254780439

254780439

carbamoyl phosphate synthase large subunit

GeneID in NCBI database:8209425Locus tag:CLIBASIA_01620
Protein GI in NCBI database:254780439Protein Accession:YP_003064852.1
Gene range:+(346164, 349652)Protein Length:1162aa
Gene description:carbamoyl phosphate synthase large subunit
COG prediction:[E] [F] Carbamoylphosphate synthase large subunit (split gene in MJ)
KEGG prediction:carB; carbamoyl phosphate synthase large subunit (EC:6.3.5.5); K01955 carbamoyl-phosphate synthase large subunit [EC:6.3.5.5]
SEED prediction:Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)
Pathway involved in KEGG:Pyrimidine metabolism [PATH:las00240]
Alanine, aspartate and glutamate metabolism [PATH:las00250]
Subsystem involved in SEED:De Novo Pyrimidine Synthesis
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVM1 TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160--
MPKRQDLKTLLIIGAGPIVIGQACEFDYSGTQACKALKEEGYRIILVNSNPATIMTDPDLADATYTEPITPEVVAKIIEKERPDAILPTTGGQTALNTALSLKRMGVLDRYGVEMIGAKPETIDKAEDRSLFSKAMQNIPLATPKSILANATDIKEHDRKLHEEERENLKKTLSKEELDAALYALELKWNLEENDRKHRYICHAMAVAVQALDEIGLPLIIRPSFTLGGTGGGIAYNRSEFLEIVENGLHASPTTEVLIEESVLGWKEYELEMMRDIKGNCIVVCSIENLDPMGVHTGDSITVAPALTLTDKEYQLMRNAAIAVLKEIGVESGGANVQFAVNPKNGKMVVIEMNPRVSRSSALASKATGFPIAKIAAKLAVGYTLDELGNDITGGKTPASFEPSIDYIVTKIPRFTFEKFPGSDVTLTTSMKSVGEVMAIGRTFAESLQKALRGLETGLTGLDEIHIPSMESDNDPNALRSAISIPCPDRLRTVAQALRLGVSVEETHQSSNIDPWFIQQIKMIVDVEHRIREHGLPKDFQNLQAIKAMGFSDARLSILSGIPCNEIRKIRHQMGLHPVFKCVDTCAGEFSSPTSYMYSTYETNFINKPVSEDKVSDRKKIVILGGGPNRIGQGIEFDYCCCHASFSLKEAGFETIMINCNPETVSTDYDIADRLYFESLTEEDILEILRVEQQKGELVGIIVQFGGQTPLKLSKILEKNQIPILGTQPDSIDLAEDRDRFQKLLMELDLNQPRNGISHSVEHARLIACEIGFPLLIRPSYVLGGRAMQIVYSENMLQDYLLDTLPGLVSEEIKRQYPNDKTGQINTLLGTHPLLFDSYLSDAMEIDVDALCQNDQVIVVGIIEHIEEAGIHSGDSACSLPSRSLSQQLKDELISQTKALAGALNVIGLINVQYAIKDGKIYILEVNPRASRTVPFIAKAIGFPVAKVAARIIAGESLDASIAAYGKRPDLSQIKHFAVKESVFPFNKFPGVDILLGPEMRSTGEVIGIDQDFPLAFAKSQLGIGVDLPHEGTVFVSVRDADKKRIVPIIQNFKKLGFKIMATEGTARFLESHGLETQKINKVLEGRPHIEDAISNRQVHLVINTTEGKKAIEDSKSLRRATLIRKIPYYTTIAGADAVFQAIQALKAGNLEVHSLQSYRYN
ccccccccEEEEEccccHHHccccccHHHHHHHHHHHHHcccEEEEEcccHHHHcccHHHccEEEEccccHHHHHHHHHHHcccEEEEEcccHHHHHHHHHHHHcccHHHcccEEEcccHHHHHHHccHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHcccccccHHHHHHHHccHHHHHHHHHcccccccccHHHccHHHHHHHHHHHcccEEEEEccccccccEEEEccHHHHHHHHHHHHHHcccccEEEEEcccccEEEEEEEEEcccccEEEEEEEEcccccccccccEEEEEccccccHHHHHHHHHHHHHHHHHccccEEEEEEEEEEEccccEEEEEEEccccccHHHHHHHHccccHHHHHHHHHccccHHHccccccccccHHHcccccccEEccccEEEccccccccccccccccEEEEEEEEEccHHHHHHHHHHHHHHHccccccccccHHHccccHHHHHHHHccccHHHHHHHHHHHHccccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHccccHHHHHHHHcccHHHHHHHHHHcccccEEEEEcccccccccccccEEEEcccccccccccccccccccEEEEEccccccccccHHHHHHHHHHHHHHHHcccEEEEEEcccHHccccHHHHHHHHHccccHHHHHHHHHHHHHcccccEEEEccccccHHHHHHHHHHcccEEEcccHHHHHHHHcHHHHHHHHHHcccccccccEEccHHHHHHHHHHccccEEEEEccccccccEEEEccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccccEEEEEEccccEEEEEEEEEcccccEEcccccccccccccccccEEEEccccccHHHHHHHHHHHHHHHHHccccEEEEEEEEEEccEEEEEEEccccccHHHHHHHHHcccHHHHHHHHHccccccccccccccccccccccEEEEEEcccccccccccccccccccccccEEEEEEccHHHHHHHHHHHccccccccccEEEEEccccHHHHHHHHHHHHHcccEEEEEHHHHHHHHHccccEEEEEEcccccHHHHHHHHcccEEEEEEcccccccccccHHHHHHHHHccccEEEcHHHHHHHHHHHHHccccccEEEEcHHHHcc
ccccccccEEEEEcccccEccEccHHHHHHHHHHHHHHHcccEEEEEccccccHHHcHHHccEEEcccccHHHHHHHHHHHcccEEEccccHHHHHHHHHHHHHccHHHHcccEEccccHHHHHHHHcHHHHHHHHHHcccccccEEEEccHHHHHHHHHHcHHHHHHHHHHHHHccccccHHHHHHHHccccccccccHEEccHHHHHHHHHHccccEEEEEcccccccccEEEccHHHHHHHHHHHHHHcccccEEEEEcccccEEEEEEEEEcccccEEEEEEEEEcccccccHHHccEEEccccccHHHHHHHHHHHHHHHHHHccccEEEEEEEEEEccccEEEEEEEEccccHHHHHHHHHHcccHHHHHHHHHccccHHHcEcHHHccccEcccccEcccEEEEEEEccHHHccccccEccccccccEEEEEEEccHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHccccHHHHHHHHHHHHccccHHHHHHHccccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHccccHHHHHHHHcccHHHHHHHHHHHccccEEEEcccEccccccccEEEEEEccHHHccccccccccccccEEEEEcccccEccEcHHHHHHHHHHHHHHHHcccEEEEEEccccccccccccccEEEEccccHHHHHHHHHHHcccEEEcEEEcccccHHHHHHHHHHHHccccEccccHHHHHHHHcHHHHHHHHHHcccccccEEEEccHHHHHHHHHHHcccEEEEccccccccccEEEccHHHHHHHHHHHHHHHcHHHHHHcccccccccEcEEcccccEEEEEcccccEEEEEEEEEccccEEEEEEEEEEEEccccHHHccEEEccccccHHHHHHHHHHHHHHHHHHcccEEEEEEEEEEccEEEEEEEEccccccHHHHHHHHcccHHHHHHHHHHcccHHHccccEEEcccccccccEEEEEEEcHHHHcccccccccccccccEEEEEEEccHHHHHHHHHHHccccccccEEEEEEccHHHHccHHHHHHHHHHccEEEEEEHHHHHHHHccccccEEEcccccccccHHHHHHcccccEEEEccccHHHHHccHHHHHHHHHcccEEEccHHHHHHHHHHHHcccccccEEEEHHHcccc
