254780443

254780443

hypothetical protein CLIBASIA_01640

GeneID in NCBI database:8209429Locus tag:CLIBASIA_01640
Protein GI in NCBI database:254780443Protein Accession:YP_003064856.1
Gene range:-(352878, 353303)Protein Length:141aa
Gene description:hypothetical protein
COG prediction:[S] Predicted integral membrane protein
KEGG prediction:hypothetical protein
SEED prediction:conserved hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM1 TM-Helix
TOPPRED1 TM-Helix
HMMTOP1 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMyes
SignalP_NNyes
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-
MLRSFLICFCFGAMIFCSNVSFAGFRVCNGTKNLIGVAVGYPAVKGGWMTEGWWQIPGNTCETVVKGALHSRYYYLYAEGVSHSEHWAGNVQMCVGQDEFNIVDIKNCYTRGYLRVGFTEYDTGQHENWTVQLTEPAQDRR
cHHHHHHHHHHHHHHHccccccccEEEEcccccEEEEEEEEEcccccEEEEEEEEEcccccEEEEEccccccEEEEEEEEccccccccccEEEEEEccEEEEEccccHHHccccccccEEccccccccccEEEEccccccc
cHHHHHHHHHHHHHHHcccHHHcccEEEcccccEEEEEEEEEccccccEEccEEEEcccccEEEEccccccEEEEEEEEEcccccccccccEEEEcccEEEEEcccccHcccccccccEEEEcccccEEEEEEcccccccc
MLRSFLICFCFGamifcsnvsfagfrvcngtKNLIGVAvgypavkggwmtegwwqipgntceTVVKGALHSRYYYLYAegvshsehwagnvqmcvgqdefnivdikncytrgylrvgfteydtgqhenwtvqltepaqdrr
MLRSFLICFCFGAMIFCSNVSFAGFRVCNGTKNLIGVAVGYPAVKGGWMTEGWWQIPGNTCETVVKGALHSRYYYLYAEGVSHSEHWAGNVQMCVGQDEFNIVDIKNCYTRGYLRVGFteydtgqhenwtvqltepaqdrr
MLRSFLICFCFGAMIFCSNVSFAGFRVCNGTKNLIGVAVGYPAVKGGWMTEGWWQIPGNTCETVVKGALHSRYYYLYAEGVSHSEHWAGNVQMCVGQDEFNIVDIKNCYTRGYLRVGFTEYDTGQHENWTVQLTEPAQDRR
***SFLICFCFGAMIFCSNVSFAGFRVCNGTKNLIGVAVGYPAVKGGWMTEGWWQIPGNTCETVVKGALHSRYYYLYAEGVSHSEHWAGNVQMCVGQDEFNIVDIKNCYTRGYLRVGFTEYDTGQHENWT***********
MLRSFLICFCFGAMIFCSNVSFAGFRVCNGTKNLIGVAVGYPAVKGGWMTEGWWQIPGNTCETVVKGALHSRYYYLYAEGVSHSEHWAGNVQMCVGQDEFNIVDIKNCYTRGYLRVGFTEYDTGQHENWTVQL********
MLRSFLICFCFGAMIFCSNVSFAGFRVCNGTKNLIGVAVGYPAVKGGWMTEGWWQIPGNTCETVVKGALHSRYYYLYAEGVSHSEHWAGNVQMCVGQDEFNIVDIKNCYTRGYLRVGFTEYDTGQHENWTVQLTE******
iiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
MLRSFLICFCFGAMIFCSNVSFAGFRVCNGTKNLIGVAVGYPAVKGGWMTEGWWQIPGNTCETVVKGALHSRYYYLYAEGVSHSEHWAGNVQMCVGQDEFNIVDIKNCYTRGYLRVGFTEYDTGQHENWTVQLTEPAQDRR
MLRSFLICFCFGAMIFCSNVSFAGFRVCNGTKNLIGVAVGYPAVKGGWMTEGWWQIPGNTCETVVKGALHSRYYYLYAEGVSHSEHWAGNVQMCVGQDEFNIVDIKNCYTRGYLRVGFTEYDTGQHENWTVQLTEPAQDRR
MLRSFLICFCFGAMIFCSNVSFAGFRVCNGTKNLIGVAVGYPAVKGGWMTEGWWQIPGNTCETVVKGALHSRYYYLYAEGVSHSEHWAGNVQMCVGQDEFNIVDIKNCYTRGYLRVGFTEYDTGQHENWTVQLTEPAQDRR

