254780442

254780442

pyruvate kinase

GeneID in NCBI database:8209428Locus tag:CLIBASIA_01635
Protein GI in NCBI database:254780442Protein Accession:YP_003064855.1
Gene range:-(351433, 352875)Protein Length:480aa
Gene description:pyruvate kinase
COG prediction:[G] Pyruvate kinase
KEGG prediction:pykA; pyruvate kinase (EC:2.7.1.40); K00873 pyruvate kinase [EC:2.7.1.40]
SEED prediction:Pyruvate kinase (EC 2.7.1.40)
Pathway involved in KEGG:Glycolysis / Gluconeogenesis [PATH:las00010]
Pyruvate metabolism [PATH:las00620]
Purine metabolism [PATH:las00230]
Subsystem involved in SEED:Pyruvate metabolism I: anaplerotic reactions, PEP
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED3 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480
MVNLRRIKIISTLGPSSFSEDVINRLHEEGTDVFRINMSHTSHDKMCELIKKIRAVELRSRRPIGILIDLQGPKFRVGKFANSKVDLTEGQIFTLDNKDSLGSSDRVMLPHPEIFASIKIGDRLLIDDGRVKLCVQEKGIGFIKCKVIAGISIADRKGISFPDTFLTTQALTQKDREDLHAALQTCEVDWVALSFIQSADDLLEIRKIISQNKIGLMSKIEKPRAIEYASEIIQLSDAVMVARGDLGVEMALELIPGIQKKLIRIARQLGKPVVIATQMLESMVTSPFPTRAEVSDVATAVFEEADAIMLSAETASGSYPVDAVRTMSLVASSAERDSSWLEMRSLRRIEPNETGADVISSAARQIAETLRLSAIFCYTASGATGLRAARERPKLEIIALSPMIQTARRLALVWGIHCVVTEDASDSDDMVNRACRIVVEQGFGKPGDRIIISAGLPLGTPGSTNMLRIAYIGADGLSGM
ccccccEEEEEEEccccccHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHHHHHHcccccEEEEEccccEEEEEEcccccEEEccccEEEEEcccccccccEEEEcHHHHHHHcccccEEEEEccEEEEEEEEEEccEEEEEEEEccEEcccccccccccccccccccHHHHHHHHHHHHHccccEEEEcccccHHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHHHHHccEEEEcccHHHHcccHHHHHHHHHHHHHHHHHccccEEEEHHHHHHHHccccccHHHHHHHHHHHHHcccEEEEEccccccccHHHHHHHHHHHHHHHHccccHHHHcccccccccccHHHHHHHHHHHHHHHccccEEEEEccccHHHHHHHHHcccccEEEEcccHHHHHHHHHHcccEEEEccccccHHHHHHHHHHHHHHccccccccEEEEEEEccccccccccEEEEEEEcccccccc
ccccccccEEEEEccccccHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHHHHHHccccEEEEEccccccEcccccccccEEEEcccEEEEEcccccccccEEEEEccccccccccccEEEEcccEEEEEEEEccccEEEEEEEccccccccccccccccEEccccccHHHHHHHHHccccccccEEEEHHHccHHHHHHHHHHHcHcccEEEEEEcccHHHHcHHHHHHHccEEEEEHHHHHHHcccccHHHHHHHHHHHHHHHcccEEEEccccHHHHccccccHHHHHHHHHHHHHcccEEEEcHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHccccEEEEEccccHHHHHHHHHcccccEEEEcccHHHHHHHHHHccccEEEccccccHHHHHHHHHHHHHHccccccccEEEEEEcccccccccccEEEEEEccHHHHccc
MVNLRRIKIIStlgpssfseDVINRLHEEGTDVFRINMSHTSHDKMCELIKKIRAVELrsrrpigilidlqgpkfrvgkfanskvdltegqiftldnkdslgssdrvmlphpeifasikigdrlliddgRVKLCVQEKGIGFIKCKVIAGIsiadrkgisfpdtflttQALTQKDREDLHAALQTCEVDWVALSFIQSADDLLEIRKIISQNKiglmskiekpRAIEYASEIIQLSDAVMVARGDLGVEMALELIPGIQKKLIRIARQLGKPVVIATQMLesmvtspfptraevSDVATAVFEEADAIMLSAetasgsypvdaVRTMSLVASSAERDSSWLEMRSlrriepnetgadVISSAARQIAETLRLSAIFCYTasgatglraarerpkleiiALSPMIQTARRLALVWGIHCVvtedasdsddmVNRACRIVVeqgfgkpgdriiisaglplgtpgstnMLRIAYIgadglsgm
mvnlrrikiistlgpssfsedVINRLHEEGTDVFRINMSHTSHDKMCELIKKIRavelrsrrpigilidlqgpkfrvgkfanskvdltegqiftldnkdslgssdRVMLPHPEIFASIKIGDRLLIDDGRVKLCVQEKGIGFIKCKVIAGISIadrkgisfpDTFLTTQALTQKDREDLHAALQTCEVDWVALSFIQSADDLLEIRKIISqnkiglmskieKPRAIEYASEIIQLSDAVMVARGDLGVEMALELIPGIQKKLIRIARQLGKPVVIATQMLESMVTSPFPTRAEVSDVATAVFEEADAIMLSaetasgsypvDAVRTMSLVAssaerdsswlemRSLRriepnetgadvISSAARQIAETLRLSAIFCYTAsgatglraarerPKLEIIALSPMIQTARRLALVWGIHCVVTedasdsddmvNRACRIVveqgfgkpgdrIIISAGlplgtpgstnMLRIAYIGADGLSGM
MVNLRRIKIISTLGPSSFSEDVINRLHEEGTDVFRINMSHTSHDKMCELIKKIRAVELRSRRPIGILIDLQGPKFRVGKFANSKVDLTEGQIFTLDNKDSLGSSDRVMLPHPEIFASIKIGDRLLIDDGRVKLCVQEKGIGFIKCKVIAGISIADRKGISFPDTFLTTQALTQKDREDLHAALQTCEVDWVALSFIQSADDLLEIRKIISQNKIGLMSKIEKPRAIEYASEIIQLSDAVMVARGDLGVEMALELIPGIQKKLIRIARQLGKPVVIATQMLESMVTSPFPTRAEVSDVATAVFEEADAIMLSAETASGSYPVDAVRTMSLVASSAERDSSWLEMRSLRRIEPNETGADVISSAARQIAETLRLSAIFCYTASGATGLRAARERPKLEIIALSPMIQTARRLALVWGIHCVVTEDASDSDDMVNRACRIVVEQGFGKPGDRIIISAGLPLGTPGSTNMLRIAYIGADGLSGM
***LRRI*IISTLGPSSFSEDVINRLHEEGTDVFRINMSHTSHDKMCELIKKIRAVELRSRRPIGILIDLQGPKFRVGKFANSKVDLTEGQIFTLDNKDSLGSSDRVMLPHPEIFASIKIGDRLLIDDGRVKLCVQEKGIGFIKCKVIAGISIADRKGISFPDTFLTTQALTQKDREDLHAALQTCEVDWVALSFIQSADDLLEIRKIISQNKIGLMSKIEKPRAIEYASEIIQLSDAVMVARGDLGVEMALELIPGIQKKLIRIARQLGKPVVIATQMLESMVTSPFPTRAEVSDVATAVFEEADAIMLSAETASGSYPVDAVRTMSLVASSAERDSSWL****************VISSAARQIAETLRLSAIFCYTASGATGLRAARERPKLEIIALSPMIQTARRLALVWGIHCVVTEDASDSDDMVNRACRIVVEQGFGKPGDRIIISAGLPLGTPGSTNMLRIAYIGADGLSGM
MVNLRRIKIISTLGPSSFSEDVINRLHEEGTDVFRINMSHTSHDKMCELIKKIRAVELRSRRPIGILIDLQGPKFRVGKFANSKVDLTEGQIFTLDNKDSLGSSDRVMLPHPEIFASIKIGDRLLIDDGRVKLCVQEKGIGFIKCKVIAGISIADRKGISFPDTFLTTQALTQKDREDLHAALQTCEVDWVALSFIQSADDLLEIRKIISQNKIGLMSKIEKPRAIEYASEIIQLSDAVMVARGDLGVEMALELIPGIQKKLIRIARQLGKPVVIATQMLESMVTSPFPTRAEVSDVATAVFEEADAIMLSAETASGSYPVDAVRTMSLV********SWLEMRSLRRIEPNETGADVISSAARQIAETLRLSAIFCYTASGATGLRAARERPKLEIIALSPMIQTARRLALVWGIHCVVTEDASDSDDMVNRACRIVVEQGFGKPGDRIIISAGLPLGTPGSTNMLRIAYIGADGLSGM
****RRIKIISTLGPSSFSEDVINRLHEEGTDVFRINMSHTSHDKMCELIKKIRAVELRSRRPIGILIDLQGPKFRVGKFANSKVDLTEGQIFTLDNKDSLGSSDRVMLPHPEIFASIKIGDRLLIDDGRVKLCVQEKGIGFIKCKVIAGISIADRKGISFPDTFLTTQALTQKDREDLHAALQTCEVDWVALSFIQSADDLLEIRKIISQNKIGLMSKIEKPRAIEYASEIIQLSDAVMVARGDLGVEMALELIPGIQKKLIRIARQLGKPVVIATQMLESMVTSPFPTRAEVSDVATAVFEEADAIMLSAETASGSYPVDAVRTMSLVASSAERDSSWLEMRSLRRIEPNETGADVISSAARQIAETLRLSAIFCYTASGATGLRAARERPKLEIIALSPMIQTARRLALVWGIHCVVTEDASDSDDMVNRACRIVVEQGFGKPGDRIIISAGLPLGTPGSTNMLRIAYIGADGLSGM
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVNLRRIKIISTLGPSSFSEDVINRLHEEGTDVFRINMSHTSHDKMCELIKKIRAVELRSRRPIGILIDLQGPKFRVGKFANSKVDLTEGQIFTLDNKDSLGSSDRVMLPHPEIFASIKIGDRLLIDDGRVKLCVQEKGIGFIKCKVIAGISIADRKGISFPDTFLTTQALTQKDREDLHAALQTCEVDWVALSFIQSADDLLEIRKIISQNKIGLMSKIEKPRAIEYASEIIQLSDAVMVARGDLGVEMALELIPGIQKKLIRIARQLGKPVVIATQMLESMVTSPFPTRAEVSDVATAVFEEADAIMLSAETASGSYPVDAVRTMSLVASSAERDSSWLEMRSLRRIEPNETGADVISSAARQIAETLRLSAIFCYTASGATGLRAARERPKLEIIALSPMIQTARRLALVWGIHCVVTEDASDSDDMVNRACRIVVEQGFGKPGDRIIISAGLPLGTPGSTNMLRIAYIGADGLSGM
MVNLRRIKIISTLGPSSFSEDVINRLHEEGTDVFRINMSHTSHDKMCELIKKIRAVELRSRRPIGILIDLQGPKFRVGKFANSKVDLTEGQIFTLDNKDSLGSSDRVMLPHPEIFASIKIGDRLLIDDGRVKLCVQEKGIGFIKCKVIAGISIADRKGISFPDTFLTTQALTQKDREDLHAALQTCEVDWVALSFIQSADDLLEIRKIISQNKIGLMSKIEKPRAIEYASEIIQLSDAVMVARGDLGVEMALELIPGIQKKLIRIARQLGKPVVIATQMLESMVTSPFPTRAEVSDVATAVFEEADAIMLSAETASGSYPVDAVRTMSLVASSAERDSSWLEMRSLRRIEPNETGADVISSAARQIAETLRLSAIFCYTASGATGLRAARERPKLEIIALSPMIQTARRLALVWGIHCVVTEDASDSDDMVNRACRIVVEQGFGKPGDRIIISAGLPLGTPGSTNMLRIAYIGADGLSGM
MVNLRRIKIISTLGPSSFSEDVINRLHEEGTDVFRINMSHTSHDKMCELIKKIRAVELRSRRPIGILIDLQGPKFRVGKFANSKVDLTEGQIFTLDNKDSLGSSDRVMLPHPEIFASIKIGDRLLIDDGRVKLCVQEKGIGFIKCKVIAGISIADRKGISFPDTFLTTQALTQKDREDLHAALQTCEVDWVALSFIQSADDLLEIRKIISQNKIGLMSKIEKPRAIEYASEIIQLSDAVMVARGDLGVEMALELIPGIQKKLIRIARQLGKPVVIATQMLESMVTSPFPTRAEVSDVATAVFEEADAIMLSAETASGSYPVDAVRTMSLVASSAERDSSWLEMRSLRRIEPNETGADVISSAARQIAETLRLSAIFCYTASGATGLRAARERPKLEIIALSPMIQTARRLALVWGIHCVVTEDASDSDDMVNRACRIVVEQGFGKPGDRIIISAGLPLGTPGSTNMLRIAYIGADGLSGM