mpkrqdlktlliigagpivigqacefdysgTQACKALKEEGYRIIlvnsnpatimtdpdladatytepitpEVVAKIIEkerpdailpttggqTALNTALSLKRMGVLDRYgvemigakpetidkaEDRSLFSKAMqniplatpksilanatdikehDRKLHEEERENLKKTLSKEELDAALYALELKWNleendrkhRYICHAMAVAVQALDeiglpliirpsftlggtgggiaynRSEFLEIVEnglhaspttEVLIEESVLGWKEYELEMMRDIKGNCIVVCsienldpmgvhtgdsitvapaltltdKEYQLMRNAAIAVLKEIgvesgganvqfavnpkngkmvviemnprvsrssalaskatgFPIAKIAAKLAVGYTldelgnditggktpasfepsidyivtkiprftfekfpgsdvtlttSMKSVGEVMAIGRTFAESLQKALRGLETgltgldeihipsmesdndpnalrsaisipcpdRLRTVAQALRLGVSVeethqssnidpwFIQQIKMIVDVEHRirehglpkdfQNLQAIKAMgfsdarlsilsgipcneIRKIrhqmglhpvfkcvdtcagefssptsymystyetnfinkpvsedkvsdrkKIVIlgggpnrigqgiefdyccchasfslkeaGFETIMincnpetvstdydiadrlyfeslTEEDILEILRVEQQKGELVGIIVQFGGQTPLKLSKIleknqipilgtqpdsidlAEDRDRFQKLLMELdlnqprngishSVEHARLIACEigfpllirpsyvlggrAMQIVYSENMLQDYLLdtlpglvseeikrqypndktgqintllgthpllfdsyLSDAMEIDVDALCQNDQVIVVGIIEHIeeagihsgdsacslpsrslSQQLKDELISQTKALAGALNVIGLINVQyaikdgkiyilevnprasrtvpfiakaiGFPVAKVAARIIAGESLDASIAaygkrpdlsqikhfavkesvfpfnkfpgvdillgpemrstgevigidqdfpLAFAKsqlgigvdlphegtvfvsvrdadkkriVPIIQNFKKLGFKIMATEGTARFLeshgletqkinkvlegrphiedAISNRQVHLVINTTEGKKAIEDSKSLRRATLIrkipyyttiaGADAVFQAIQALKagnlevhslqsyryn
mpkrqdlkTLLIIGAGPIVIGQACEFDYSGTQACKALKEEGYRIILVNSNPATIMTDPDLADATYTEPITPEVVAKIIEKErpdailpttggqtalntalslkrMGVLDRYGVEMIGAKPETIDKAEDRSLFSKAMqniplatpksilanatdiKEHDRKLHEEERenlkktlskeeLDAALYALELKWNLEENDRKHRYICHAMAVAVQALDEIGLPLIIRPSFTLGGTGGGIAYNRSEFLEIVENGlhaspttevLIEESVLGWKEYELEMMRDIKGNCIVVCSIENLDPMGVHTGDSITVAPALTLTDKEYQLMRNAAIAVLKEIGvesgganvqfavnpkngKMVVIEMNPRVSRSSALASKATGFPIAKIAAKLAVGYTLDELGNDItggktpasfepSIDYIVTKIPrftfekfpgsdvTLTTSMKSVGEVMAIGRTFAESLQKALRGLETGLTGLDEIHIPSMESDNDPNALRSAISIPCPDRLRTVAQALRLGVSVeethqssnidpwfIQQIKMIVDVEHRIREHGLPKDFQNLQAIKAMGFSDARLSILSGIPCNEIRKIRHQMGLHPVFKCVDTCAGEFSSPTSYMYSTYETNFInkpvsedkvsdRKKIVILGGGPNRIGQGIEFDYCCCHASFSLKEAGFETIMINCNPETVSTDYDIADRLYFESLTEEDILEILRVEQQKGELVGIIVQFGGQTPLKLSKILeknqipilgtqpdsidlAEDRDRFQKLLMELDLNQPRNGISHSVEHARLIACEIGFPLLIRPSYVLGGRAMQIVYSENMLQDYLLDTLPGLVSEEIKRQYPNDKTGQINTLLGTHPLLFDSYLSDAMEIDVDALCQNDQVIVVGIIEHIEEAGIHSGDSACSLPSRSLSQQLKDELISQTKALAGALNVIGLINVQYAIKDGKIYILEVNPRASRTVPFIAKAIGFPVAKVAARIIAGESLDASIAAYGKRPDLSQIKHFAVKESVFPFNKFPGVDILLGPEMRSTGEVIGIDQDFPLAFAKSQLGIGVDLPHEGTVFvsvrdadkkriVPIIQNFKKLGFKIMATEGTARFLESHGLETQKINKVLEGRPHIEdaisnrqvhlvinttegkkaiedskslrRATLIRKIPYYTTIAGADAVFQAIQALKAgnlevhslqsyryn
MPKRQDLKTLLIIGAGPIVIGQACEFDYSGTQACKALKEEGYRIILVNSNPATIMTDPDLADATYTEPITPEVVAKIIEKERPDAILPTTGGQTALNTALSLKRMGVLDRYGVEMIGAKPETIDKAEDRSLFSKAMQNIPLATPKSILANATDIKEHDRKLHEEERENLKKTLSKeeldaalyalelKWNLEENDRKHRYICHAMAVAVQALDEIGLPLIIRPSFTLGGTGGGIAYNRSEFLEIVENGLHASPTTEVLIEESVLGWKEYELEMMRDIKGNCIVVCSIENLDPMGVHTGDSITVAPALTLTDKEYQLMRNAAIAVLKEIGVESGGANVQFAVNPKNGKMVVIEMNPRVSRSSALASKATGFPIAKIAAKLAVGYTLDELGNDITGGKTPASFEPSIDYIVTKIPRFTFEKFPGSDVTLTTSMKSVGEVMAIGRTFAESLQKALRGLETGLTGLDEIHIPSMESDNDPNALRSAISIPCPDRLRTVAQALRLGVSVEETHQSSNIDPWFIQQIKMIVDVEHRIREHGLPKDFQNLQAIKAMGFSDARLSILSGIPCNEIRKIRHQMGLHPVFKCVDTCAGEFSSPTSYMYSTYETNFINKPVSEDKVSDRKKIVILGGGPNRIGQGIEFDYCCCHASFSLKEAGFETIMINCNPETVSTDYDIADRLYFESLTEEDILEILRVEQQKGELVGIIVQFGGQTPLKLSKILEKNQIPILGTQPDSIDLAEDRDRFQKLLMELDLNQPRNGISHSVEHARLIACEIGFPLLIRPSYVLGGRAMQIVYSENMLQDYLLDTLPGLVSEEIKRQYPNDKTGQINTLLGTHPLLFDSYLSDAMEIDVDALCQNDQvivvgiiehieeagihSGDSACSLPSRSLSQQLKDELISQTKALAGALNVIGLINVQYAIKDGKIYILEVNPRASRTVPFIAKAIGFPVAKVAARIIAGESLDASIAAYGKRPDLSQIKHFAVKESVFPFNKFPGVDILLGPEMRSTGEVIGIDQDFPLAFAKSQLGIGVDLPHEGTVFVSVRDADKKRIVPIIQNFKKLGFKIMATEGTARFLESHGLETQKINKVLEGRPHIEDAISNRQVHLVINTTEGKKAIEDSKSLRRATLIRKIPYYTTIAGADAVFQAIQALKAGNLEVHSLQSYRYN
*PKRQDLKTLLIIGAGPIVIGQACEFDYSGTQACKALKEEGYRIILVNSNPATIMTDPDLADATYTEPITPEVVAKIIEKERPDAILPTTGGQTALNTALSLKRMGVLDRYGVEMIGAKPETIDKAEDRSLFSKAMQNIPLATPKSILANATDIKEHDRKLHEEERENLKKTLSKEELDAALYALELKWNLEENDRKHRYICHAMAVAVQALDEIGLPLIIRPSFTLGGTGGGIAYNRSEFLEIVENGLHASPTTEVLIEESVLGWKEYELEMMRDIKGNCIVVCSIENLDPMGVHTGDSITVAPALTLTDKEYQLMRNAAIAVLKEIGVESGGANVQFAVNPKNGKMVVIEMNPRVSRSSALASKATGFPIAKIAAKLAVGYTLDELGNDITGGKTPASFEPSIDYIVTKIPRFTFEKFPGSDVTLTTSMKSVGEVMAIGRTFAESLQKALRGLETGLTGLDEIHIPSMESDNDPNALRSAISIPCPDRLRTVAQALRLGVSVEETHQSSNIDPWFIQQIKMIVDVEHRIREHGLPKDFQNLQAIKAMGFSDARLSILSGIPCNEIRKIRHQMGLHPVFKCVDTCAGEFSSPTSYMYSTYETNF***********DRKKIVILGGGPNRIGQGIEFDYCCCHASFSLKEAGFETIMINCNPETVSTDYDIADRLYFESLTEEDILEILRVEQQKGELVGIIVQFGGQTPLKLSKILEKNQIPILGTQPDSIDLAEDRDRFQKLLMELDLNQPRNGISHSVEHARLIACEIGFPLLIRPSYVLGGRAMQIVYSENMLQDYLLDTLPGLVSEEIKRQYPNDKTGQINTLLGTHPLLFDSYLSDAMEIDVDALCQNDQVIVVGIIEHIEEAGIHSGDSACSLPSRSLSQQLKDELISQTKALAGALNVIGLINVQYAIKDGKIYILEVNPRASRTVPFIAKAIGFPVAKVAARIIAGESLDASIAAYGKRPDLSQIKHFAVKESVFPFNKFPGVDILLGPEMRSTGEVIGIDQDFPLAFAKSQLGIGVDLPHEGTVFVSVRDADKKRIVPIIQNFKKLGFKIMATEGTARFLESHGLETQKINKVLEGRPHIEDAISNRQVHLVINTTEGKKAIEDSKSLRRATLIRKIPYYTTIAGADAVFQAIQALKAGNLEVHSLQS****
MPKRQDLKTLLIIGAGPIVIGQACEFDYSGTQACKALKEEGYRIILVNSNPATIMTDPDLADATYTEPITPEVVAKIIEKERPDAILPTTGGQTALNTALSLKRMGVLDRYGVEMIGAKPETIDKAEDRSLFSKAMQNIPLATPKSILANATDIKEHDRKLHEEERENLKKTLSKEELDAALYALELKWNLEENDRKHRYICHAMAVAVQALDEIGLPLIIRPSFTLGGTGGGIAYNRSEFLEIVENGLHASPTTEVLIEESVLGWKEYELEMMRDIKGNCIVVCSIENLDPMGVHTGDSITVAPALTLTDKEYQLMRNAAIAVLKEIGVESGGANVQFAVNPKNGKMVVIEMNPRVSRSSALASKATGFPIAKIAAKLAVGYTLDELGNDITGGKTPASFEPSIDYIVTKIPRFTFEKFPGSDVTLTTSMKSVGEVMAIGRTFAESLQKALRGLETGLTGLDEIHIPSMESDNDPNALRSAISIPCPDRLRTVAQALRLGVSVEETHQSSNIDPWFIQQIKMIVDVEHRIREHGLPKDFQNLQAIKAMGFSDARLSILSGIPCNEIRKIRHQMGLHPVFKCVDTCAGEFSSPTSYMYSTYETNFINKPVSEDKVSDRKKIVILGGGPNRIGQGIEFDYCCCHASFSLKEAGFETIMINCNPETVSTDYDIADRLYFESLTEEDILEILRVEQQKGELVGIIVQFGGQTPLKLSKILEKNQIPILGTQPDSIDLAEDRDRFQKLLMELDLNQPRNGISHSVEHARLIACEIGFPLLIRPSYVLGGRAMQIVYSENMLQDYLLDTLPGLVSEEIKRQYPNDKTGQINTLLGTHPLLFDSYLSDAMEIDVDALCQNDQVIVVGIIEHIEEAGIHSGDSACSLPSRSLSQQLKDELISQTKALAGALNVIGLINVQYAIKDGKIYILEVNPRASRTVPFIAKAIGFPVAKVAARIIAGESLDASIAAYGKRPDLSQIKHFAVKESVFPFNKFPGVDILLGPEMRSTGEVIGIDQDFPLAFAKSQLGIGVDLPHEGTVFVSVRDADKKRIVPIIQNFKKLGFKIMATEGTARFLESHGLETQKINKVLEGRPHIEDAISNRQVHLVINTTEGKKAIEDSKSLRRATLIRKIPYYTTIAGADAVFQAIQALKAGNLEVHSLQSYRYN