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target141 hypothetical protein CLIBASIA_01640 [Candidatus Liberib
315122108139 hypothetical protein CKC_01790 [Candidatus Liberibacter 1 4e-55
218682191158 hypothetical protein RetlC8_25245 [Rhizobium etli CIAT 1 2e-38
209550866157 hypothetical protein Rleg2_3290 [Rhizobium leguminosaru 1 2e-37
190893368161 hypothetical protein RHECIAT_CH0003794 [Rhizobium etli 1 2e-37
86359134161 hypothetical protein RHE_CH03543 [Rhizobium etli CFN 42 1 6e-37
116253800161 hypothetical protein RL4061 [Rhizobium leguminosarum bv 1 7e-37
241206280157 hypothetical protein Rleg_3591 [Rhizobium leguminosarum 1 7e-37
218663145131 hypothetical protein RetlI_29289 [Rhizobium etli IE4771 1 1e-36
15966543145 hypothetical protein SMc04006 [Sinorhizobium meliloti 1 1 2e-35
222087049181 hypothetical protein Arad_3784 [Agrobacterium radiobact 1 2e-35
>gi|315122108|ref|YP_004062597.1| hypothetical protein CKC_01790 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 139 Back     alignment and organism information
 Score =  217 bits (552), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 97/139 (69%), Positives = 113/139 (81%)

Query: 1   MLRSFLICFCFGAMIFCSNVSFAGFRVCNGTKNLIGVAVGYPAVKGGWMTEGWWQIPGNT 60
           M+R FLIC   G MI  S+VS+AGFRVCNGTKNLIGVA+GYP   G W T+GWW IP N+
Sbjct: 1   MIRGFLICIFLGTMIIFSSVSYAGFRVCNGTKNLIGVAIGYPLSNGHWTTQGWWHIPKNS 60

Query: 61  CETVVKGALHSRYYYLYAEGVSHSEHWAGNVQMCVGQDEFNIVDIKNCYTRGYLRVGFTE 120
           CET+++GAL SRYYYL+ EG+SH E W GNVQMCVG+DEF IVDIK+CY RGYLR  F E
Sbjct: 61  CETIIEGALSSRYYYLHVEGISHGERWLGNVQMCVGEDEFTIVDIKDCYARGYLRASFIE 120

Query: 121 YDTGQHENWTVQLTEPAQD 139
           YDTGQHE+WTVQLTE + +
Sbjct: 121 YDTGQHESWTVQLTESSLE 139


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|218682191|ref|ZP_03529792.1| hypothetical protein RetlC8_25245 [Rhizobium etli CIAT 894] Length = 158 Back     alignment and organism information
>gi|209550866|ref|YP_002282783.1| hypothetical protein Rleg2_3290 [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 157 Back     alignment and organism information
>gi|190893368|ref|YP_001979910.1| hypothetical protein RHECIAT_CH0003794 [Rhizobium etli CIAT 652] Length = 161 Back     alignment and organism information
>gi|86359134|ref|YP_471026.1| hypothetical protein RHE_CH03543 [Rhizobium etli CFN 42] Length = 161 Back     alignment and organism information
>gi|116253800|ref|YP_769638.1| hypothetical protein RL4061 [Rhizobium leguminosarum bv. viciae 3841] Length = 161 Back     alignment and organism information
>gi|241206280|ref|YP_002977376.1| hypothetical protein Rleg_3591 [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 157 Back     alignment and organism information
>gi|218663145|ref|ZP_03519075.1| hypothetical protein RetlI_29289 [Rhizobium etli IE4771] Length = 131 Back     alignment and organism information
>gi|15966543|ref|NP_386896.1| hypothetical protein SMc04006 [Sinorhizobium meliloti 1021] Length = 145 Back     alignment and organism information
>gi|222087049|ref|YP_002545584.1| hypothetical protein Arad_3784 [Agrobacterium radiobacter K84] Length = 181 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target141 hypothetical protein CLIBASIA_01640 [Candidatus Liberib
pfam06282115 pfam06282, DUF1036, Protein of unknown function (DUF103 9e-38
COG5480147 COG5480, COG5480, Predicted integral membrane protein [ 3e-34
>gnl|CDD|148096 pfam06282, DUF1036, Protein of unknown function (DUF1036) Back     alignment and domain information
>gnl|CDD|35039 COG5480, COG5480, Predicted integral membrane protein [Function unknown] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 141 hypothetical protein CLIBASIA_01640 [Candidatus Liberib
pfam06282115 DUF1036 Protein of unknown function (DUF1036). This fam 100.0
COG5480147 Predicted integral membrane protein [Function unknown] 100.0
>pfam06282 DUF1036 Protein of unknown function (DUF1036) Back     alignment and domain information
>COG5480 Predicted integral membrane protein [Function unknown] Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00