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target480 pyruvate kinase [Candidatus Liberibacter asiaticus str.
315122109480 pyruvate kinase [Candidatus Liberibacter solanacearum C 1 0.0
86359133480 pyruvate kinase [Rhizobium etli CFN 42] Length = 480 1 0.0
209550865479 pyruvate kinase [Rhizobium leguminosarum bv. trifolii W 1 0.0
222087048479 pyruvate kinase [Agrobacterium radiobacter K84] Length 1 0.0
190893367479 pyruvate kinase II protein [Rhizobium etli CIAT 652] Le 1 0.0
241206279479 pyruvate kinase [Rhizobium leguminosarum bv. trifolii W 1 0.0
15891188479 pyruvate kinase [Agrobacterium tumefaciens str. C58] Le 1 0.0
227823362479 pyruvate kinase [Sinorhizobium fredii NGR234] Length = 1 0.0
116253799479 pyruvate kinase [Rhizobium leguminosarum bv. viciae 384 1 0.0
163758853479 pyruvate kinase [Hoeflea phototrophica DFL-43] Length = 1 0.0
>gi|315122109|ref|YP_004062598.1| pyruvate kinase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 480 Back     alignment and organism information
 Score =  807 bits (2085), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/480 (82%), Positives = 438/480 (91%)

