobacter jejuni subsp} PDB: 3o6d_A* Back     alignment and structure
>3inp_A D-ribulose-phosphate 3-epimerase; IDP02542, isomerase, structural genomics, center for structural genomics of infectious diseases; 2.05A {Francisella tularensis subsp} Back     alignment and structure
>1rpx_A Protein (ribulose-phosphate 3-epimerase); chloroplast, calvin cycle, oxidative pentose phosphate pathway; 2.30A {Solanum tuberosum} SCOP: c.1.2.2 Back     alignment and structure
>2fli_A Ribulose-phosphate 3-epimerase; (beta/alpha)8-barrel, D- xylitol 5-phosphate, isomerase; HET: DX5; 1.80A {Streptococcus pyogenes} SCOP: c.1.2.2 Back     alignment and structure
>3igs_A N-acetylmannosamine-6-phosphate 2-epimerase 2; energy metabolism, sugars, csgid, carbohydrate metabolism, isomerase; HET: MSE 16G; 1.50A {Salmonella enterica subsp} Back     alignment and structure
>3ajx_A 3-hexulose-6-phosphate synthase; HPS, OMPDC suprafamily, LYA; 1.60A {Mycobacterium gastri} Back     alignment and structure
>1tqj_A Ribulose-phosphate 3-epimerase; beta-alpha barrel epimerase, isomerase; 1.60A {Synechocystis SP} SCOP: c.1.2.2 Back     alignment and structure
>3exr_A RMPD (hexulose-6-phosphate synthase); beta barrel, lyase; 1.70A {Streptococcus mutans} PDB: 3exs_A* 3ext_A Back     alignment and structure
>3ctl_A D-allulose-6-phosphate 3-epimerase; D-glucitol 6-phosphate, (beta/alpha)8 barrel, carbohydrate metabolism, isomerase; HET: S6P; 2.20A {Escherichia coli} PDB: 3ct7_A* Back     alignment and structure
>3kws_A Putative sugar isomerase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; HET: MSE; 1.68A {Parabacteroides distasonis atcc 8503} Back     alignment and structure
>1q6o_A Humps, 3-keto-L-gulonate 6-phosphate decarboxylase, D-; beta barrel, lyase; HET: LG6; 1.20A {Escherichia coli} SCOP: c.1.2.3 PDB: 1kw1_A* 1q6l_A* 1kv8_A* 1q6q_A* 1q6r_A* 1xbv_A* 1so5_A* 1so4_A* 1xby_A* 1so3_A* 1so6_A* 1xbz_A* 1xbx_A* Back     alignment and structure
>3f4w_A Putative hexulose 6 phosphate synthase; humps, malonate, lyase; 1.65A {Salmonella typhimurium} Back     alignment and structure
>1h1y_A D-ribulose-5-phosphate 3-epimerase; oxidative pentose phosphate pathway, isomerase; 1.87A {Oryza sativa} SCOP: c.1.2.2 PDB: 1h1z_A Back     alignment and structure
>2zvr_A Uncharacterized protein TM_0416; hyperthermophIle, ketohexose 3- epimerase, D-tagatose 3-epimerase, isomerase; 2.20A {Thermotoga maritima} Back     alignment and structure
>1i60_A IOLI protein; beta barrel, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.60A {Bacillus subtilis} SCOP: c.1.15.4 PDB: 1i6n_A Back     alignment and structure
>1twd_A Copper homeostasis protein CUTC; TIM-like protein, structural genomics, PSI, protein structure initiative; 1.70A {Shigella flexneri} SCOP: c.1.30.1 PDB: 1x7i_A 1x8c_A Back     alignment and structure
>3jr2_A Hexulose-6-phosphate synthase SGBH; 3-keto-L-gulonate-6-phosphate decarboxylase, ULAD, niaid, csgid, Mg-bound, biosynthetic protein; HET: MSE; 1.80A {Vibrio cholerae} PDB: 3ieb_A* Back     alignment and structure
>3c6c_A 3-keto-5-aminohexanoate cleavage enzyme; YP_293392.1, prokaryotic protein of unknown function (DUF849), structural genomics; HET: MSE; 1.72A {Ralstonia eutropha JMP134} Back     alignment and structure
>3no5_A Uncharacterized protein; PFAM DUF849 domain containing protein, structural genomics, center for structural genomics, JCSG; HET: MSE; 1.90A {Ralstonia eutropha JMP134} Back     alignment and structure
>3chv_A Prokaryotic domain of unknown function (DUF849) W barrel fold; TIM barrel fold, structural genomics, joint center for struc genomics; HET: MSE; 1.45A {Silicibacter pomeroyi dss-3} PDB: 3fa5_A Back     alignment and structure
>3dx5_A Uncharacterized protein ASBF; beta-alpha barrel, petrobactin synthesis, ASB locus, structural genomics, PSI-2, protein structure initiative; HET: MSE DHB TRS; 2.12A {Bacillus anthracis} Back     alignment and structure