****QDLKTLLIIGAGPIVIGQACEFDYSGTQACKALKEEGYRIILVNSNPATIMTDPDLADATYTEPITPEVVAKIIEKERPDAILPTTGGQTALNTALSLKRMGVLDRYGVEMIGAKPETIDKAEDRSLFSKAMQNIPLATPKSILANATDIKEHDRKLHEEERENLKKTLSKEELDAALYALELKWNLEENDRKHRYICHAMAVAVQALDEIGLPLIIRPSFTLGGTGGGIAYNRSEFLEIVENGLHASPTTEVLIEESVLGWKEYELEMMRDIKGNCIVVCSIENLDPMGVHTGDSITVAPALTLTDKEYQLMRNAAIAVLKEIGVESGGANVQFAVNPKNGKMVVIEMNPRVSRSSALASKATGFPIAKIAAKLAVGYTLDELGNDITGGKTPASFEPSIDYIVTKIPRFTFEKFPGSDVTLTTSMKSVGEVMAIGRTFAESLQKALRGLETGLTGLDEIHIPSMESDNDPNALRSAISIPCPDRLRTVAQALRLGVSVEETHQSSNIDPWFIQQIKMIVDVEHRIREHGLPKDFQNLQAIKAMGFSDARLSILSGIPCNEIRKIRHQMGLHPVFKCVDTCAGEFSSPTSYMYSTYETNFINK*******SDRKKIVILGGGPNRIGQGIEFDYCCCHASFSLKEAGFETIMINCNPETVSTDYDIADRLYFESLTEEDILEILRVEQQKGELVGIIVQFGGQTPLKLSKILEKNQIPILGTQPDSIDLAEDRDRFQKLLMELDLNQPRNGISHSVEHARLIACEIGFPLLIRPSYVLGGRAMQIVYSENMLQDYLLDTLPGLVSEEIKRQYPNDKTGQINTLLGTHPLLFDSYLSDAMEIDVDALCQNDQVIVVGIIEHIEEAGIHSGDSACSLPSRSLSQQLKDELISQTKALAGALNVIGLINVQYAIKDGKIYILEVNPRASRTVPFIAKAIGFPVAKVAARIIAGESLDASIAAYGKRPDLSQIKHFAVKESVFPFNKFPGVDILLGPEMRSTGEVIGIDQDFPLAFAKSQLGIGVDLPHEGTVFVSVRDADKKRIVPIIQNFKKLGFKIMATEGTARFLESHGLETQKINKVLEGRPHIEDAISNRQVHLVINTTEGKKAIEDSKSLRRATLIRKIPYYTTIAGADAVFQAIQALKAGNLEVHSLQSYRYN
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPKRQDLKTLLIIGAGPIVIGQACEFDYSGTQACKALKEEGYRIILVNSNPATIMTDPDLADATYTEPITPEVVAKIIEKERPDAILPTTGGQTALNTALSLKRMGVLDRYGVEMIGAKPETIDKAEDRSLFSKAMQNIPLATPKSILANATDIKEHDxxxxxxxxxxxxxxxxxxxxxAALYALELKWNLEENDRKHRYICHAMAVAVQALDEIGLPLIIRPSFTLGGTGGGIAYNRSEFLEIVENGLHASPTTEVLIEESVLGWKEYELEMMRDIKGNCIVVCSIENLDPMGVHTGDSITVAPALTLTDKEYQLMRNAAIAVLKEIGVESGGANVQFAVNPKNGKMVVIEMNPRVSRSSALASKATGFPIAKIAAKLAVGYTLDELGNDITGGKTPASFEPSIDYIVTKIPRFTFEKFPGSDVTLTTSMKSVGEVMAIGRTFAESLQKALRGLETGLTGLDEIHIPSMESDNDPNALRSAISIPCPDRLRTVAQALRLGVSVEETHQSSNIDPWFIQQIKMIVDVEHRIREHGLPKDFQNLQAIKAMGFSDARLSILSGIPCNEIRKIRHQMGLHPVFKCVDTCAGEFSSPTSYMYSTYETNFINKPVSEDKVSDRKKIVILGGGPNRIGQGIEFDYCCCHASFSLKEAGFETIMINCNPETVSTDYDIADRLYFESLTEEDILEILRVEQQKGELVGIIVQFGGQTPLKLSKILEKNQIPILGTQPDSIDLAEDRDRFQKLLMELDLNQPRNGISHSVEHARLIACEIGFPLLIRPSYVLGGRAMQIVYSENMLQDYLLDTLPGLVSEEIKRQYPNDKTGQINTLLGTHPLLFDSYLSDAMEIDVDALCQNDQVIVVGIIEHIEEAGIHSGDSACSLPSRSLSQQLKDELISQTKALAGALNVIGLINVQYAIKDGKIYILEVNPRASRTVPFIAKAIGFPVAKVAARIIAGESLDASIAAYGKRPDLSQIKHFAVKESVFPFNKFPGVDILLGPEMRSTGEVIGIDQDFPLAFAKSQLGIGVDLPHEGTVFVSVRDADKKRIVPIIQNFKKLGFKIMATEGTARFLESHGLETQKINKVLEGRPHIEDAISNRQVHLVINTTEGKKAIEDSKSLRRATLIRKIPYYTTIAGADAVFQAIQALKAGNLEVHSLQSYRYN
MPKRQDLKTLLIIGAGPIVIGQACEFDYSGTQACKALKEEGYRIILVNSNPATIMTDPDLADATYTEPITPEVVAKIIEKERPDAILPTTGGQTALNTALSLKRMGVLDRYGVEMIGAKPETIDKAEDRSLFSKAMQNIPLATPKSILANATDIKEHDRKLHEEERENLKKTLSKEELDAALYALELKWNLEENDRKHRYICHAMAVAVQALDEIGLPLIIRPSFTLGGTGGGIAYNRSEFLEIVENGLHASPTTEVLIEESVLGWKEYELEMMRDIKGNCIVVCSIENLDPMGVHTGDSITVAPALTLTDKEYQLMRNAAIAVLKEIGVESGGANVQFAVNPKNGKMVVIEMNPRVSRSSALASKATGFPIAKIAAKLAVGYTLDELGNDITGGKTPASFEPSIDYIVTKIPRFTFEKFPGSDVTLTTSMKSVGEVMAIGRTFAESLQKALRGLETGLTGLDEIHIPSMESDNDPNALRSAISIPCPDRLRTVAQALRLGVSVEETHQSSNIDPWFIQQIKMIVDVEHRIREHGLPKDFQNLQAIKAMGFSDARLSILSGIPCNEIRKIRHQMGLHPVFKCVDTCAGEFSSPTSYMYSTYETNFINKPVSEDKVSDRKKIVILGGGPNRIGQGIEFDYCCCHASFSLKEAGFETIMINCNPETVSTDYDIADRLYFESLTEEDILEILRVEQQKGELVGIIVQFGGQTPLKLSKILEKNQIPILGTQPDSIDLAEDRDRFQKLLMELDLNQPRNGISHSVEHARLIACEIGFPLLIRPSYVLGGRAMQIVYSENMLQDYLLDTLPGLVSEEIKRQYPNDKTGQINTLLGTHPLLFDSYLSDAMEIDVDALCQNDQVIVVGIIEHIEEAGIHSGDSACSLPSRSLSQQLKDELISQTKALAGALNVIGLINVQYAIKDGKIYILEVNPRASRTVPFIAKAIGFPVAKVAARIIAGESLDASIAAYGKRPDLSQIKHFAVKESVFPFNKFPGVDILLGPEMRSTGEVIGIDQDFPLAFAKSQLGIGVDLPHEGTVFVSVRDADKKRIVPIIQNFKKLGFKIMATEGTARFLESHGLETQKINKVLEGRPHIEDAISNRQVHLVINTTEGKKAIEDSKSLRRATLIRKIPYYTTIAGADAVFQAIQALKAGNLEVHSLQSYRYN
MPKRQDLKTLLIIGAGPIVIGQACEFDYSGTQACKALKEEGYRIILVNSNPATIMTDPDLADATYTEPITPEVVAKIIEKERPDAILPTTGGQTALNTALSLKRMGVLDRYGVEMIGAKPETIDKAEDRSLFSKAMQNIPLATPKSILANATDIKEHDRKLHEEERENLKKTLSKEELDAALYALELKWNLEENDRKHRYICHAMAVAVQALDEIGLPLIIRPSFTLGGTGGGIAYNRSEFLEIVENGLHASPTTEVLIEESVLGWKEYELEMMRDIKGNCIVVCSIENLDPMGVHTGDSITVAPALTLTDKEYQLMRNAAIAVLKEIGVESGGANVQFAVNPKNGKMVVIEMNPRVSRSSALASKATGFPIAKIAAKLAVGYTLDELGNDITGGKTPASFEPSIDYIVTKIPRFTFEKFPGSDVTLTTSMKSVGEVMAIGRTFAESLQKALRGLETGLTGLDEIHIPSMESDNDPNALRSAISIPCPDRLRTVAQALRLGVSVEETHQSSNIDPWFIQQIKMIVDVEHRIREHGLPKDFQNLQAIKAMGFSDARLSILSGIPCNEIRKIRHQMGLHPVFKCVDTCAGEFSSPTSYMYSTYETNFINKPVSEDKVSDRKKIVILGGGPNRIGQGIEFDYCCCHASFSLKEAGFETIMINCNPETVSTDYDIADRLYFESLTEEDILEILRVEQQKGELVGIIVQFGGQTPLKLSKILEKNQIPILGTQPDSIDLAEDRDRFQKLLMELDLNQPRNGISHSVEHARLIACEIGFPLLIRPSYVLGGRAMQIVYSENMLQDYLLDTLPGLVSEEIKRQYPNDKTGQINTLLGTHPLLFDSYLSDAMEIDVDALCQNDQVIVVGIIEHIEEAGIHSGDSACSLPSRSLSQQLKDELISQTKALAGALNVIGLINVQYAIKDGKIYILEVNPRASRTVPFIAKAIGFPVAKVAARIIAGESLDASIAAYGKRPDLSQIKHFAVKESVFPFNKFPGVDILLGPEMRSTGEVIGIDQDFPLAFAKSQLGIGVDLPHEGTVFVSVRDADKKRIVPIIQNFKKLGFKIMATEGTARFLESHGLETQKINKVLEGRPHIEDAISNRQVHLVINTTEGKKAIEDSKSLRRATLIRKIPYYTTIAGADAVFQAIQALKAGNLEVHSLQSYRYN