Query: 1   MVNLRRIKIISTLGPSSFSEDVINRLHEEGTDVFRINMSHTSHDKMCELIKKIRAVELRS 60
           M +LRRIKIISTLGP+SFSED+I RLHEEGTD+FRINMSHTSH+KM +LI+KIR VE +S
Sbjct: 1   MQSLRRIKIISTLGPASFSEDLIRRLHEEGTDLFRINMSHTSHEKMRDLIRKIRVVESQS 60

Query: 61  RRPIGILIDLQGPKFRVGKFANSKVDLTEGQIFTLDNKDSLGSSDRVMLPHPEIFASIKI 120
           RRP+GILIDLQGPKFRVGKF  SK+ L +GQ FTLDNKDSLG+ DRV LPH E+F S+K+
Sbjct: 61  RRPVGILIDLQGPKFRVGKFEGSKIYLKQGQNFTLDNKDSLGNVDRVFLPHAEVFESVKV 120

Query: 121 GDRLLIDDGRVKLCVQEKGIGFIKCKVIAGISIADRKGISFPDTFLTTQALTQKDREDLH 180
           GDRLLIDDG+VKLCV+  G  FIKC+V++G SI+DRKGISFPDT LTTQALT KDREDL 
Sbjct: 121 GDRLLIDDGKVKLCVKGTGSDFIKCEVVSGASISDRKGISFPDTLLTTQALTPKDREDLD 180

Query: 181 AALQTCEVDWVALSFIQSADDLLEIRKIISQNKIGLMSKIEKPRAIEYASEIIQLSDAVM 240
           AALQT EVDWVALSFIQS +DL+EIRKIIS  +IGLMSKIEK +AI+YA+EII+LSDAVM
Sbjct: 181 AALQTFEVDWVALSFIQSTEDLVEIRKIISPQQIGLMSKIEKSQAIDYATEIIKLSDAVM 240

Query: 241 VARGDLGVEMALELIPGIQKKLIRIARQLGKPVVIATQMLESMVTSPFPTRAEVSDVATA 300
           VARGDLGVEM LE IPGIQKKLIRIARQLGKP+VIATQMLESM++SP PTRAEVSDVATA
Sbjct: 241 VARGDLGVEMPLESIPGIQKKLIRIARQLGKPIVIATQMLESMISSPVPTRAEVSDVATA 300

Query: 301 VFEEADAIMLSAETASGSYPVDAVRTMSLVASSAERDSSWLEMRSLRRIEPNETGADVIS 360
           VFEEADAIMLSAETASGSYPVDAV+ M+LVA+SAE+D SWL+MRSLR+IEPNETGADVIS
Sbjct: 301 VFEEADAIMLSAETASGSYPVDAVKMMALVAASAEKDPSWLDMRSLRKIEPNETGADVIS 360

Query: 361 SAARQIAETLRLSAIFCYTASGATGLRAARERPKLEIIALSPMIQTARRLALVWGIHCVV 420
           SAARQIAETLRLSAI CYTASG TGLR ARERPKL I+ALSP+I+TARRL+LVWG+HCVV
Sbjct: 361 SAARQIAETLRLSAIVCYTASGQTGLRTARERPKLAIVALSPVIRTARRLSLVWGVHCVV 420

Query: 421 TEDASDSDDMVNRACRIVVEQGFGKPGDRIIISAGLPLGTPGSTNMLRIAYIGADGLSGM 480
           TEDAS  DDMVNRACRIVVEQGFGKPGDRIIISAGLPL T GSTNMLRI YIG DGLSG+
Sbjct: 421 TEDASGFDDMVNRACRIVVEQGFGKPGDRIIISAGLPLRTSGSTNMLRIVYIGEDGLSGV 480