>3e02_A Uncharacterized protein DUF849; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 1.90A {Burkholderia xenovorans LB400} Back     alignment and structure
>3lot_A Uncharacterized protein; protein of unknown function, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.89A {Archaeoglobus fulgidus} Back     alignment and structure
>3e49_A Uncharacterized protein DUF849 with A TIM barrel fold; YP_556190.1; HET: MSE; 1.75A {Burkholderia xenovorans LB400} Back     alignment and structure
>2qul_A D-tagatose 3-epimerase; beta/alpha barrel, isomerase; 1.79A {Pseudomonas cichorii} PDB: 2ou4_A 2qum_A* 2qun_A* Back     alignment and structure
>3ju2_A Uncharacterized protein SMC04130; structural genomics, PSI-2, TIM barrel protein, protein structure initiative, Zn binding domain; 1.80A {Sinorhizobium meliloti} Back     alignment and structure
>3iwp_A Copper homeostasis protein CUTC homolog; conserved sequence motif, metal-binding site, polymorphism, metal binding protein; 2.50A {Homo sapiens} Back     alignment and structure
>2bdq_A Copper homeostasis protein CUTC; alpha beta protein, structural genomics, PSI, protein structure initiative; 2.30A {Streptococcus agalactiae} Back     alignment and structure
>3cqj_A L-ribulose-5-phosphate 3-epimerase ULAE; TIM-barrel, isomerase, phosphate-binding motif, structural genomics; 2.04A {Escherichia coli} PDB: 3cqi_A 3cqh_A 3cqk_A Back     alignment and structure
>2hk0_A D-psicose 3-epimerase; TIM-barrel, isomerase; 2.00A {Agrobacterium tumefaciens} PDB: 2hk1_A* Back     alignment and structure
>3iix_A Biotin synthetase, putative; adoMet radical, SAM radical, adoMet cleavage, Fe4S4 cluster, HYDE, hydrogenase, maturation, beta barrel; HET: OTY CSO 5AD CPS; 1.25A {Thermotoga maritima} PDB: 3ciw_A* 3iiz_A* 3cix_A* Back     alignment and structure
>1qwg_A PSL synthase;, (2R)-phospho-3-sulfolactate synthase; beta-alpha-barrel, lyase; 1.60A {Methanocaldococcus jannaschii} SCOP: c.1.27.1 Back     alignment and structure
>2fli_A Ribulose-phosphate 3-epimerase; (beta/alpha)8-barrel, D- xylitol 5-phosphate, isomerase; HET: DX5; 1.80A {Streptococcus pyogenes} SCOP: c.1.2.2 Back     alignment and structure
>3inp_A D-ribulose-phosphate 3-epimerase; IDP02542, isomerase, structural genomics, center for structural genomics of infectious diseases; 2.05A {Francisella tularensis subsp} Back     alignment and structure
>1h1y_A D-ribulose-5-phosphate 3-epimerase; oxidative pentose phosphate pathway, isomerase; 1.87A {Oryza sativa} SCOP: c.1.2.2 PDB: 1h1z_A Back     alignment and structure
>2x7v_A Probable endonuclease 4; DNA repair protein, metal-binding, hydrolase, DNA damage, DN; 2.30A {Thermotoga maritima MSB8} PDB: 2x7w_A* Back     alignment and structure
>1z41_A YQJM, probable NADH-dependent flavin oxidoreductase YQJM; FMN, beta-alpha-barrel; HET: FMN; 1.30A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1z42_A* 1z44_A* 1z48_A* Back     alignment and structure
>1r30_A Biotin synthase; SAM radical protein, TIM barrel, FES cluster, transferase; HET: SAM DTB; 3.40A {Escherichia coli} SCOP: c.1.28.1 Back     alignment and structure
>3ju2_A Uncharacterized protein SMC04130; structural genomics, PSI-2, TIM barrel protein, protein structure initiative, Zn binding domain; 1.80A {Sinorhizobium meliloti} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 261 pyridoxine 5'-phosphate synthase [Candidatus Liberibact
d1m5wa_242 c.1.24.1 (A:) Pyridoxine 5'-phosphate synthase {Escheri 6e-47
>d1m5wa_ c.1.24.1 (A:) Pyridoxine 5'-phosphate synthase {Escherichia coli [TaxId: 562]} Length = 242 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Pyridoxine 5'-phosphate synthase
family: Pyridoxine 5'-phosphate synthase
domain: Pyridoxine 5'-phosphate synthase
species: Escherichia coli [TaxId: 562]
 Score =  181 bits (460), Expect = 6e-47
 Identities = 80/240 (33%), Positives = 126/240 (52%), Gaps = 9/240 (3%)