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target1162 carbamoyl phosphate synthase large subunit [Candidatus
254780268443 acetyl-CoA carboxylase biotin carboxylase subunit 2e-08
254780268443 acetyl-CoA carboxylase biotin carboxylase subunit 7e-05
>gi|254780268|ref|YP_003064681.1| acetyl-CoA carboxylase biotin carboxylase subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 443 Back     alignment
 Score = 53.9 bits (128), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 54/230 (23%), Positives = 96/230 (41%), Gaps = 42/230 (18%)

Query: 712 KLSKILEKNQIPILGTQPDSIDLAEDRDRFQKLLMELDLNQ-PRNGISHSVEHARLIACE 770
           K ++ILE + I  +G   + I +  D+   +K   +L +   P +G  +    A  IA E
Sbjct: 90  KFAEILEDHHIKFIGPSSEHIKIMGDKITAKKTAQQLGIPVVPGSGEVYP-HTAMPIAKE 148

Query: 771 IGFPLLIRPSYVLGGRAMQIVYSENMLQDYLLDTLPGLVSEEIKRQYPNDKTGQINTLLG 830
           IGFP+L++ S   GGR M+I YSEN L + +                 +    +     G
Sbjct: 149 IGFPVLVKASAGGGGRGMRIAYSENDLSEAI-----------------DQARSEALAAFG 191

Query: 831 THPLLFDSYLSDAMEIDVDALCQNDQVIVVGIIEHIEEAGIHSGDSACSLPSRS------ 884
              +  + YL +   I+V       Q+   G+        IH G+  CS+  R+      
Sbjct: 192 NDAVYIEKYLENPRHIEV-------QIFGDGM-----GNAIHFGERDCSVQRRNQKIWEE 239

Query: 885 -----LSQQLKDELISQTKALAGALNVIGLINVQYAIKDGKIYILEVNPR 929
                +S Q + E+          ++  G   +++  ++G+ Y +E+N R
Sbjct: 240 AHSPVISAQDRTEIGETCVKAMKKIDYRGAGTIEFLYENGQFYFIEMNTR 289

>gi|254780268|ref|YP_003064681.1| acetyl-CoA carboxylase biotin carboxylase subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 443 Back     alignment
 Score = 41.6 bits (96), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 45/188 (23%), Positives = 78/188 (41%), Gaps = 17/188 (9%)

Query: 214 EIGLPLIIRPSFTLGGTGGGIAYNRSEFLEIVEN----GLHASPTTEVLIEESVLGWKEY 269
           EIG P++++ S   GG G  IAY+ ++  E ++      L A     V IE+ +   +  
Sbjct: 148 EIGFPVLVKASAGGGGRGMRIAYSENDLSEAIDQARSEALAAFGNDAVYIEKYLENPRHI 207

Query: 270 ELEMMRDIKGNCIVV----CSIENLDPMGVHTGDSITVAPALTLTDKEYQLMRNAAIAVL 325
           E+++  D  GN I      CS++  +        S    P ++  D+    +    +  +
Sbjct: 208 EVQIFGDGMGNAIHFGERDCSVQRRNQKIWEEAHS----PVISAQDR--TEIGETCVKAM 261

Query: 326 KEIGVESGGANVQFAVNPKNGKMVVIEMNPRVSRSSALASKATGFPIAKIAAKLAVGYTL 385
           K+I    G   ++F    +NG+   IEMN R+     +    TG  +      +A    L
Sbjct: 262 KKIDYR-GAGTIEFLY--ENGQFYFIEMNTRLQVEHPVTEAITGIDLVHEQIYVASENRL 318

Query: 386 DELGNDIT 393
                DIT
Sbjct: 319 SVQQKDIT 326

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target1162 carbamoyl phosphate synthase large subunit [Candidatus
3151221121162 carbamoyl phosphate synthase large subunit [Candidatus 1 0.0
2278221231163 carbamoyl phosphate synthase large subunit [Sinorhizobi 1 0.0
3073171861163 carbamoyl-phosphate synthase, large subunit [Sinorhizob 1 0.0
159653291163 carbamoyl phosphate synthase large subunit [Sinorhizobi 1 0.0
1503964751163 carbamoyl phosphate synthase large subunit [Sinorhizobi 1 0.0
1591850891162 carbamoyl phosphate synthase large subunit [Agrobacteri 1 0.0
1162531611162 carbamoyl phosphate synthase large subunit [Rhizobium l 1 0.0
2220865551161 carbamoyl-phosphate synthase large chain (ammonia chain 1 0.0
3271927081162 carbamoyl-phosphate synthase (glutamine-hydrolyzing) pr 1 0.0
863585681162 carbamoyl phosphate synthase large subunit [Rhizobium e 1 0.0
>gi|315122112|ref|YP_004062601.1| carbamoyl phosphate synthase large subunit [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 1162 Back     alignment and organism information
 Score = 2173 bits (5631), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1041/1162 (89%), Positives = 1112/1162 (95%)

Query: 1    MPKRQDLKTLLIIGAGPIVIGQACEFDYSGTQACKALKEEGYRIILVNSNPATIMTDPDL 60
            MPKRQD+K++LIIGAGPIVIGQACEFDYSGTQACKALKEEGYRIIL+NSNPATIMTDPDL
Sbjct: 1    MPKRQDIKSILIIGAGPIVIGQACEFDYSGTQACKALKEEGYRIILINSNPATIMTDPDL 60

Query: 61   ADATYTEPITPEVVAKIIEKERPDAILPTTGGQTALNTALSLKRMGVLDRYGVEMIGAKP 120
            ADATYTEPITPEVV KIIEKERPDAILPTTGGQTALNTALSLKRMGVLDRYGVEMIGAKP
Sbjct: 61   ADATYTEPITPEVVTKIIEKERPDAILPTTGGQTALNTALSLKRMGVLDRYGVEMIGAKP 120

Query: 121  ETIDKAEDRSLFSKAMQNIPLATPKSILANATDIKEHDRKLHEEERENLKKTLSKEELDA 180
            +TIDKAEDR+LFSKAM+NIPLATPKSILANATD+K +DRKLHE ERENLKK LSKEELD+
Sbjct: 121  DTIDKAEDRALFSKAMKNIPLATPKSILANATDVKNNDRKLHEAERENLKKNLSKEELDS 180

Query: 181  ALYALELKWNLEENDRKHRYICHAMAVAVQALDEIGLPLIIRPSFTLGGTGGGIAYNRSE 240
            ALYALE+KWNLEEN RKHRYICHAMA+AVQALDEIGLPLIIRPSFTLGGTGGGIAYNRSE
Sbjct: 181  ALYALEIKWNLEENARKHRYICHAMAIAVQALDEIGLPLIIRPSFTLGGTGGGIAYNRSE 240

Query: 241  FLEIVENGLHASPTTEVLIEESVLGWKEYELEMMRDIKGNCIVVCSIENLDPMGVHTGDS 300
            F EIVENGLHASPTTEVLIEESVLGWKEYE EM+RD K NCIVVCSIEN+DPMGVHTGDS
Sbjct: 241  FFEIVENGLHASPTTEVLIEESVLGWKEYEFEMIRDKKDNCIVVCSIENIDPMGVHTGDS 300

Query: 301  ITVAPALTLTDKEYQLMRNAAIAVLKEIGVESGGANVQFAVNPKNGKMVVIEMNPRVSRS 360
            ITVAPALTLTDKEYQLMRNAAIAVLKEIGVE+GGANVQFAVNPK+GKMVVIEMNPRVSRS
Sbjct: 301  ITVAPALTLTDKEYQLMRNAAIAVLKEIGVETGGANVQFAVNPKDGKMVVIEMNPRVSRS 360

Query: 361  SALASKATGFPIAKIAAKLAVGYTLDELGNDITGGKTPASFEPSIDYIVTKIPRFTFEKF 420
            SALASKATGFPIAKIAAKLAVGYTLDELGNDITGGKTPASFEPSIDYIVTKIPRF FEKF
Sbjct: 361  SALASKATGFPIAKIAAKLAVGYTLDELGNDITGGKTPASFEPSIDYIVTKIPRFAFEKF 420

Query: 421  PGSDVTLTTSMKSVGEVMAIGRTFAESLQKALRGLETGLTGLDEIHIPSMESDNDPNALR 480
            PG+D TLTTSMKSVGEVMAIGR+F ESLQKALRGLETGLTGLDEI IPSMES ND NA+R
Sbjct: 421  PGADTTLTTSMKSVGEVMAIGRSFPESLQKALRGLETGLTGLDEIQIPSMESANDQNAIR 480

Query: 481  SAISIPCPDRLRTVAQALRLGVSVEETHQSSNIDPWFIQQIKMIVDVEHRIREHGLPKDF 540
            +AISIP PDRLR VAQALRLG+SVEETHQ  NIDPWFIQQIKMIVD+EHRI E G+PKDF
Sbjct: 481  AAISIPSPDRLRMVAQALRLGMSVEETHQGCNIDPWFIQQIKMIVDMEHRICEQGIPKDF 540

Query: 541  QNLQAIKAMGFSDARLSILSGIPCNEIRKIRHQMGLHPVFKCVDTCAGEFSSPTSYMYST 600
             N   IKAMGFSDARLS+LSGI  +EIR++R+++ +HPVFKC+DTCAGEF SPTSYMYST
Sbjct: 541  HNFHTIKAMGFSDARLSLLSGISIHEIREMRNKLNVHPVFKCIDTCAGEFLSPTSYMYST 600

Query: 601  YETNFINKPVSEDKVSDRKKIVILGGGPNRIGQGIEFDYCCCHASFSLKEAGFETIMINC 660
            YE  FIN+ +SEDKVSDRKKIVILGGGPNRIGQGIEFDYCCCHA+FSLKEAGFETIMINC
Sbjct: 601  YEKKFINQAMSEDKVSDRKKIVILGGGPNRIGQGIEFDYCCCHATFSLKEAGFETIMINC 660

Query: 661  NPETVSTDYDIADRLYFESLTEEDILEILRVEQQKGELVGIIVQFGGQTPLKLSKILEKN 720
            NPETVSTDYDIADRLYFESLTEED+LE+LR+EQQKGEL+G+IVQFGGQTPLKL++ LEKN
Sbjct: 661  NPETVSTDYDIADRLYFESLTEEDVLEVLRIEQQKGELIGVIVQFGGQTPLKLAQALEKN 720

Query: 721  QIPILGTQPDSIDLAEDRDRFQKLLMELDLNQPRNGISHSVEHARLIACEIGFPLLIRPS 780
            QIPILGTQPDSIDLAEDRDRFQKLLM+L+LNQP+NGISHSVE AR+IA EIGFP LIRPS
Sbjct: 721  QIPILGTQPDSIDLAEDRDRFQKLLMKLNLNQPKNGISHSVEQARIIAREIGFPFLIRPS 780