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|86359133|ref|YP_471025.1| pyruvate kinase [Rhizobium etli CFN 42] Length = 480 Back     alignment and organism information
>gi|209550865|ref|YP_002282782.1| pyruvate kinase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 479 Back     alignment and organism information
>gi|222087048|ref|YP_002545583.1| pyruvate kinase [Agrobacterium radiobacter K84] Length = 479 Back     alignment and organism information
>gi|190893367|ref|YP_001979909.1| pyruvate kinase II protein [Rhizobium etli CIAT 652] Length = 479 Back     alignment and organism information
>gi|241206279|ref|YP_002977375.1| pyruvate kinase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 479 Back     alignment and organism information
>gi|15891188|ref|NP_356860.1| pyruvate kinase [Agrobacterium tumefaciens str. C58] Length = 479 Back     alignment and organism information
>gi|227823362|ref|YP_002827334.1| pyruvate kinase [Sinorhizobium fredii NGR234] Length = 479 Back     alignment and organism information
>gi|116253799|ref|YP_769637.1| pyruvate kinase [Rhizobium leguminosarum bv. viciae 3841] Length = 479 Back     alignment and organism information
>gi|163758853|ref|ZP_02165940.1| pyruvate kinase [Hoeflea phototrophica DFL-43] Length = 479 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target480 pyruvate kinase [Candidatus Liberibacter asiaticus str.
PRK06247476 PRK06247, PRK06247, pyruvate kinase; Provisional 0.0
PRK05826465 PRK05826, PRK05826, pyruvate kinase; Provisional 1e-129
TIGR01064473 TIGR01064, pyruv_kin, pyruvate kinase 1e-123
PRK06354 590 PRK06354, PRK06354, pyruvate kinase; Provisional 1e-123
cd00288480 cd00288, Pyruvate_Kinase, Pyruvate kinase (PK): Large a 1e-104
PRK09206470 PRK09206, PRK09206, pyruvate kinase; Provisional 5e-83
KOG2323501 KOG2323, KOG2323, KOG2323, Pyruvate kinase [Carbohydrat 8e-79
PTZ00066513 PTZ00066, PTZ00066, pyruvate kinase; Provisional 3e-78
PLN02623581 PLN02623, PLN02623, pyruvate kinase 5e-70
PLN02461511 PLN02461, PLN02461, Probable pyruvate kinase 3e-68
PLN02762509 PLN02762, PLN02762, pyruvate kinase complex alpha subun 7e-66
PLN02765526 PLN02765, PLN02765, pyruvate kinase 1e-43
COG0469477 COG0469, PykF, Pyruvate kinase [Carbohydrate transport 1e-144
pfam00224348 pfam00224, PK, Pyruvate kinase, barrel domain 6e-87
PRK06739352 PRK06739, PRK06739, pyruvate kinase; Validated 6e-64
PRK08187493 PRK08187, PRK08187, pyruvate kinase; Validated 2e-46
PTZ00300454 PTZ00300, PTZ00300, pyruvate kinase; Provisional 3e-58
PRK14725608 PRK14725, PRK14725, pyruvate kinase; Provisional 4e-33
pfam02887117 pfam02887, PK_C, Pyruvate kinase, alpha/beta domain 4e-31
PRK14725608 PRK14725, PRK14725, pyruvate kinase; Provisional 4e-08
>gnl|CDD|180487 PRK06247, PRK06247, pyruvate kinase; Provisional Back     alignment and domain information
>gnl|CDD|180277 PRK05826, PRK05826, pyruvate kinase; Provisional Back     alignment and domain information
>gnl|CDD|162184 TIGR01064, pyruv_kin, pyruvate kinase Back     alignment and domain information
>gnl|CDD|180540 PRK06354, PRK06354, pyruvate kinase; Provisional Back     alignment and domain information
>gnl|CDD|29370 cd00288, Pyruvate_Kinase, Pyruvate kinase (PK): Large allosteric enzyme that regulates glycolysis through binding of the substrate, phosphoenolpyruvate, and one or more allosteric effectors Back     alignment and domain information
>gnl|CDD|181699 PRK09206, PRK09206, pyruvate kinase; Provisional Back     alignment and domain information
>gnl|CDD|37534 KOG2323, KOG2323, KOG2323, Pyruvate kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|173361 PTZ00066, PTZ00066, pyruvate kinase; Provisional Back     alignment and domain information
>gnl|CDD|178230 PLN02623, PLN02623, pyruvate kinase Back     alignment and domain information
>gnl|CDD|178080 PLN02461, PLN02461, Probable pyruvate kinase Back     alignment and domain information
>gnl|CDD|178362 PLN02762, PLN02762, pyruvate kinase complex alpha subunit Back     alignment and domain information
>gnl|CDD|178365 PLN02765, PLN02765, pyruvate kinase Back     alignment and domain information
>gnl|CDD|30817 COG0469, PykF, Pyruvate kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|143979 pfam00224, PK, Pyruvate kinase, barrel domain Back     alignment and domain information
>gnl|CDD|180676 PRK06739, PRK06739, pyruvate kinase; Validated Back     alignment and domain information
>gnl|CDD|181277 PRK08187, PRK08187, pyruvate kinase; Validated Back     alignment and domain information
>gnl|CDD|140321 PTZ00300, PTZ00300, pyruvate kinase; Provisional Back     alignment and domain information
>gnl|CDD|184806 PRK14725, PRK14725, pyruvate kinase; Provisional Back     alignment and domain information
>gnl|CDD|145835 pfam02887, PK_C, Pyruvate kinase, alpha/beta domain Back     alignment and domain information
>gnl|CDD|184806 PRK14725, PRK14725, pyruvate kinase; Provisional Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 480 pyruvate kinase [Candidatus Liberibacter asiaticus str.
TIGR01064513 pyruv_kin pyruvate kinase; InterPro: IPR001697 Pyruvate 100.0
PRK06354 589 pyruvate kinase; Provisional 100.0
PRK06247477 pyruvate kinase; Provisional 100.0
PTZ00066513 pyruvate kinase; Provisional 100.0
PRK09206470 pyruvate kinase; Provisional 100.0
cd00288480 Pyruvate_Kinase Pyruvate kinase (PK): Large allosteric 100.0
PRK05826461 pyruvate kinase; Provisional 100.0
COG0469477 PykF Pyruvate kinase [Carbohydrate transport and metabo 100.0
KOG2323501 consensus 100.0
PTZ00300454 pyruvate kinase; Provisional 100.0
pfam00224348 PK Pyruvate kinase, barrel domain. This domain of the i 100.0
PRK06739352 pyruvate kinase; Validated 100.0
PRK08187606 pyruvate kinase; Validated 100.0
pfam02887117 PK_C Pyruvate kinase, alpha/beta domain. As well as bei 99.96
pfam08981181 consensus 96.2
COG1751186 Uncharacterized conserved protein [Function unknown] 94.44
PRK10558256 alpha-dehydro-beta-deoxy-D-glucarate aldolase; Provisio 98.68
TIGR03239249 GarL 2-dehydro-3-deoxyglucarate aldolase. In E. coli th 98.68
PRK10128250 putative aldolase; Provisional 98.45
COG3836255 HpcH 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase [C 97.3
TIGR01418877 PEP_synth phosphoenolpyruvate synthase; InterPro: IPR00 95.54
pfam00478467 IMPDH IMP dehydrogenase / GMP reductase domain. This fa 93.5
PTZ00314499 inosine-5'-monophosphate dehydrogenase; Provisional 93.1
PRK05567486 inositol-5'-monophosphate dehydrogenase; Reviewed 91.79
TIGR03586327 PseI pseudaminic acid synthase. 91.34
pfam03102240 NeuB NeuB family. NeuB is the prokaryotic N-acetylneura 91.14
pfam03328221 HpcH_HpaI HpcH/HpaI aldolase/citrate lyase family. This 98.47
pfam02896292 PEP-utilizers_C PEP-utilising enzyme, TIM barrel domain 96.98
PRK05567486 inositol-5'-monophosphate dehydrogenase; Reviewed 96.39
cd00381325 IMPDH IMPDH: The catalytic domain of the inosine monoph 96.38
COG2301283 CitE Citrate lyase beta subunit [Carbohydrate transport 96.26
PRK11177575 phosphoenolpyruvate-protein phosphotransferase; Provisi 95.8
PRK11061748 fused phosphoenolpyruvate-protein phosphotransferase Pt 95.21
PRK05458326 guanosine 5'-monophosphate oxidoreductase; Provisional 95.01
pfam00478467 IMPDH IMP dehydrogenase / GMP reductase domain. This fa 94.46
PTZ00314499 inosine-5'-monophosphate dehydrogenase; Provisional 94.14
PRK07807479 inositol-5-monophosphate dehydrogenase; Validated 94.12
cd04730236 NPD_like 2-Nitropropane dioxygenase (NPD), one of the n 94.09
PRK08649368 inositol-5-monophosphate dehydrogenase; Validated 93.42
cd00381325 IMPDH IMPDH: The catalytic domain of the inosine monoph 92.52
PRK07107497 inositol-5-monophosphate dehydrogenase; Validated 91.78
PRK01261228 aroD 3-dehydroquinate dehydratase; Provisional 90.76
PRK06843404 inositol-5-monophosphate dehydrogenase; Validated 90.11
PRK08227291 aldolase; Validated 96.29
TIGR01588288 citE citrate lyase, beta subunit; InterPro: IPR006475 T 96.17
PRK00073391 pgk phosphoglycerate kinase; Provisional 95.91
PTZ00005419 phosphoglycerate kinase; Provisional 94.33
TIGR01302476 IMP_dehydrog inosine-5'-monophosphate dehydrogenase; In 95.56
TIGR02311249 HpaI 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase; I 95.26
cd02911233 arch_FMN Archeal FMN-binding domain. This family of arc 92.68
cd02801231 DUS_like_FMN Dihydrouridine synthase-like (DUS-like) FM 91.15
PRK10415321 tRNA-dihydrouridine synthase B; Provisional 91.09
PRK01222212 N-(5'-phosphoribosyl)anthranilate isomerase; Provisiona 94.82
cd00958235 DhnA Class I fructose-1,6-bisphosphate (FBP) aldolases 94.79
PRK07226266 fructose-bisphosphate aldolase; Provisional 92.01