Query: 6   SVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLID 65
            VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R+ +D
Sbjct: 6   GVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILRQTLD 65

Query: 66  EQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTVA 125
            +        E    E  L +    KP    LVP+   ++T++ G D    +  +     
Sbjct: 66  TRMNL-----EMAVTEEMLAIAVETKPHFCCLVPEKRQEVTTEGGLDVAGQRDKMRDACK 120

Query: 126 RLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAIT 185
           RL + G ++SLF   + +E  ++AA   GA  IE++TG Y A      ++   L ++A  
Sbjct: 121 RLADAGIQVSLFI--DADEEQIKAAAEVGAPFIEIHTGCY-ADAKTDAEQAQELARIAKA 177

Query: 186 AQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRRA 245
           A  A  + L++NAGH LT  N+   I AIP + E+++GHA    A+  G+K+AV   +R 
Sbjct: 178 ATFAASLGLKVNAGHGLTYHNVK-AIAAIPEMHELNIGHAIIGRAVMTGLKDAVAEMKRL 236


Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target261 pyridoxine 5'-phosphate synthase [Candidatus Liberibact
d1m5wa_242 Pyridoxine 5'-phosphate synthase {Escherichia coli [Tax 100.0
d2flia1217 D-ribulose-5-phosphate 3-epimerase {Streptococcus pyoge 95.41
d1rpxa_230 D-ribulose-5-phosphate 3-epimerase {Potato (Solanum tub 95.28
d1i60a_278 Hypothetical protein IolI {Bacillus subtilis [TaxId: 14 94.9
d2g0wa1275 Hypothetical protein Lmo2234 {Listeria monocytogenes [T 94.73
d1h1ya_220 D-ribulose-5-phosphate 3-epimerase {Rice (Oryza sativa) 94.67
d2flia1217 D-ribulose-5-phosphate 3-epimerase {Streptococcus pyoge 94.91
d2q02a1271 Putative cytoplasmic protein STM4435 {Salmonella typhim 92.84
d1rpxa_230 D-ribulose-5-phosphate 3-epimerase {Potato (Solanum tub 91.54
d1h1ya_220 D-ribulose-5-phosphate 3-epimerase {Rice (Oryza sativa) 90.99
d1z41a1337 NADPH dehydrogenase NamA {Bacillus subtilis [TaxId: 142 93.99
d1ps9a1330 2,4-dienoyl-CoA reductase, N-terminal domain {Escherich 90.42
>d1m5wa_ c.1.24.1 (A:) Pyridoxine 5'-phosphate synthase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Pyridoxine 5'-phosphate synthase
family: Pyridoxine 5'-phosphate synthase
domain: Pyridoxine 5'-phosphate synthase
species: Escherichia coli [TaxId: 562]
Probab=100.00  E-value=0  Score=723.03  Aligned_cols=240  Identities=33%  Similarity=0.521  Sum_probs=230.6