Query: 781  YVLGGRAMQIVYSENMLQDYLLDTLPGLVSEEIKRQYPNDKTGQINTLLGTHPLLFDSYL 840
            YVLGGRAMQI+YSENMLQDYLL+T+P LVSEEIKRQYPNDKTGQINTLLG +PLLFDSYL
Sbjct: 781  YVLGGRAMQIIYSENMLQDYLLETVPELVSEEIKRQYPNDKTGQINTLLGKNPLLFDSYL 840

Query: 841  SDAMEIDVDALCQNDQVIVVGIIEHIEEAGIHSGDSACSLPSRSLSQQLKDELISQTKAL 900
            SDA+EIDVDALCQ DQVIVVGI+EHIEEAGIHSGDSACSLPSRSLS+QLKDELISQTKAL
Sbjct: 841  SDAIEIDVDALCQKDQVIVVGIMEHIEEAGIHSGDSACSLPSRSLSKQLKDELISQTKAL 900

Query: 901  AGALNVIGLINVQYAIKDGKIYILEVNPRASRTVPFIAKAIGFPVAKVAARIIAGESLDA 960
            A +LNV+GLINVQYAIKDGKIYI+EVNPRASRTVPFIAKAIGFP+AKVAARIIAGESLD+
Sbjct: 901  ACSLNVVGLINVQYAIKDGKIYIIEVNPRASRTVPFIAKAIGFPIAKVAARIIAGESLDS 960

Query: 961  SIAAYGKRPDLSQIKHFAVKESVFPFNKFPGVDILLGPEMRSTGEVIGIDQDFPLAFAKS 1020
            +I AYG+RPDLS+IKHFAVKESVFPFNKF GVDILLGPEMRSTGEVIG+D+DFPLAFAKS
Sbjct: 961  AIEAYGERPDLSKIKHFAVKESVFPFNKFLGVDILLGPEMRSTGEVIGMDRDFPLAFAKS 1020

Query: 1021 QLGIGVDLPHEGTVFVSVRDADKKRIVPIIQNFKKLGFKIMATEGTARFLESHGLETQKI 1080
            QLG GVDLP EGTVFVSVRDADKKRIVPII+ F+ LGFKIMATEGTARFL+S GLETQKI
Sbjct: 1021 QLGAGVDLPREGTVFVSVRDADKKRIVPIIRTFQNLGFKIMATEGTARFLDSQGLETQKI 1080

Query: 1081 NKVLEGRPHIEDAISNRQVHLVINTTEGKKAIEDSKSLRRATLIRKIPYYTTIAGADAVF 1140
            NKVLEGRPHI+DAISNRQVHLVINTTEGKKAIEDSKSLRR+TL+RKIPYYTTIAGA+AV 
Sbjct: 1081 NKVLEGRPHIDDAISNRQVHLVINTTEGKKAIEDSKSLRRSTLVRKIPYYTTIAGAEAVS 1140