PRK06464 794 phosphoenolpyruvate synthase; Validated 93.48
PRK06381319 threonine synthase; Validated 90.08
PRK02621254 consensus 93.19
>TIGR01064 pyruv_kin pyruvate kinase; InterPro: IPR001697 Pyruvate kinase (2 Back     alignment and domain information
>PRK06354 pyruvate kinase; Provisional Back     alignment and domain information
>PRK06247 pyruvate kinase; Provisional Back     alignment and domain information
>PTZ00066 pyruvate kinase; Provisional Back     alignment and domain information
>PRK09206 pyruvate kinase; Provisional Back     alignment and domain information
>cd00288 Pyruvate_Kinase Pyruvate kinase (PK): Large allosteric enzyme that regulates glycolysis through binding of the substrate, phosphoenolpyruvate, and one or more allosteric effectors Back     alignment and domain information
>PRK05826 pyruvate kinase; Provisional Back     alignment and domain information
>COG0469 PykF Pyruvate kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2323 consensus Back     alignment and domain information
>PTZ00300 pyruvate kinase; Provisional Back     alignment and domain information
>pfam00224 PK Pyruvate kinase, barrel domain Back     alignment and domain information
>PRK06739 pyruvate kinase; Validated Back     alignment and domain information
>PRK08187 pyruvate kinase; Validated Back     alignment and domain information
>pfam02887 PK_C Pyruvate kinase, alpha/beta domain Back     alignment and domain information
>pfam08981 consensus Back     alignment and domain information
>COG1751 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK10558 alpha-dehydro-beta-deoxy-D-glucarate aldolase; Provisional Back     alignment and domain information
>TIGR03239 GarL 2-dehydro-3-deoxyglucarate aldolase Back     alignment and domain information
>PRK10128 putative aldolase; Provisional Back     alignment and domain information
>COG3836 HpcH 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01418 PEP_synth phosphoenolpyruvate synthase; InterPro: IPR006319 This family represents phosphoenolpyruvate synthase; also called pyruvate,water dikinase and PEP synthase Back     alignment and domain information
>pfam00478 IMPDH IMP dehydrogenase / GMP reductase domain Back     alignment and domain information
>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK05567 inositol-5'-monophosphate dehydrogenase; Reviewed Back     alignment and domain information
>TIGR03586 PseI pseudaminic acid synthase Back     alignment and domain information
>pfam03102 NeuB NeuB family Back     alignment and domain information
>pfam03328 HpcH_HpaI HpcH/HpaI aldolase/citrate lyase family Back     alignment and domain information
>pfam02896 PEP-utilizers_C PEP-utilising enzyme, TIM barrel domain Back     alignment and domain information
>PRK05567 inositol-5'-monophosphate dehydrogenase; Reviewed Back     alignment and domain information
>cd00381 IMPDH IMPDH: The catalytic domain of the inosine monophosphate dehydrogenase Back     alignment and domain information
>COG2301 CitE Citrate lyase beta subunit [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11177 phosphoenolpyruvate-protein phosphotransferase; Provisional Back     alignment and domain information
>PRK11061 fused phosphoenolpyruvate-protein phosphotransferase PtsP/GAF domain; Provisional Back     alignment and domain information
>PRK05458 guanosine 5'-monophosphate oxidoreductase; Provisional Back     alignment and domain information
>pfam00478 IMPDH IMP dehydrogenase / GMP reductase domain Back     alignment and domain information
>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK07807 inositol-5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>cd04730 NPD_like 2-Nitropropane dioxygenase (NPD), one of the nitroalkane oxidizing enzyme families, catalyzes oxidative denitrification of nitroalkanes to their corresponding carbonyl compounds and nitrites Back     alignment and domain information
>PRK08649 inositol-5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>cd00381 IMPDH IMPDH: The catalytic domain of the inosine monophosphate dehydrogenase Back     alignment and domain information
>PRK07107 inositol-5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>PRK01261 aroD 3-dehydroquinate dehydratase; Provisional Back     alignment and domain information
>PRK06843 inositol-5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>PRK08227 aldolase; Validated Back     alignment and domain information
>TIGR01588 citE citrate lyase, beta subunit; InterPro: IPR006475 This group of sequences represent the beta subunit of the holoenzyme citrate lyase (4 Back     alignment and domain information
>PRK00073 pgk phosphoglycerate kinase; Provisional Back     alignment and domain information
>PTZ00005 phosphoglycerate kinase; Provisional Back     alignment and domain information
>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase; InterPro: IPR005990 Synonyms: Inosine-5'-monophosphate dehydrogenase, Inosinic acid dehydrogenase IMP dehydrogenase (1 Back     alignment and domain information
>TIGR02311 HpaI 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase; InterPro: IPR012689 This entry represents the aldolase which performs the final step unique to the 4-hydroxyphenylacetic acid catabolism pathway in which 2,4-dihydroxyhept-2-ene-1,7-dioic acid is split into pyruvate and succinate-semialdehyde Back     alignment and domain information
>cd02911 arch_FMN Archeal FMN-binding domain Back     alignment and domain information
>cd02801 DUS_like_FMN Dihydrouridine synthase-like (DUS-like) FMN-binding domain Back     alignment and domain information
>PRK10415 tRNA-dihydrouridine synthase B; Provisional Back     alignment and domain information
>PRK01222 N-(5'-phosphoribosyl)anthranilate isomerase; Provisional Back     alignment and domain information
>cd00958 DhnA Class I fructose-1,6-bisphosphate (FBP) aldolases of the archaeal type (DhnA homologs) found in bacteria and archaea Back     alignment and domain information
>PRK07226 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>PRK06464 phosphoenolpyruvate synthase; Validated Back     alignment and domain information
>PRK06381 threonine synthase; Validated Back     alignment and domain information
>PRK02621 consensus Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target480 pyruvate kinase [Candidatus Liberibacter asiaticus str.
2e28_A 587 Crystal Structure Analysis Of Pyruvate Kinase From 1e-134
3bjt_A530 Pyruvate Kinase M2 Is A Phosphotyrosine Binding Pro 1e-120
1zjh_A548 Structure Of Human Muscle Pyruvate Kinase (Pkm2) Le 1e-119
3bjf_A518 Pyruvate Kinase M2 Is A Phosphotyrosine Binding Pro 1e-119
3gqy_A550 Activator-Bound Structure Of Human Pyruvate Kinase 1e-119
3g2g_A533 S437y Mutant Of Human Muscle Pyruvate Kinase, Isofo 1e-119
1t5a_A567 Human Pyruvate Kinase M2 Length = 567 1e-119
2g50_A530 The Location Of The Allosteric Amino Acid Binding S 1e-117
3n25_A531 The Structure Of Muscle Pyruvate Kinase In Complex 1e-116
1aqf_A530 Pyruvate Kinase From Rabbit Muscle With Mg, K, And 1e-116
1f3x_A530 S402p Mutant Of Rabbit Muscle Pyruvate Kinase Lengt 1e-116
1f3w_A530 Recombinant Rabbit Muscle Pyruvate Kinase Length = 1e-116
1pkm_A530 The Refined Three-Dimensional Structure Of Cat Musc 1e-116
1pkn_A530 Structure Of Rabbit Muscle Pyruvate Kinase Complexe 1e-116
2vgb_A528 Human Erythrocyte Pyruvate Kinase Length = 528 1e-113
2vgg_A528 Human Erythrocyte Pyruvate Kinase: R479h Mutant Len 1e-113
2vgf_A528 Human Erythrocyte Pyruvate Kinase: T384m Mutant Len 1e-113
2vgi_A528 Human Erythrocyte Pyruvate Kinase: R486w Mutant Len 1e-112
1pky_A470 Pyruvate Kinase From E. Coli In The T-State Length 1e-110
1e0u_A470 Structure R271l Mutant Of E. Coli Pyruvate Kinase L 1e-110
1e0t_A470 R292d Mutant Of E. Coli Pyruvate Kinase Length = 47 1e-109
3khd_A520 Crystal Structure Of Pff1300w. Length = 520 1e-109
3eoe_A511 Crystal Structure Of Pyruvate Kinase From Toxoplasm 1e-108
1a3w_A500 Pyruvate Kinase From Saccharomyces Cerevisiae Compl 1e-104
3ma8_A534 Crystal Structure Of Cgd1_2040, A Pyruvate Kinase F 1e-104
3pp7_A498 Crystal Structure Of Leishmania Mexicana Pyruvate K 1e-104
1pkl_A499 The Structure Of Leishmania Pyruvate Kinase Length 1e-104
3e0v_A539 Crystal Structure Of Pyruvate Kinase From Leishmani 1e-103
>gi|167013173|pdb|2E28|A Chain A, Crystal Structure Analysis Of Pyruvate Kinase From Bacillus Stearothermophilus Length = 587 Back     alignment and structure
 Score =  483 bits (1243), Expect = e-134,   Method: Composition-based stats.
 Identities = 179/480 (37%), Positives = 283/480 (58%), Gaps = 6/480 (1%)