Q ss_pred             CCCCCCCCHHHHHHHHCCCCCCCCHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEECCCH
Q ss_conf             84533221443223220788689989999999974998999824788334888999998874000136741588834856
Q gi|254780438|r    2 STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLIDEQFPKAELNIEGYPNE   81 (261)
Q Consensus         2 ~t~LsVNidhiAtLRnaRg~~~P~~~~~a~~~~~~GadgITvH~R~DrRHI~~~Dv~~l~~~~~~~~~~~elNiEg~p~~   81 (261)
                      .++||||||||||||||||+++|||++||.+|+++||||||||||||||||||+||+.|++.+     ++|||+||+|++
T Consensus         2 ~m~LsVNidhiAtLRnaRg~~~Pd~~~~a~~~~~~GadgITvH~R~DrRHI~~~Dv~~l~~~~-----~~~lNlE~a~~~   76 (242)
T d1m5wa_           2 ELLLGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILRQTL-----DTRMNLEMAVTE   76 (242)
T ss_dssp             CCEEEEECHHHHHHHHTSSCCCSCHHHHHHHHHTTTCSEEEEECCTTCSSSCHHHHHHHHHHC-----SSEEEEEECSSH
T ss_pred             CCEEEEEECEEEEECCCCCCCCCCHHHHHHHHHHCCCCEEEECCCCCCCCCCHHHHHHHHHHH-----HCCCCCCCCCCH
T ss_conf             845876311044210058999999999999999849986895778875655658899998875-----201254533422


Q ss_pred             HHHHHHHHHCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHCCCCEEEEC
Q ss_conf             89999985072128971016555333578221333788999998620269638997254444147999974066146511
Q gi|254780438|r   82 TFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELY  161 (261)
Q Consensus        82 e~i~ia~~ikP~qvtLVPe~r~elTTegGldv~~~~~~L~~~i~~l~~~girvSLFIDpd~~q~~i~~a~~~Gad~VElh  161 (261)
                      +|+++|+++||+|||||||+|+|+|||||||+.++.++|+++|++|+++|||||||||||++|  |++|+++|||+||||
T Consensus        77 e~i~ia~~~kP~qvtLVPe~r~elTTegGld~~~~~~~L~~~i~~l~~~girvSLFiDpd~~~--i~~a~~lGad~IElh  154 (242)
T d1m5wa_          77 EMLAIAVETKPHFCCLVPEKRQEVTTEGGLDVAGQRDKMRDACKRLADAGIQVSLFIDADEEQ--IKAAAEVGAPFIEIH  154 (242)
T ss_dssp             HHHHHHHHHCCSEEEECCCCSSCSSCCSCCCSGGGHHHHHHHHHHHHHTTCEEEEEECSCHHH--HHHHHHTTCSEEEEE
T ss_pred             HHHHHHHHHCCCEEEEEECCCCCCCCCCCEEEHHHHHHHHHHHHHHHHCCCEEEEEECCCHHH--HHHHHHCCCCEEEEE
T ss_conf             489999871632278862575555767755202158899999999986697079994452465--778864276635532


Q ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEECCCCCHHHHHHHHHHCCCCEEEEEHHHHHHHHHHHHHHHHHHH
Q ss_conf             21110244435643366688999876654156235207898987799999736996388425999999999409999999
Q gi|254780438|r  162 TGPYGACYNNPQQERIFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC  241 (261)
Q Consensus       162 TG~Ya~a~~~~~~~~~el~~i~~aa~~A~~lgL~VnAGHgLn~~Nl~~~i~~Ip~I~EvsIGHaiIseAl~~GL~~aI~~  241 (261)
                      ||+||+++.++... .++++|++++++|+++||+|||||||||+|+++ +++||+|+||||||||||||||+||++||++
T Consensus       155 TG~Ya~a~~~~~~~-~el~~i~~aa~~A~~lGL~VnAGHgLn~~Nl~~-i~~ip~i~EvsIGHaiI~eal~~Gl~~aV~~  232 (242)
T d1m5wa_         155 TGCYADAKTDAEQA-QELARIAKAATFAASLGLKVNAGHGLTYHNVKA-IAAIPEMHELNIGHAIIGRAVMTGLKDAVAE  232 (242)
T ss_dssp             CHHHHHCCSHHHHH-HHHHHHHHHHHHHHHTTCEEEEESSCCTTTHHH-HHTCTTEEEEEECHHHHHHHHHHCHHHHHHH
T ss_pred             CCCCCCCCCCHHHH-HHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHH-HHCCCCCEEEECCHHHHHHHHHHHHHHHHHH
T ss_conf             02110235410257-789999999999986688555898867200599-8448997688456999999999719999999