Query: 1141 QAIQALKAGNLEVHSLQSYRYN 1162
            QAIQALK G LEV+SLQSYRYN
Sbjct: 1141 QAIQALKEGTLEVYSLQSYRYN 1162


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|227822123|ref|YP_002826094.1| carbamoyl phosphate synthase large subunit [Sinorhizobium fredii NGR234] Length = 1163 Back     alignment and organism information
>gi|307317186|ref|ZP_07596627.1| carbamoyl-phosphate synthase, large subunit [Sinorhizobium meliloti AK83] Length = 1163 Back     alignment and organism information
>gi|15965329|ref|NP_385682.1| carbamoyl phosphate synthase large subunit [Sinorhizobium meliloti 1021] Length = 1163 Back     alignment and organism information
>gi|150396475|ref|YP_001326942.1| carbamoyl phosphate synthase large subunit [Sinorhizobium medicae WSM419] Length = 1163 Back     alignment and organism information
>gi|159185089|ref|NP_355138.2| carbamoyl phosphate synthase large subunit [Agrobacterium tumefaciens str. C58] Length = 1162 Back     alignment and organism information
>gi|116253161|ref|YP_768999.1| carbamoyl phosphate synthase large subunit [Rhizobium leguminosarum bv. viciae 3841] Length = 1162 Back     alignment and organism information
>gi|222086555|ref|YP_002545089.1| carbamoyl-phosphate synthase large chain (ammonia chain) protein [Agrobacterium radiobacter K84] Length = 1161 Back     alignment and organism information
>gi|327192708|gb|EGE59645.1| carbamoyl-phosphate synthase (glutamine-hydrolyzing) protein, large chain [Rhizobium etli CNPAF512] Length = 1162 Back     alignment and organism information
>gi|86358568|ref|YP_470460.1| carbamoyl phosphate synthase large subunit [Rhizobium etli CFN 42] Length = 1162 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target1162 carbamoyl phosphate synthase large subunit [Candidatus
PRK052941066 PRK05294, carB, carbamoyl phosphate synthase large subu 0.0
TIGR013691050 TIGR01369, CPSaseII_lrg, carbamoyl-phosphate synthase, 0.0
PLN027351102 PLN02735, PLN02735, carbamoyl-phosphate synthase 0.0
PRK128151068 PRK12815, carB, carbamoyl phosphate synthase large subu 0.0
KOG03701435 KOG0370, KOG0370, KOG0370, Multifunctional pyrimidine s 0.0
COG0458400 COG0458, CarB, Carbamoylphosphate synthase large subuni 1e-154
pfam02786211 pfam02786, CPSase_L_D2, Carbamoyl-phosphate synthase L 1e-63
COG10381149 COG1038, PycA, Pyruvate carboxylase [Energy production 5e-11
PRK08654499 PRK08654, PRK08654, pyruvate carboxylase subunit A; Val 2e-09
KOG03691176 KOG0369, KOG0369, KOG0369, Pyruvate carboxylase [Energy 7e-09
TIGR012351143 TIGR01235, pyruv_carbox, pyruvate carboxylase 9e-09
KOG0238670 KOG0238, KOG0238, KOG0238, 3-Methylcrotonyl-CoA carboxy 1e-08
COG4770645 COG4770, COG4770, Acetyl/propionyl-CoA carboxylase, alp 1e-08
PRK07178472 PRK07178, PRK07178, pyruvate carboxylase subunit A; Val 8e-07
PRK129991146 PRK12999, PRK12999, pyruvate carboxylase; Reviewed 8e-06
PRK05586447 PRK05586, PRK05586, biotin carboxylase; Validated 1e-05
PRK08463478 PRK08463, PRK08463, acetyl-CoA carboxylase subunit A; V 3e-04
TIGR00514449 TIGR00514, accC, acetyl-CoA carboxylase, biotin carboxy 0.001
PRK08462445 PRK08462, PRK08462, biotin carboxylase; Validated 0.002
PLN02735 1102 PLN02735, PLN02735, carbamoyl-phosphate synthase 8e-59
COG0458400 COG0458, CarB, Carbamoylphosphate synthase large subuni 5e-58
pfam02787122 pfam02787, CPSase_L_D3, Carbamoyl-phosphate synthetase 2e-39
cd01424110 cd01424, MGS_CPS_II, Methylglyoxal synthase-like domain 9e-39
smart0085190 smart00851, MGS, MGS-like domain 2e-22
pfam0214292 pfam02142, MGS, MGS-like domain 4e-22
cd00532112 cd00532, MGS-like, MGS-like domain 2e-14
cd01423116 cd01423, MGS_CPS_I_III, Methylglyoxal synthase-like dom 5e-08
KOG0370 1435 KOG0370, KOG0370, KOG0370, Multifunctional pyrimidine s 4e-35
pfam02786211 pfam02786, CPSase_L_D2, Carbamoyl-phosphate synthase L 6e-25
KOG0238 670 KOG0238, KOG0238, KOG0238, 3-Methylcrotonyl-CoA carboxy 1e-08
TIGR01235 1143 TIGR01235, pyruv_carbox, pyruvate carboxylase 5e-08
PRK05586447 PRK05586, PRK05586, biotin carboxylase; Validated 8e-08
PRK12833467 PRK12833, PRK12833, acetyl-CoA carboxylase biotin carbo 5e-07
COG4770 645 COG4770, COG4770, Acetyl/propionyl-CoA carboxylase, alp 4e-06
PRK08654499 PRK08654, PRK08654, pyruvate carboxylase subunit A; Val 6e-06
TIGR00514449 TIGR00514, accC, acetyl-CoA carboxylase, biotin carboxy 2e-05
COG1181317 COG1181, DdlA, D-alanine-D-alanine ligase and related A 0.001
PRK06111450 PRK06111, PRK06111, acetyl-CoA carboxylase biotin carbo 0.003
pfam00289109 pfam00289, CPSase_L_chain, Carbamoyl-phosphate synthase 5e-19
cd05188271 cd05188, MDR, Medium chain reductase/dehydrogenase (MDR 5e-04
pfam00289109 pfam00289, CPSase_L_chain, Carbamoyl-phosphate synthase 7e-18
COG0439449 COG0439, AccC, Biotin carboxylase [Lipid metabolism] 1e-13
PRK02186887 PRK02186, PRK02186, argininosuccinate lyase; Provisiona 0.002
COG0439449 COG0439, AccC, Biotin carboxylase [Lipid metabolism] 4e-13
PRK12767326 PRK12767, PRK12767, carbamoyl phosphate synthase-like p 2e-11
COG1038 1149 COG1038, PycA, Pyruvate carboxylase [Energy production 3e-08
TIGR00768277 TIGR00768, rimK_fam, alpha-L-glutamate ligases, RimK fa 1e-04
KOG0368 2196 KOG0368, KOG0368, KOG0368, Acetyl-CoA carboxylase [Lipi 7e-07
COG1181317 COG1181, DdlA, D-alanine-D-alanine ligase and related A 2e-04
PRK12767326 PRK12767, PRK12767, carbamoyl phosphate synthase-like p 2e-06
COG2232389 COG2232, COG2232, Predicted ATP-dependent carboligase r 6e-06
PRK00881 513 PRK00881, purH, bifunctional phosphoribosylaminoimidazo 7e-04
cd01421187 cd01421, IMPCH, Inosine monophosphate cyclohydrolase do 0.001
KOG0369 1176 KOG0369, KOG0369, KOG0369, Pyruvate carboxylase [Energy 0.001
>gnl|CDD|179998 PRK05294, carB, carbamoyl phosphate synthase large subunit; Reviewed Back     alignment and domain information
>gnl|CDD|162321 TIGR01369, CPSaseII_lrg, carbamoyl-phosphate synthase, large subunit Back     alignment and domain information
>gnl|CDD|178336 PLN02735, PLN02735, carbamoyl-phosphate synthase Back     alignment and domain information
>gnl|CDD|183765 PRK12815, carB, carbamoyl phosphate synthase large subunit; Reviewed Back     alignment and domain information
>gnl|CDD|35591 KOG0370, KOG0370, KOG0370, Multifunctional pyrimidine synthesis protein CAD (includes carbamoyl-phophate synthetase, aspartate transcarbamylase, and glutamine amidotransferase) [General function prediction only] Back     alignment and domain information
>gnl|CDD|30806 COG0458, CarB, Carbamoylphosphate synthase large subunit (split gene in MJ) [Amino acid transport and metabolism / Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|145768 pfam02786, CPSase_L_D2, Carbamoyl-phosphate synthase L chain, ATP binding domain Back     alignment and domain information
>gnl|CDD|31240 COG1038, PycA, Pyruvate carboxylase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|181524 PRK08654, PRK08654, pyruvate carboxylase subunit A; Validated Back     alignment and domain information
>gnl|CDD|35590 KOG0369, KOG0369, KOG0369, Pyruvate carboxylase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|130302 TIGR01235, pyruv_carbox, pyruvate carboxylase Back     alignment and domain information
>gnl|CDD|35459 KOG0238, KOG0238, KOG0238, 3-Methylcrotonyl-CoA carboxylase, biotin-containing subunit/Propionyl-CoA carboxylase, alpha chain/Acetyl-CoA carboxylase, biotin carboxylase subunit [Lipid transport and metabolism, Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|34383 COG4770, COG4770, Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|180865 PRK07178, PRK07178, pyruvate carboxylase subunit A; Validated Back     alignment and domain information
>gnl|CDD|183835 PRK12999, PRK12999, pyruvate carboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|180150 PRK05586, PRK05586, biotin carboxylase; Validated Back     alignment and domain information
>gnl|CDD|169452 PRK08463, PRK08463, acetyl-CoA carboxylase subunit A; Validated Back     alignment and domain information
>gnl|CDD|129605 TIGR00514, accC, acetyl-CoA carboxylase, biotin carboxylase subunit Back     alignment and domain information
>gnl|CDD|181436 PRK08462, PRK08462, biotin carboxylase; Validated Back     alignment and domain information
>gnl|CDD|178336 PLN02735, PLN02735, carbamoyl-phosphate synthase Back     alignment and domain information
>gnl|CDD|30806 COG0458, CarB, Carbamoylphosphate synthase large subunit (split gene in MJ) [Amino acid transport and metabolism / Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|145769 pfam02787, CPSase_L_D3, Carbamoyl-phosphate synthetase large chain, oligomerisation domain Back     alignment and domain information
>gnl|CDD|29636 cd01424, MGS_CPS_II, Methylglyoxal synthase-like domain from type II glutamine-dependent carbamoyl phosphate synthetase (CSP) Back     alignment and domain information
>gnl|CDD|129084 smart00851, MGS, MGS-like domain Back     alignment and domain information
>gnl|CDD|145348 pfam02142, MGS, MGS-like domain Back     alignment and domain information
>gnl|CDD|29632 cd00532, MGS-like, MGS-like domain Back     alignment and domain information
>gnl|CDD|29635 cd01423, MGS_CPS_I_III, Methylglyoxal synthase-like domain found in pyr1 and URA1-like carbamoyl phosphate synthetases (CPS), including ammonia-dependent CPS Type I, and glutamine-dependent CPS Type III Back     alignment and domain information
>gnl|CDD|35591 KOG0370, KOG0370, KOG0370, Multifunctional pyrimidine synthesis protein CAD (includes carbamoyl-phophate synthetase, aspartate transcarbamylase, and glutamine amidotransferase) [General function prediction only] Back     alignment and domain information
>gnl|CDD|145768 pfam02786, CPSase_L_D2, Carbamoyl-phosphate synthase L chain, ATP binding domain Back     alignment and domain information
>gnl|CDD|35459 KOG0238, KOG0238, KOG0238, 3-Methylcrotonyl-CoA carboxylase, biotin-containing subunit/Propionyl-CoA carboxylase, alpha chain/Acetyl-CoA carboxylase, biotin carboxylase subunit [Lipid transport and metabolism, Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|130302 TIGR01235, pyruv_carbox, pyruvate carboxylase Back     alignment and domain information
>gnl|CDD|180150 PRK05586, PRK05586, biotin carboxylase; Validated Back     alignment and domain information
>gnl|CDD|183781 PRK12833, PRK12833, acetyl-CoA carboxylase biotin carboxylase subunit; Provisional Back     alignment and domain information
>gnl|CDD|34383 COG4770, COG4770, Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|181524 PRK08654, PRK08654, pyruvate carboxylase subunit A; Validated Back     alignment and domain information
>gnl|CDD|129605 TIGR00514, accC, acetyl-CoA carboxylase, biotin carboxylase subunit Back     alignment and domain information
>gnl|CDD|31374 COG1181, DdlA, D-alanine-D-alanine ligase and related ATP-grasp enzymes [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|180406 PRK06111, PRK06111, acetyl-CoA carboxylase biotin carboxylase subunit; Validated Back     alignment and domain information
>gnl|CDD|144029 pfam00289, CPSase_L_chain, Carbamoyl-phosphate synthase L chain, N-terminal domain Back     alignment and domain information
>gnl|CDD|176178 cd05188, MDR, Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|144029 pfam00289, CPSase_L_chain, Carbamoyl-phosphate synthase L chain, N-terminal domain Back     alignment and domain information