Query: 5   RRIKIISTLGPSSFSEDVINRLHEEGTDVFRINMSHTSHDKMCELIKKIRAVELRSRRPI 64
           R+ KI+ST+GP+S S D + +L E G +V R+N SH  H++    I  IR    R+ R +
Sbjct: 3   RKTKIVSTIGPASESVDKLVQLMEAGMNVARLNFSHGDHEEHGRRIANIREAAKRTGRTV 62

Query: 65  GILIDLQGPKFRVGKFANSKVDLTEGQIFTLDNKDSLGSSDRVMLPHPEIFASIKIGDRL 124
            IL+D +GP+ R     N  ++L EG    +   + LG+ +++ + +P +   + +G ++
Sbjct: 63  AILLDTKGPEIRTHNMENGAIELKEGSKLVISMSEVLGTPEKISVTYPSLIDDVSVGAKI 122

Query: 125 LIDDG--RVKLCVQEKGIGFIKCKVIAGISIADRKGISFPDTFLTTQALTQKDREDLHAA 182
           L+DDG   +++   +K  G I   V+ G  + ++KG++ P   +    +T+KDR D+   
Sbjct: 123 LLDDGLISLEVNAVDKQAGEIVTTVLNGGVLKNKKGVNVPGVKVNLPGITEKDRADILFG 182

Query: 183 LQTCEVDWVALSFIQSADDLLEIRKIISQN---KIGLMSKIEKPRAIEYASEIIQLSDAV 239
           ++    D++A SF++ A D+LEIR+++  +    I +++KIE    +    EI++ +D +
Sbjct: 183 IRQGI-DFIAASFVRRASDVLEIRELLEAHDALHIQIIAKIENEEGVANIDEILEAADGL 241

Query: 240 MVARGDLGVEMALELIPGIQKKLIRIARQLGKPVVIATQMLESMVTSPFPTRAEVSDVAT 299
           MVARGDLGVE+  E +P IQK LI+ +  LGKPV+ ATQML+SM  +P PTRAE SDVA 
Sbjct: 242 MVARGDLGVEIPAEEVPLIQKLLIKKSNMLGKPVITATQMLDSMQRNPRPTRAEASDVAN 301

Query: 300 AVFEEADAIMLSAETASGSYPVDAVRTMSLVASSAERDSSWLEMRSLRRIEPNETGADVI 359
           A+F+  DA+MLS ETA+G YPV+AV+TM  +A   E+     ++ S R  E   T  D I
Sbjct: 302 AIFDGTDAVMLSGETAAGQYPVEAVKTMHQIALRTEQALEHRDILSQRTKESQTTITDAI 361

Query: 360 SSAARQIAETLRLSAIFCYTASGATGLRAARERPKLEIIALSPMIQTARRLALVWGIHCV 419
             +    A  L ++AI   T SG T    A+ RPK  IIA++     +RRLALVWG++  
Sbjct: 362 GQSVAHTALNLDVAAIVTPTVSGKTPQMVAKYRPKAPIIAVTSNEAVSRRLALVWGVYTK 421

Query: 420 VTEDASDSDDMVNRACRIVVEQGFGKPGDRIIISAGLPLGTPGSTNMLRIAYIGADGLSG 479
                + +D+M++ A    V  G  K GD ++I+AG+P+G  GSTN++++  I      G
Sbjct: 422 EAPHVNTTDEMLDVAVDAAVRSGLVKHGDLVVITAGVPVGETGSTNLMKVHVISDLLAKG 481