Q ss_pred             HHHHHHHHH
Q ss_conf             999997410
Q gi|254780438|r  242 FRRACGQHL  250 (261)
Q Consensus       242 ~~~ii~~~~  250 (261)
                      |+++|+++|
T Consensus       233 ~~~ii~~~r  241 (242)
T d1m5wa_         233 MKRLMLEAR  241 (242)
T ss_dssp             HHHHHHHHH
T ss_pred             HHHHHHHCC
T ss_conf             999998705



>d2flia1 c.1.2.2 (A:3-219) D-ribulose-5-phosphate 3-epimerase {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1rpxa_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Potato (Solanum tuberosum) [TaxId: 4113]} Back     information, alignment and structure
>d1i60a_ c.1.15.4 (A:) Hypothetical protein IolI {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2g0wa1 c.1.15.4 (A:10-284) Hypothetical protein Lmo2234 {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h1ya_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d2flia1 c.1.2.2 (A:3-219) D-ribulose-5-phosphate 3-epimerase {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2q02a1 c.1.15.4 (A:1-271) Putative cytoplasmic protein STM4435 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1rpxa_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Potato (Solanum tuberosum) [TaxId: 4113]} Back     information, alignment and structure
>d1h1ya_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1z41a1 c.1.4.1 (A:2-338) NADPH dehydrogenase NamA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ps9a1 c.1.4.1 (A:1-330) 2,4-dienoyl-CoA reductase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 261 pyridoxine 5'-phosphate synthase [Candidatus Liber
1m5w_A_243 (A:) Pyridoxal phosphate biosynthetic protein PDXJ 2e-72
3gk0_A_278 (A:) PNP synthase, pyridoxine 5'-phosphate synthas 4e-72
>1m5w_A (A:) Pyridoxal phosphate biosynthetic protein PDXJ; TIM barrel, protein-substrate complex, multi-binding states; HET: DXP; 1.96A {Escherichia coli}Length = 243 Back     alignment and structure
 Score =  266 bits (682), Expect = 2e-72
 Identities = 81/243 (33%), Positives = 129/243 (53%), Gaps = 9/243 (3%)

Query: 6   SVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLID 65
            VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R+ + 
Sbjct: 7   GVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILRQTL- 65

Query: 66  EQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTVA 125
                  +N+E    E  L +    KP    LVP+   ++T++ G D    +  +     
Sbjct: 66  ----DTRMNLEMAVTEEMLAIAVETKPHFCCLVPEKRQEVTTEGGLDVAGQRDKMRDACK 121

Query: 126 RLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAIT 185
           RL + G ++SLF D   +E  ++AA   GA  IE++TG Y     + +Q +  L ++A  
Sbjct: 122 RLADAGIQVSLFID--ADEEQIKAAAEVGAPFIEIHTGCYADAKTDAEQAQE-LARIAKA 178

Query: 186 AQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRRA 245
           A  A  + L++NAGH LT  N+   I AIP + E+++GHA    A+  G+K+AV   +R 
Sbjct: 179 ATFAASLGLKVNAGHGLTYHNVK-AIAAIPEMHELNIGHAIIGRAVMTGLKDAVAEMKRL 237