>gnl|CDD|30788 COG0439, AccC, Biotin carboxylase [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|167327 PRK02186, PRK02186, argininosuccinate lyase; Provisional Back     alignment and domain information
>gnl|CDD|30788 COG0439, AccC, Biotin carboxylase [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|183732 PRK12767, PRK12767, carbamoyl phosphate synthase-like protein; Provisional Back     alignment and domain information
>gnl|CDD|31240 COG1038, PycA, Pyruvate carboxylase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|162031 TIGR00768, rimK_fam, alpha-L-glutamate ligases, RimK family Back     alignment and domain information
>gnl|CDD|35589 KOG0368, KOG0368, KOG0368, Acetyl-CoA carboxylase [Lipid transport and metabolism] Back     alignment and domain information
>gnl|CDD|31374 COG1181, DdlA, D-alanine-D-alanine ligase and related ATP-grasp enzymes [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|183732 PRK12767, PRK12767, carbamoyl phosphate synthase-like protein; Provisional Back     alignment and domain information
>gnl|CDD|32413 COG2232, COG2232, Predicted ATP-dependent carboligase related to biotin carboxylase [General function prediction only] Back     alignment and domain information
>gnl|CDD|179152 PRK00881, purH, bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|29633 cd01421, IMPCH, Inosine monophosphate cyclohydrolase domain Back     alignment and domain information
>gnl|CDD|35590 KOG0369, KOG0369, KOG0369, Pyruvate carboxylase [Energy production and conversion] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 1162 carbamoyl phosphate synthase large subunit [Candidatus
TIGR013691089 CPSaseII_lrg carbamoyl-phosphate synthase, large subuni 100.0
PRK128151068 carB carbamoyl phosphate synthase large subunit; Review 100.0
PRK052941063 carB carbamoyl phosphate synthase large subunit; Review 100.0
KOG03701435 consensus 100.0
TIGR01235 1169 pyruv_carbox pyruvate carboxylase; InterPro: IPR005930 100.0
TIGR01369 1089 CPSaseII_lrg carbamoyl-phosphate synthase, large subuni 100.0
COG0458400 CarB Carbamoylphosphate synthase large subunit (split g 100.0
PRK129991147 pyruvate carboxylase; Reviewed 100.0
TIGR00514451 accC acetyl-CoA carboxylase, biotin carboxylase; InterP 100.0
TIGR02712 1226 urea_carbox urea carboxylase; InterPro: IPR014084 Membe 100.0
KOG03691176 consensus 100.0
COG0439449 AccC Biotin carboxylase [Lipid metabolism] 100.0
KOG0368 2196 consensus 100.0
PRK06019377 phosphoribosylaminoimidazole carboxylase ATPase subunit 99.92
PRK02186892 argininosuccinate lyase; Provisional 99.91
COG0027394 PurT Formate-dependent phosphoribosylglycinamide formyl 99.85
COG0151428 PurD Phosphoribosylamine-glycine ligase [Nucleotide tra 99.74
COG0026375 PurK Phosphoribosylaminoimidazole carboxylase (NCAIR sy 99.69
), forming GARS-AIRS-GART.; GO: 0004637 phosphoribosylamine-glycine ligase activity, 0009113 purine base biosynthetic process." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR00877">TIGR00877459 purD phosphoribosylamine--glycine ligase; InterPro: IPR 99.55
PRK05294 1063 carB carbamoyl phosphate synthase large subunit; Review 100.0
PRK12815 1068 carB carbamoyl phosphate synthase large subunit; Review 100.0
COG0458400 CarB Carbamoylphosphate synthase large subunit (split g 100.0
KOG0370 1435 consensus 100.0
PRK12999 1147 pyruvate carboxylase; Reviewed 100.0
COG1038 1149 PycA Pyruvate carboxylase [Energy production and conver 100.0
PRK09288395 purT phosphoribosylglycinamide formyltransferase 2; Val 100.0
KOG0369 1176 consensus 100.0
PRK06019377 phosphoribosylaminoimidazole carboxylase ATPase subunit 99.9
COG0027394 PurT Formate-dependent phosphoribosylglycinamide formyl 99.78
PRK05784485 phosphoribosylamine--glycine ligase; Provisional 99.63
PRK08654497 pyruvate carboxylase subunit A; Validated 100.0
KOG0237788 consensus 99.04
PRK08462446 biotin carboxylase; Validated 100.0
PRK12833458 acetyl-CoA carboxylase biotin carboxylase subunit; Prov 100.0
PRK05586447 biotin carboxylase; Validated 100.0
PRK08591449 acetyl-CoA carboxylase biotin carboxylase subunit; Vali 100.0
PRK07178471 acetyl-CoA carboxylase; Validated 100.0
PRK06111449 acetyl-CoA carboxylase biotin carboxylase subunit; Vali 100.0
PRK08654497 pyruvate carboxylase subunit A; Validated 100.0
PRK08463478 acetyl-CoA carboxylase; Validated 100.0
COG4770 645 Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid 100.0
PRK08463478 acetyl-CoA carboxylase; Validated 100.0
COG10381149 PycA Pyruvate carboxylase [Energy production and conver 100.0
PRK08462446 biotin carboxylase; Validated 100.0
TIGR02712 1226 urea_carbox urea carboxylase; InterPro: IPR014084 Membe 100.0
KOG0238 670 consensus 100.0
COG0026375 PurK Phosphoribosylaminoimidazole carboxylase (NCAIR sy 99.65
COG2232389 Predicted ATP-dependent carboligase related to biotin c 99.6
COG4770645 Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid 100.0
KOG0238670 consensus 100.0
PRK12767325 carbamoyl phosphate synthase-like protein; Provisional 100.0
PRK01372304 ddl D-alanine--D-alanine ligase; Reviewed 99.94
PRK07206415 hypothetical protein; Provisional 99.9
PRK01966344 ddl D-alanyl-alanine synthetase A; Reviewed 99.9
TIGR01205375 D_ala_D_alaTIGR D-alanine--D-alanine ligase; InterPro: 99.85
PRK10446300 ribosomal protein S6 modification protein; Provisional 99.73
COG1181317 DdlA D-alanine-D-alanine ligase and related ATP-grasp e 99.65
COG2232389 Predicted ATP-dependent carboligase related to biotin c 99.54
TIGR01142407 purT phosphoribosylglycinamide formyltransferase 2; Int 99.32
COG0189318 RimK Glutathione synthase/Ribosomal protein S6 modifica 99.31
TIGR00768321 rimK_fam alpha-L-glutamate ligases, RimK family; InterP 99.28
COG3919415 Predicted ATP-grasp enzyme [General function prediction 98.94
COG1821307 Predicted ATP-utilizing enzyme (ATP-grasp superfamily) 98.79
PRK05246316 glutathione synthetase; Provisional 94.73
pfam02571246 CbiJ Precorrin-6x reductase CbiJ/CobK. This family cons 91.69
PRK12833458 acetyl-CoA carboxylase biotin carboxylase subunit; Prov 100.0
PRK07178471 acetyl-CoA carboxylase; Validated 100.0
PRK08591449 acetyl-CoA carboxylase biotin carboxylase subunit; Vali 100.0
PRK05586447 biotin carboxylase; Validated 100.0
PRK06111449 acetyl-CoA carboxylase biotin carboxylase subunit; Vali 100.0
COG0439449 AccC Biotin carboxylase [Lipid metabolism] 100.0
TIGR00514451 accC acetyl-CoA carboxylase, biotin carboxylase; InterP 100.0
TIGR01235 1169 pyruv_carbox pyruvate carboxylase; InterPro: IPR005930 100.0
PRK12767325 carbamoyl phosphate synthase-like protein; Provisional 100.0
KOG0368 2196 consensus 99.89
PRK02186 892 argininosuccinate lyase; Provisional 99.87
PRK07206415 hypothetical protein; Provisional 99.84
PRK13789426 phosphoribosylamine--glycine ligase; Provisional 99.78
COG0151428 PurD Phosphoribosylamine-glycine ligase [Nucleotide tra 99.78
PRK00885424 phosphoribosylamine--glycine ligase; Provisional 99.77
PRK13790415 phosphoribosylamine--glycine ligase; Provisional 99.76
PRK06395435 phosphoribosylamine--glycine ligase; Provisional 99.7
), forming GARS-AIRS-GART.; GO: 0004637 phosphoribosylamine-glycine ligase activity, 0009113 purine base biosynthetic process." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR00877">TIGR00877459 purD phosphoribosylamine--glycine ligase; InterPro: IPR 99.56
TIGR01161386 purK phosphoribosylaminoimidazole carboxylase, ATPase s 99.28
TIGR01142407 purT phosphoribosylglycinamide formyltransferase 2; Int 99.26
KOG0237 788 consensus 98.74
COG1821307 Predicted ATP-utilizing enzyme (ATP-grasp superfamily) 98.72
pfam02786211 CPSase_L_D2 Carbamoyl-phosphate synthase L chain, ATP b 100.0
pfam07478201 Dala_Dala_lig_C D-ala D-ala ligase C-terminus. This fam 99.91
pfam08443190 RimK RimK-like ATP-grasp domain. This ATP-grasp domain 99.79
pfam02787122 CPSase_L_D3 Carbamoyl-phosphate synthetase large chain, 100.0
pfam02786211 CPSase_L_D2 Carbamoyl-phosphate synthase L chain, ATP b 100.0
pfam07478201 Dala_Dala_lig_C D-ala D-ala ligase C-terminus. This fam 99.88
pfam08443190 RimK RimK-like ATP-grasp domain. This ATP-grasp domain 99.8
pfam02955176 GSH-S_ATP Prokaryotic glutathione synthetase, ATP-grasp 98.19
PRK05246316 glutathione synthetase; Provisional 97.86
PRK12458349 glutathione synthetase; Provisional 96.97
PRK09288395 purT phosphoribosylglycinamide formyltransferase 2; Val 100.0
PRK00885424 phosphoribosylamine--glycine ligase; Provisional 99.83
PRK06849387 hypothetical protein; Provisional 99.81
PRK13789426 phosphoribosylamine--glycine ligase; Provisional 99.81
PRK13790415 phosphoribosylamine--glycine ligase; Provisional 99.78
PRK06395435 phosphoribosylamine--glycine ligase; Provisional 99.76
PRK05784485 phosphoribosylamine--glycine ligase; Provisional 99.7
TIGR01161386 purK phosphoribosylaminoimidazole carboxylase, ATPase s 99.51
PRK13278356 purP 5-formaminoimidazole-4-carboxamide-1-(beta)-D-ribo 98.89
COG1759361 5-formaminoimidazole-4-carboxamide-1-beta-D-ribofuranos 98.84
PRK13277363 5-formaminoimidazole-4-carboxamide-1-(beta)-D-ribofuran 98.76
cd01424110 MGS_CPS_II Methylglyoxal synthase-like domain from type 99.96
cd01423116 MGS_CPS_I_III Methylglyoxal synthase-like domain found 99.94
cd00532112 MGS-like MGS-like domain. This domain composes the whol 99.94
pfam0214292 MGS MGS-like domain. This domain composes the whole pro 99.79
smart0085190 MGS MGS-like domain. This domain composes the whole pro 99.77
cd01421187 IMPCH Inosine monophosphate cyclohydrolase domain. This 98.55
PRK05234146 mgsA methylglyoxal synthase; Validated 98.2
COG1803142 MgsA Methylglyoxal synthase [Carbohydrate transport and 97.92
cd01422115 MGS Methylglyoxal synthase catalyzes the enolization of 97.88
TIGR00160143 MGSA methylglyoxal synthase; InterPro: IPR004363 Methyl 97.33
pfam02222171 ATP-grasp ATP-grasp domain. This family does not contai 99.95
pfam02655160 ATP-grasp_3 ATP-grasp domain. No functional information 99.8
pfam02955176 GSH-S_ATP Prokaryotic glutathione synthetase, ATP-grasp 97.76
PRK12458349 glutathione synthetase; Provisional 93.18
pfam02222171 ATP-grasp ATP-grasp domain. This family does not contai 99.93
pfam01071193 GARS_A Phosphoribosylglycinamide synthetase, ATP-grasp 99.91
pfam02655160 ATP-grasp_3 ATP-grasp domain. No functional information 99.8
pfam08442202 ATP-grasp_2 ATP-grasp domain. 98.33
PRK00696388 sucC succinyl-CoA synthetase subunit beta; Provisional 98.17
COG0045387 SucC Succinyl-CoA synthetase, beta subunit [Energy prod 98.14
pfam01071193 GARS_A Phosphoribosylglycinamide synthetase, ATP-grasp 99.9
pfam08442202 ATP-grasp_2 ATP-grasp domain. 98.84
COG0045387 SucC Succinyl-CoA synthetase, beta subunit [Energy prod 97.71
PRK01372304 ddl D-alanine--D-alanine ligase; Reviewed 99.89
PRK01966344 ddl D-alanyl-alanine synthetase A; Reviewed 99.82
PRK06849387 hypothetical protein; Provisional 99.76
TIGR01205375 D_ala_D_alaTIGR D-alanine--D-alanine ligase; InterPro: 99.74
PRK10446300 ribosomal protein S6 modification protein; Provisional 99.63
COG1181317 DdlA D-alanine-D-alanine ligase and related ATP-grasp e 99.54
COG0189318 RimK Glutathione synthase/Ribosomal protein S6 modifica 99.26
TIGR00768321 rimK_fam alpha-L-glutamate ligases, RimK family; InterP 99.25
PRK13278356 purP 5-formaminoimidazole-4-carboxamide-1-(beta)-D-ribo 98.89
PRK13277363 5-formaminoimidazole-4-carboxamide-1-(beta)-D-ribofuran 98.68
COG1759361 5-formaminoimidazole-4-carboxamide-1-beta-D-ribofuranos 98.43