>gi|169404699|pdb|3BJT|A Chain A, Pyruvate Kinase M2 Is A Phosphotyrosine Binding Protein Length = 530 Back     alignment and structure
>gi|67464392|pdb|1ZJH|A Chain A, Structure Of Human Muscle Pyruvate Kinase (Pkm2) Length = 548 Back     alignment and structure
>gi|169404695|pdb|3BJF|A Chain A, Pyruvate Kinase M2 Is A Phosphotyrosine Binding Protein Length = 518 Back     alignment and structure
>gi|226438362|pdb|3GQY|A Chain A, Activator-Bound Structure Of Human Pyruvate Kinase M2 Length = 550 Back     alignment and structure
>gi|224510884|pdb|3G2G|A Chain A, S437y Mutant Of Human Muscle Pyruvate Kinase, Isoform M2 Length = 533 Back     alignment and structure
>gi|73535278|pdb|1T5A|A Chain A, Human Pyruvate Kinase M2 Length = 567 Back     alignment and structure
>gi|109157779|pdb|2G50|A Chain A, The Location Of The Allosteric Amino Acid Binding Site Of Muscle Pyruvate Kinase. Length = 530 Back     alignment and structure
>gi|301598638|pdb|3N25|A Chain A, The Structure Of Muscle Pyruvate Kinase In Complex With Proline, Pyruvate, And Mn2+ Length = 531 Back     alignment and structure
>gi|3659945|pdb|1AQF|A Chain A, Pyruvate Kinase From Rabbit Muscle With Mg, K, And L- Phospholactate Length = 530 Back     alignment and structure
>gi|15987978|pdb|1F3X|A Chain A, S402p Mutant Of Rabbit Muscle Pyruvate Kinase Length = 530 Back     alignment and structure
>gi|15987970|pdb|1F3W|A Chain A, Recombinant Rabbit Muscle Pyruvate Kinase Length = 530 Back     alignment and structure
>gi|157833510|pdb|1PKM|A Chain A, The Refined Three-Dimensional Structure Of Cat Muscle (M1) Pyruvate Kinase, At A Resolution Of 2.6 Angstroms Length = 530 Back     alignment and structure
>gi|157833511|pdb|1PKN|A Chain A, Structure Of Rabbit Muscle Pyruvate Kinase Complexed With Mn2+, K+, And Pyruvate Length = 530 Back     alignment and structure
>gi|160877853|pdb|2VGB|A Chain A, Human Erythrocyte Pyruvate Kinase Length = 528 Back     alignment and structure
>gi|160877861|pdb|2VGG|A Chain A, Human Erythrocyte Pyruvate Kinase: R479h Mutant Length = 528 Back     alignment and structure
>gi|160877857|pdb|2VGF|A Chain A, Human Erythrocyte Pyruvate Kinase: T384m Mutant Length = 528 Back     alignment and structure
>gi|160877865|pdb|2VGI|A Chain A, Human Erythrocyte Pyruvate Kinase: R486w Mutant Length = 528 Back     alignment and structure
>gi|1310978|pdb|1PKY|A Chain A, Pyruvate Kinase From E. Coli In The T-State Length = 470 Back     alignment and structure
>gi|9955371|pdb|1E0U|A Chain A, Structure R271l Mutant Of E. Coli Pyruvate Kinase Length = 470 Back     alignment and structure
>gi|9955367|pdb|1E0T|A Chain A, R292d Mutant Of E. Coli Pyruvate Kinase Length = 470 Back     alignment and structure
>gi|284055700|pdb|3KHD|A Chain A, Crystal Structure Of Pff1300w. Length = 520 Back     alignment and structure
>gi|209447575|pdb|3EOE|A Chain A, Crystal Structure Of Pyruvate Kinase From Toxoplasma Gondii, 55.M00007 Length = 511 Back     alignment and structure
gi|3212328|pdb|1A3W|A Chain A, Pyruvate Kinase From Saccharomyces Cerevisiae Complexed With Fbp, Pg, Mn2+ And K+ Length = 500 Back     alignment and structure
>gi|301015901|pdb|3MA8|A Chain A, Crystal Structure Of Cgd1_2040, A Pyruvate Kinase From Cryptosporidium Parvum Length = 534 Back     alignment and structure
>gi|315113812|pdb|3PP7|A Chain A, Crystal Structure Of Leishmania Mexicana Pyruvate Kinase In Complex With The Drug Suramin, An Inhibitor Of Glycolysis. Length = 498 Back     alignment and structure
gi|3660261|pdb|1PKL|A Chain A, The Structure Of Leishmania Pyruvate Kinase Length = 499 Back     alignment and structure
>gi|197107490|pdb|3E0V|A Chain A, Crystal Structure Of Pyruvate Kinase From Leishmania Mexicana In Complex With Sulphate Ions Length = 539 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target480 pyruvate kinase [Candidatus Liberibacter asiaticus str.
1e0t_A470 Pyruvate kinase, PK; phosphotransferase, glycolysis, al 1e-139
3hqn_D499 Pyruvate kinase, PK; TIM barrel, T-state enzyme, transf 1e-134
3ma8_A534 Pyruvate kinase; parasitology, pyruvate kiase, glycol k 1e-128
3khd_A520 Pyruvate kinase; malaria, structural genomics, structur 1e-127
2e28_A 587 Pyruvate kinase, PK; allosteric, transferase; 2.40A {Ge 1e-110
3gg8_A511 Pyruvate kinase; malaria, genomics, proteomics, glycoly 1e-103
3gr4_A550 Pyruvate kinase isozymes M1/M2; activator, acetylation, 4e-99
1a3w_A500 Pyruvate kinase; allosteric regulation, tranferase; HET 1e-97
1dxe_A256 2-dehydro-3-deoxy-galactarate aldolase; class II aldola 7e-08
>1e0t_A Pyruvate kinase, PK; phosphotransferase, glycolysis, allostery; 1.8A {Escherichia coli} SCOP: b.58.1.1 c.1.12.1 c.49.1.1 PDB: 1pky_A 1e0u_A Length = 470 Back     alignment and structure
 Score =  490 bits (1263), Expect = e-139
 Identities = 141/471 (29%), Positives = 247/471 (52%), Gaps = 9/471 (1%)

Query: 4   LRRIKIISTLGPSSFSEDVINRLHEEGTDVFRINMSHTSHDKMCELIKKIRAVELRSRRP 63
           +++ KI+ T+GP + SE+++ ++ + G +V R+N SH  + +  + I+ +R V  ++ + 
Sbjct: 1   MKKTKIVCTIGPKTESEEMLAKMLDAGMNVMRLNFSHGDYAEHGQRIQNLRNVMSKTGKT 60

Query: 64  IGILIDLQGPKFRVGKFAN-SKVDLTEGQIFTLD-NKDSLGSSDRVMLPHPEIFASIKIG 121
             IL+D +GP+ R  K    + V L  GQ FT   +K  +G+S+ V + +      + +G
Sbjct: 61  AAILLDTKGPEIRTMKLEGGNDVSLKAGQTFTFTTDKSVIGNSEMVAVTYEGFTTDLSVG 120

Query: 122 DRLLIDDGRVKLCVQEKGIGFIKCKVIAGISIADRKGISFPDTFLTTQALTQKDREDLHA 181
           + +L+DDG + + V       + CKV+    + + KG++ P   +   AL +KD++DL  
Sbjct: 121 NTVLVDDGLIGMEVTAIEGNKVICKVLNNGDLGENKGVNLPGVSIALPALAEKDKQDLIF 180