Query: 246 CGQ 248
             +
Sbjct: 238 MLE 240


>3gk0_A (A:) PNP synthase, pyridoxine 5'-phosphate synthase; decode, ssgcid, niaid, SBRI, cytoplasm, pyridoxine biosynthesis, transferase; HET: DXP; 2.28A {Burkholderia pseudomallei}Length = 278 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target261 pyridoxine 5'-phosphate synthase [Candidatus Liberibact
3gk0_A_278 PNP synthase, pyridoxine 5'-phosphate synthase; de 100.0
1m5w_A_243 Pyridoxal phosphate biosynthetic protein PDXJ; TIM 100.0
3inp_A_246 D-ribulose-phosphate 3-epimerase; IDP02542, isomer 96.64
1i60_A_278 IOLI protein; beta barrel, structural genomics, PS 95.84
3cqj_A_295 L-ribulose-5-phosphate 3-epimerase ULAE; TIM-barre 95.02
1xi3_A_215 Thiamine phosphate pyrophosphorylase; structural g 94.53
3ctl_A_231 D-allulose-6-phosphate 3-epimerase; D-glucitol 6-p 94.19
2fli_A_220 Ribulose-phosphate 3-epimerase; (beta/alpha)8-barr 93.97
1q6o_A_216 Humps, 3-keto-L-gulonate 6-phosphate decarboxylase 93.13
1h1y_A_228 D-ribulose-5-phosphate 3-epimerase; oxidative pent 92.37
1xla_A_394 D-xylose isomerase; isomerase(intramolecular oxido 91.34
3c6c_A_316 3-keto-5-aminohexanoate cleavage enzyme; YP_293392 96.69
3e49_A_311 Uncharacterized protein DUF849 with A TIM barrel f 96.61
3dx5_A_286 Uncharacterized protein ASBF; beta-alpha barrel, p 95.07
3chv_A_284 Prokaryotic domain of unknown function (DUF849) wi 94.89
3inp_A_246 D-ribulose-phosphate 3-epimerase; IDP02542, isomer 92.95
2q02_A_272 Putative cytoplasmic protein; NP_463296.1, structu 92.84
3lot_A_314 Uncharacterized protein; protein of unknown functi 96.29
3e02_A_311 Uncharacterized protein DUF849; YP_555544.1, prote 94.98
2qul_A_290 D-tagatose 3-epimerase; beta/alpha barrel, isomera 91.93
1ps9_A_1-333333 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 95.47
1o94_A_1-343343 Tmadh, trimethylamine dehydrogenase; electron tran 94.83
3hgj_A_349 Chromate reductase; TIM barrel, oxidoreductase; HE 92.92
1i60_A_278 IOLI protein; beta barrel, structural genomics, PS 91.65
1gte_A_523-742_762-821280 Dihydropyrimidine dehydrogenase; electron transfer 95.21
1xp3_A_307 Endonuclease IV; NFO, DNA replication, DNA recombi 94.52
2zbt_A_297 Pyridoxal biosynthesis lyase PDXS; pyridoxine bios 92.9
1qtw_A_285 Endonuclease IV; DNA repair enzyme, TIM barrel, tr 94.27
>3gk0_A (A:) PNP synthase, pyridoxine 5'-phosphate synthase; decode, ssgcid, niaid, SBRI, cytoplasm, pyridoxine biosynthesis, transferase; HET: DXP; 2.28A {Burkholderia pseudomallei} Back     alignment and structure
Probab=100.00  E-value=0  Score=714.48  Aligned_cols=247  Identities=30%  Similarity=0.463  Sum_probs=238.8

Q ss_pred             CCCCCCCCHHHHHHHHCCCCCCCCHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEECCCH
Q ss_conf             84533221443223220788689989999999974998999824788334888999998874000136741588834856
Q gi|254780438|r    2 STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLIDEQFPKAELNIEGYPNE   81 (261)
Q Consensus         2 ~t~LsVNidhiAtLRnaRg~~~P~~~~~a~~~~~~GadgITvH~R~DrRHI~~~Dv~~l~~~~~~~~~~~elNiEg~p~~   81 (261)
                      |++||||||||||||||||+++|||+++|.+|+++||||||+|||||||||||+||+.|++++     ++||||||+|++
T Consensus        31 m~~LgVNIDhVAtLRnaR~~~~PD~v~aA~~a~~aGAdgITvHlReDrRHI~d~Dv~~L~~~i-----~~~lNlE~a~t~  105 (278)
T 3gk0_A           31 AIDLGVNIDHVATLRNARGTAYPDPVRAALAAEDAGADAITLHLREDRRHIVDADVRTLRPRV-----KTRMNLECAVTP  105 (278)
T ss_dssp             GSEEEEECHHHHHHHHHHSSSCSCHHHHHHHHHHTTCSEEEEECCTTCSSSCHHHHHHHHHHC-----SSCEEEEECSSH
T ss_pred             CEEEEEEECCEEEECCCCCCCCCCHHHHHHHHHHCCCCEEEECCCCCCCCCCHHHHHHHHHCC-----CCCCCCCCCCHH
T ss_conf             158877512165310058989999999999999839986995258876667578888887403-----556686656638