COG3919415 Predicted ATP-grasp enzyme [General function prediction 98.08
PRK02471753 bifunctional glutamate--cysteine ligase/glutathione syn 98.04
pfam00289109 CPSase_L_chain Carbamoyl-phosphate synthase L chain, N- 99.68
pfam0284499 GARS_N Phosphoribosylglycinamide synthetase, N domain. 96.2
pfam02254115 TrkA_N TrkA-N domain. This domain is found in a wide va 96.1
pfam06849124 DUF1246 Protein of unknown function (DUF1246). This fam 96.03
COG0569225 TrkA K+ transport systems, NAD-binding component [Inorg 95.62
pfam00899134 ThiF ThiF family. This family contains a repeated domai 92.47
PRK05192621 tRNA uridine 5-carboxymethylaminomethyl modification en 91.87
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreduct 91.23
pfam01408120 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossman 90.38
pfam00289109 CPSase_L_chain Carbamoyl-phosphate synthase L chain, N- 99.49
PRK10309347 galactitol-1-phosphate dehydrogenase; Provisional 96.21
PRK09880343 L-idonate 5-dehydrogenase; Provisional 96.0
TIGR03451358 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrog 95.58
PRK13771332 putative alcohol dehydrogenase; Provisional 95.24
pfam06849124 DUF1246 Protein of unknown function (DUF1246). This fam 95.2
PRK05396341 tdh L-threonine 3-dehydrogenase; Validated 95.1
PRK10083339 putative dehydrogenase; Provisional 94.16
pfam0284499 GARS_N Phosphoribosylglycinamide synthetase, N domain. 93.48
PRK10754327 quinone oxidoreductase, NADPH-dependent; Provisional 92.29
TIGR00959439 ffh signal recognition particle protein; InterPro: IPR0 91.59
TIGR03103547 trio_acet_GNAT GNAT-family acetyltransferase TIGR03103. 99.19
TIGR02068876 cya_phycin_syn cyanophycin synthetase; InterPro: IPR011 99.0
TIGR02144289 LysX_arch Lysine biosynthesis enzyme LysX; InterPro: IP 98.95
PRK02471753 bifunctional glutamate--cysteine ligase/glutathione syn 98.81
TIGR02144289 LysX_arch Lysine biosynthesis enzyme LysX; InterPro: IP 98.8
TIGR03103547 trio_acet_GNAT GNAT-family acetyltransferase TIGR03103. 98.48
pfam05770307 Ins134_P3_kin Inositol 1, 3, 4-trisphosphate 5/6-kinase 97.49
TIGR02068 876 cya_phycin_syn cyanophycin synthetase; InterPro: IPR011 98.74
PRK06524480 biotin carboxylase-like protein; Validated 98.46
PRK06524480 biotin carboxylase-like protein; Validated 98.44
PRK00881514 purH bifunctional phosphoribosylaminoimidazolecarboxami 97.95
TIGR01016389 sucCoAbeta succinyl-CoA synthetase, beta subunit; Inter 97.48
PRK00696388 sucC succinyl-CoA synthetase subunit beta; Provisional 97.44
COG0138515 PurH AICAR transformylase/IMP cyclohydrolase PurH (only 97.43
TIGR01016389 sucCoAbeta succinyl-CoA synthetase, beta subunit; Inter 97.22
PRK06130310 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.83
PRK07660283 consensus 96.27
PRK07530292 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.04
PRK05808282 3-hydroxybutyryl-CoA dehydrogenase; Validated 95.9
PRK09117282 consensus 95.81
PRK09260289 3-hydroxybutyryl-CoA dehydrogenase; Validated 95.43
PRK08268503 3-hydroxybutyryl-CoA dehydrogenase; Validated 95.16
PRK08293288 3-hydroxybutyryl-CoA dehydrogenase; Validated 94.37
pfam05770307 Ins134_P3_kin Inositol 1, 3, 4-trisphosphate 5/6-kinase 96.73
KOG2555588 consensus 96.7
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General funct 96.63
PRK10669558 putative cation:proton antiport protein; Provisional 96.22
PRK03659602 glutathione-regulated potassium-efflux system protein K 96.06
TIGR03366280 HpnZ_proposed putative phosphonate catabolism associate 95.9
PRK03562615 glutathione-regulated potassium-efflux system protein K 95.71
PRK09496455 trkA potassium transporter peripheral membrane componen 95.54
PRK09422338 alcohol dehydrogenase; Provisional 94.32
COG1063350 Tdh Threonine dehydrogenase and related Zn-dependent de 94.26
PRK07531489 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioestera 96.54
PRK01438481 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 93.32
pfam02737180 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding do 92.51
TIGR03201349 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA deh 96.28
PRK11730715 fadB multifunctional fatty acid oxidation complex subun 94.84
PRK12770350 putative glutamate synthase subunit beta; Provisional 94.2
PRK11154706 fadJ multifunctional fatty acid oxidation complex subun 94.03
PRK11749460 putative oxidoreductase; Provisional 92.03
cd01977415 Nitrogenase_VFe_alpha Nitrogenase_VFe_alpha -like: Nitr 90.73
PRK12810472 gltD glutamate synthase subunit beta; Reviewed 90.65
PRK13608391 diacylglycerol glucosyltransferase; Provisional 96.13
PRK07066321 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.07
PRK06035291 3-hydroxyacyl-CoA dehydrogenase; Validated 95.8
PRK06129308 3-hydroxyacyl-CoA dehydrogenase; Validated 94.97
PRK07502307 cyclohexadienyl dehydrogenase; Validated 94.12
PRK09496455 trkA potassium transporter peripheral membrane componen 94.11
pfam00743532 FMO-like Flavin-binding monooxygenase-like. This family 93.66
PRK08773392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxy 93.12
PRK12770350 putative glutamate synthase subunit beta; Provisional 93.07
PRK07417280 arogenate dehydrogenase; Reviewed 92.85
PRK05335434 tRNA (uracil-5-)-methyltransferase Gid; Reviewed 92.85
pfam01134391 GIDA Glucose inhibited division protein A. 92.59
PRK06847375 hypothetical protein; Provisional 92.06
PRK08850405 2-octaprenyl-6-methoxyphenol hydroxylase; Validated 92.03
PRK07208474 hypothetical protein; Provisional 91.54
pfam07992277 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreducta 91.23
PRK07608389 hypothetical protein; Provisional 91.15
PRK00066315 ldh L-lactate dehydrogenase; Reviewed 91.12
PRK05714405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxy 91.04
PTZ00318514 NADH dehydrogenase; Provisional 90.92
PRK08013400 hypothetical protein; Provisional 90.62
PRK09126392 hypothetical protein; Provisional 90.5
PRK08020391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 90.5
PRK00045429 hemA glutamyl-tRNA reductase; Reviewed 95.87
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of gl 92.95
PRK03562615 glutathione-regulated potassium-efflux system protein K 95.67
PRK03659602 glutathione-regulated potassium-efflux system protein K 95.62
PRK10669558 putative cation:proton antiport protein; Provisional 94.26
TIGR02717457 AcCoA-syn-alpha acetyl coenzyme A synthetase (ADP formi 92.41
PRK13361329 molybdenum cofactor biosynthesis protein A; Provisional 95.55
PRK00164334 moaA molybdenum cofactor biosynthesis protein A; Review 94.2
COG2896322 MoaA Molybdenum cofactor biosynthesis enzyme [Coenzyme 92.24
TIGR01179341 galE UDP-glucose 4-epimerase; InterPro: IPR005886 Synon 95.16
COG1087329 GalE UDP-glucose 4-epimerase [Cell envelope biogenesis, 95.06
PRK03369487 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 94.63
CHL00194319 ycf39 Ycf39; Provisional 94.13
pfam01370235 Epimerase NAD dependent epimerase/dehydratase family. T 92.87
pfam01488134 Shikimate_DH Shikimate / quinate 5-dehydrogenase. This 92.35
PRK00683418 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 92.0
pfam04321284 RmlD_sub_bind RmlD substrate binding domain. L-rhamnose 91.99
KOG1371343 consensus 90.97
COG1148622 HdrA Heterodisulfide reductase, subunit A and related p 92.91
TIGR00315170 cdhB CO dehydrogenase/acetyl-CoA synthase complex, epsi 90.49
PRK00945171 acetyl-CoA decarbonylase/synthase complex subunit epsil 90.04
PRK13940414 glutamyl-tRNA reductase; Provisional 92.31
TIGR03385427 CoA_CoA_reduc CoA-disulfide reductase. Members of this 92.13
pfam01326327 PPDK_N Pyruvate phosphate dikinase, PEP/pyruvate bindin 91.52
KOG0024354 consensus 91.39
KOG2799434 consensus 91.26
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucin 91.0
COG0541451 Ffh Signal recognition particle GTPase [Intracellular t 90.48
>TIGR01369 CPSaseII_lrg carbamoyl-phosphate synthase, large subunit; InterPro: IPR006275 Carbamoyl phosphate synthase (CPSase) is a heterodimeric enzyme composed of a small and a large subunit (with the exception of CPSase III, see below) Back     alignment and domain information
>PRK12815 carB carbamoyl phosphate synthase large subunit; Reviewed Back     alignment and domain information
>PRK05294 carB carbamoyl phosphate synthase large subunit; Reviewed Back     alignment and domain information
>KOG0370 consensus Back     alignment and domain information
>TIGR01235 pyruv_carbox pyruvate carboxylase; InterPro: IPR005930 In the postabsorptive state, blood glucose concentration is kept constant by a combination of glycogenolysis and gluconeogenesis Back     alignment and domain information
>TIGR01369 CPSaseII_lrg carbamoyl-phosphate synthase, large subunit; InterPro: IPR006275 Carbamoyl phosphate synthase (CPSase) is a heterodimeric enzyme composed of a small and a large subunit (with the exception of CPSase III, see below) Back     alignment and domain information
>COG0458 CarB Carbamoylphosphate synthase large subunit (split gene in MJ) [Amino acid transport and metabolism / Nucleotide transport and metabolism] Back     alignment and domain information
>PRK12999 pyruvate carboxylase; Reviewed Back     alignment and domain information
>TIGR00514 accC acetyl-CoA carboxylase, biotin carboxylase; InterPro: IPR004549 This family represents the biotin carboxylase subunit found usually as a component of acetyl-CoA carboxylase Back     alignment and domain information
>TIGR02712 urea_carbox urea carboxylase; InterPro: IPR014084 Members of this family are ATP-dependent urea carboxylases, including characterised members from Oleomonas sagaranensis (alpha class Proteobacterium) and yeasts such as Saccharomyces cerevisiae (Baker's yeast) Back     alignment and domain information
>KOG0369 consensus Back     alignment and domain information
>COG0439 AccC Biotin carboxylase [Lipid metabolism] Back     alignment and domain information
>KOG0368 consensus Back     alignment and domain information
>PRK06019 phosphoribosylaminoimidazole carboxylase ATPase subunit; Reviewed Back     alignment and domain information
>PRK02186 argininosuccinate lyase; Provisional Back     alignment and domain information
>COG0027 PurT Formate-dependent phosphoribosylglycinamide formyltransferase (GAR transformylase) [Nucleotide transport and metabolism] Back     alignment and domain information
>COG0151 PurD Phosphoribosylamine-glycine ligase [Nucleotide transport and metabolism] Back     alignment and domain information
>COG0026 PurK Phosphoribosylaminoimidazole carboxylase (NCAIR synthetase) [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR00877 purD phosphoribosylamine--glycine ligase; InterPro: IPR000115 Phosphoribosylglycinamide synthetase (6 Back     alignment and domain information
>PRK05294 carB carbamoyl phosphate synthase large subunit; Reviewed Back     alignment and domain information
>PRK12815 carB carbamoyl phosphate synthase large subunit; Reviewed Back     alignment and domain information
>COG0458 CarB Carbamoylphosphate synthase large subunit (split gene in MJ) [Amino acid transport and metabolism / Nucleotide transport and metabolism] Back     alignment and domain information
>KOG0370 consensus Back     alignment and domain information
>PRK12999 pyruvate carboxylase; Reviewed Back     alignment and domain information
>COG1038 PycA Pyruvate carboxylase [Energy production and conversion] Back     alignment and domain information