Q ss_pred             HHHHHHHHHCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHCCCCEEEEC
Q ss_conf             89999985072128971016555333578221333788999998620269638997254444147999974066146511
Q gi|254780438|r   82 TFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELY  161 (261)
Q Consensus        82 e~i~ia~~ikP~qvtLVPe~r~elTTegGldv~~~~~~L~~~i~~l~~~girvSLFIDpd~~q~~i~~a~~~Gad~VElh  161 (261)
                      ||++||+++||+|||||||+|+|+|||||||+.++.++|+++|++|+++|||||||||||++|  |++|+++|||+||||
T Consensus       106 emi~ia~~~kP~~vtLVPEkr~ElTTegGlDv~~~~~~L~~~i~~Lk~~gIrVSLFiDP~~~q--i~~A~~~GAd~VELh  183 (278)
T 3gk0_A          106 EMLDIACEIRPHDACLVPEKRSELTTEGGLDVVGHFDAVRAACKQLADAGVRVSLFIDPDEAQ--IRAAHETGAPVIELH  183 (278)
T ss_dssp             HHHHHHHHHCCSEEEECCCSGGGBCSSSSBCTTTTHHHHHHHHHHHHHTTCEEEEEECSCHHH--HHHHHHHTCSEEEEC
T ss_pred             HHHHHHHHCCEEEEEEECCCCCCCCCCCCEEEHHHHHHHHHHHHHHHHCCCCEEEEECCCHHH--HHHHHHHCCCEEEEC
T ss_conf             899989851403899832576531223645412178789999999987287279996453144--778776166767650


Q ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEECCCCCHHHHHHHHHHCCCCEEEEEHHHHHHHHHHHHHHHHHHH
Q ss_conf             21110244435643366688999876654156235207898987799999736996388425999999999409999999
Q gi|254780438|r  162 TGPYGACYNNPQQERIFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC  241 (261)
Q Consensus       162 TG~Ya~a~~~~~~~~~el~~i~~aa~~A~~lgL~VnAGHgLn~~Nl~~~i~~Ip~I~EvsIGHaiIseAl~~GL~~aI~~  241 (261)
                      ||+||++|..+.+. .||++|+.+|.+|+++||+|||||||||+|++. +++||+|.||||||||||||||+||++||++
T Consensus       184 TG~YA~a~~~~~~~-~el~rl~~aA~~A~~lGL~VnAGHgLny~Nv~~-ia~ip~i~EvnIGHaiia~Al~~Gl~~AVr~  261 (278)
T 3gk0_A          184 TGRYADAHDAAEQQ-REFERIATGVDAGIALGLKVNAGHGLHYTNVQA-IAALPGIAELNIGHAIVAHAVFVGWDNAVRE  261 (278)
T ss_dssp             CHHHHTCSSHHHHH-HHHHHHHHHHHHHHHTTCEEEECTTCCTTTHHH-HHTCTTEEEEEECHHHHHHHHHHCHHHHHHH
T ss_pred             CHHHHHCCCCCHHH-HHHHHHHHHHHHHHHCCCEEECCCCCCHHHHHH-HHCCCCCEEEECCHHHHHHHHHHHHHHHHHH
T ss_conf             05554102220127-999999987778987098896578988656899-8528997698566999999999729999999


Q ss_pred             HHHHHHHHHHHHHHHC
Q ss_conf             9999974105655403
Q gi|254780438|r  242 FRRACGQHLDNTMRLT  257 (261)
Q Consensus       242 ~~~ii~~~~~~~~~~~  257 (261)
                      |++++++.+.+++|+-
T Consensus       262 m~~~l~~~r~~~~~~~  277 (278)
T 3gk0_A          262 MKAIMVAARVAALHGG  277 (278)
T ss_dssp             HHHHHHHHHHHHHC--
T ss_pred             HHHHHHHHHHHHCCCC
T ss_conf             9999999733023279



>1m5w_A (A:) Pyridoxal phosphate biosynthetic protein PDXJ; TIM barrel, protein-substrate complex, multi-binding states; HET: DXP; 1.96A {Escherichia coli} Back     alignment and structure
>3inp_A (A:) D-ribulose-phosphate 3-epimerase; IDP02542, isomerase, structural genomics, center for structural genomics of infectious diseases; 2.05A {Francisella tularensis subsp} Back     alignment and structure
>1i60_A (A:) IOLI protein; beta barrel, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.60A {Bacillus subtilis} Back     alignment and structure
>3cqj_A (A:) L-ribulose-5-phosphate 3-epimerase ULAE; TIM-barrel, isomerase, phosphate-binding motif, structural genomics; 2.04A {Escherichia coli} PDB: 3cqi_A 3cqh_A 3cqk_A Back     alignment and structure
>1xi3_A (A:) Thiamine phosphate pyrophosphorylase; structural genomics, southeast collaboratory for structural genomics, hyperthermophIle; 1.70A {Pyrococcus furiosus} Back     alignment and structure
>3ctl_A (A:) D-allulose-6-phosphate 3-epimerase; D-glucitol 6-phosphate, (beta/alpha)8 barrel, carbohydrate metabolism, isomerase; HET: S6P; 2.20A {Escherichia coli} PDB: 3ct7_A* Back     alignment and structure
>2fli_A (A:) Ribulose-phosphate 3-epimerase; (beta/alpha)8-barrel, D- xylitol 5-phosphate, isomerase; HET: DX5; 1.80A {Streptococcus pyogenes} Back     alignment and structure
>1q6o_A (A:) Humps, 3-keto-L-gulonate 6-phosphate decarboxylase, D-; beta barrel, lyase; HET: LG6; 1.20A {Escherichia coli} Back     alignment and structure
>1h1y_A (A:) D-ribulose-5-phosphate 3-epimerase; oxidative pentose phosphate pathway, isomerase; 1.87A {Oryza sativa} Back     alignment and structure
>1xla_A (A:) D-xylose isomerase; isomerase(intramolecular oxidoreductse); 2.30A {Arthrobacter SP} Back     alignment and structure
>3c6c_A (A:) 3-keto-5-aminohexanoate cleavage enzyme; YP_293392.1, prokaryotic protein of unknown function (DUF849), structural genomics; HET: MSE; 1.72A {Ralstonia eutropha JMP134} Back     alignment and structure
>3e49_A (A:) Uncharacterized protein DUF849 with A TIM barrel fold; YP_556190.1; HET: MSE; 1.75A {Burkholderia xenovorans LB400} Back     alignment and structure
>3dx5_A (A:) Uncharacterized protein ASBF; beta-alpha barrel, petrobactin synthesis, ASB locus, structural genomics, PSI-2, protein structure initiative; HET: MSE DHB TRS; 2.12A {Bacillus anthracis} Back     alignment and structure
>3chv_A (A:) Prokaryotic domain of unknown function (DUF849) with A TIM barrel fold; YP_164873.1; HET: MSE; 1.45A {Silicibacter pomeroyi dss-3} PDB: 3fa5_A Back     alignment and structure
>3inp_A (A:) D-ribulose-phosphate 3-epimerase; IDP02542, isomerase, structural genomics, center for structural genomics of infectious diseases; 2.05A {Francisella tularensis subsp} Back     alignment and structure
>2q02_A (A:) Putative cytoplasmic protein; NP_463296.1, structural genomics, joint center for structural genomics, JCSG; 2.40A {Salmonella typhimurium LT2} Back     alignment and structure
>3lot_A (A:) Uncharacterized protein; protein of unknown function, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.89A {Archaeoglobus fulgidus} Back     alignment and structure
>3e02_A (A:) Uncharacterized protein DUF849; YP_555544.1, protein of unknown function (DUF849), structural genomics; HET: MSE; 1.90A {Burkholderia xenovorans LB400} Back     alignment and structure
>2qul_A (A:) D-tagatose 3-epimerase; beta/alpha barrel, isomerase; 1.79A {Pseudomonas cichorii} PDB: 2ou4_A 2qum_A* 2qun_A* Back     alignment and structure
>1ps9_A (A:1-333) 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} Back     alignment and structure
>1o94_A (A:1-343) Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} Back     alignment and structure
>3hgj_A (A:) Chromate reductase; TIM barrel, oxidoreductase; HET: FMN; 2.00A {Thermus scotoductus} PDB: 3hf3_A* Back     alignment and structure
>1i60_A (A:) IOLI protein; beta barrel, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.60A {Bacillus subtilis} Back     alignment and structure
>1gte_A (A:523-742,A:762-821) Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} Back     alignment and structure
>1xp3_A (A:) Endonuclease IV; NFO, DNA replication, DNA recombination, DNA repair, spine, structural genomics, structural proteomics in europe, hydrolase; 2.57A {Bacillus anthracis} Back     alignment and structure
>2zbt_A (A:) Pyridoxal biosynthesis lyase PDXS; pyridoxine biosynthesis, structural genomics, NPPSFA; 1.65A {Thermus thermophilus HB8} PDB: 2iss_A* Back     alignment and structure
>1qtw_A (A:) Endonuclease IV; DNA repair enzyme, TIM barrel, trinuclear Zn cluster, hydrolase; 1.02A {Escherichia coli} Back     alignment and structure