Query: 182 ALQTCEVDWVALSFIQSADDLLEIRKIISQNK---IGLMSKIEKPRAIEYASEIIQLSDA 238
             +   VD+VA SFI+   D++EIR+ +  +    I ++SKIE    +    EI++ SD 
Sbjct: 181 GCE-QGVDFVAASFIRKRSDVIEIREHLKAHGGENIHIISKIENQEGLNNFDEILEASDG 239

Query: 239 VMVARGDLGVEMALELIPGIQKKLIRIARQLGKPVVIATQMLESMVTSPFPTRAEVSDVA 298
           +MVARGDLGVE+ +E +   QK +I    +  K V+ AT ML+SM+ +P PT AE  DVA
Sbjct: 240 IMVARGDLGVEIPVEEVIFAQKMMIEKCIRARKVVITATMMLDSMIKNPRPTDAEAGDVA 299

Query: 299 TAVFEEADAIMLSAETASGSYPVDAVRTMSLVASSAERDSSWLEMRSLRRIEPNETGADV 358
            A+ +  DA+MLS E+A G YP++AV  M+ +    +R                    + 
Sbjct: 300 NAILDGTDAVMLSGESAKGKYPLEAVSIMATICERTDR--VMNSRLEFNNDNRKLRITEA 357

Query: 359 ISSAARQIAETLRLSAIFCYTASGATGLRAARERPKLEIIALSPMIQTARRLALVWGIHC 418
           +   A + AE L    I   T  G +     +  P   I+AL+   +TA +L L  G+  
Sbjct: 358 VCRGAVETAEKLDAPLIVVATQGGKSARAVRKYFPDATILALTTNEKTAHQLVLSKGVVP 417

Query: 419 VVTEDASDSDDMVNRACRIVVEQGFGKPGDRIIISAGLPLGTPGSTNMLRI 469
            + ++ + +DD       + ++ G    GD +++ +G  +   G+TN   +
Sbjct: 418 QLVKEITSTDDFYRLGKELALQSGLAHKGDVVVMVSGALVP-SGTTNTASV 467


>3hqn_D Pyruvate kinase, PK; TIM barrel, T-state enzyme, transferase, allosteric enzyme, ATP-binding, glycolysis, magnesium, metal-binding; 2.00A {Leishmania mexicana} PDB: 1pkl_A 3hqo_K* 3hqp_A* 3hqq_A* 3ktx_A* 3e0w_A 3e0v_A Length = 499 Back     alignment and structure
>3ma8_A Pyruvate kinase; parasitology, pyruvate kiase, glycol kinase, magnesium, transferase, structural genomi structural genomics consortium; HET: CIT; 2.64A {Cryptosporidium parvum} Length = 534 Back     alignment and structure
>3khd_A Pyruvate kinase; malaria, structural genomics, structural genomics consortium, SGC; 2.70A {Plasmodium falciparum 3D7} Length = 520 Back     alignment and structure
>2e28_A Pyruvate kinase, PK; allosteric, transferase; 2.40A {Geobacillus stearothermophilus} Length = 587 Back     alignment and structure
>3gg8_A Pyruvate kinase; malaria, genomics, proteomics, glycolysis, magnesium, transferase, structural genomics, structural genomics consortium, SGC; 2.21A {Toxoplasma gondii} PDB: 3eoe_A Length = 511 Back     alignment and structure
>3gr4_A Pyruvate kinase isozymes M1/M2; activator, acetylation, allosteric enzyme, alternative splicing, glycolysis, magnesium, metal-binding; HET: FBP TLA DYY ADP; 1.60A {Homo sapiens} PDB: 3gqy_A* 3h6o_A* 1zjh_A 3g2g_A 1t5a_A* 3bjt_A 3bjf_A* 1f3x_A 1f3w_A 1a49_A* 1a5u_A* 1aqf_A* 1pkm_A 2g50_A* 1pkn_A 2vgb_A* 2vgf_A* 2vgg_A* 2vgi_A* Length = 550 Back     alignment and structure
>1a3w_A Pyruvate kinase; allosteric regulation, tranferase; HET: FBP; 3.00A {Saccharomyces cerevisiae} SCOP: b.58.1.1 c.1.12.1 c.49.1.1 PDB: 1a3x_A Length = 500 Back     alignment and structure
>1dxe_A 2-dehydro-3-deoxy-galactarate aldolase; class II aldolase; 1.8A {Escherichia coli} SCOP: c.1.12.5 PDB: 1dxf_A Length = 256 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target480 pyruvate kinase [Candidatus Liberibacter asiaticus str.
2e28_A 587 Pyruvate kinase, PK; allosteric, transferase; 2.40A {Ge 100.0
3gr4_A550 Pyruvate kinase isozymes M1/M2; activator, acetylation, 100.0
3ma8_A534 Pyruvate kinase; parasitology, pyruvate kiase, glycol k 100.0
3gg8_A511 Pyruvate kinase; malaria, genomics, proteomics, glycoly 100.0
1e0t_A470 Pyruvate kinase, PK; phosphotransferase, glycolysis, al 100.0
3khd_A520 Pyruvate kinase; malaria, structural genomics, structur 100.0
3hqn_D499 Pyruvate kinase, PK; TIM barrel, T-state enzyme, transf 100.0
1a3w_A500 Pyruvate kinase; allosteric regulation, tranferase, tra 100.0
1izc_A339 Macrophomate synthase intermolecular diels- alderase; T 98.95
2v5j_A287 2,4-dihydroxyhept-2-ENE-1,7-dioic acid aldolase; lyase, 98.76
2vws_A267 YFAU, 2-keto-3-deoxy sugar aldolase; lyase, escherichia 98.74
1dxe_A256 2-dehydro-3-deoxy-galactarate aldolase; class II aldola 98.69
1sgj_A284 Citrate lyase, beta subunit; trimer, TIM barrel, struct 97.71
1u5h_A273 CITE; TIM barrel, structural genomics, PSI, protein str 97.41
3cux_A528 Malate synthase; TIM barrel, glyoxylate bypass, transfe 97.01
3khj_A361 Inosine-5-monophosphate dehydrogenase; enzyme-inhibitor 96.97
2wqd_A572 Phosphoenolpyruvate-protein phosphotransferase; kinase, 96.88
3ffs_A400 Inosine-5-monophosphate dehydrogenase; beta-alpha barre 96.77
2bg5_A324 Enzyme I, phosphoenolpyruvate-protein kinase; phosphotr 96.76
2hwg_A575 Phosphoenolpyruvate-protein phosphotransferase; enzyme 96.58
2qr6_A393 IMP dehydrogenase/GMP reductase; NP_599840.1, GMP reduc 96.46
1kbl_A873 PPDK, pyruvate phosphate dikinase; transferase, phospho 96.11
3igs_A232 N-acetylmannosamine-6-phosphate 2-epimerase 2; energy m 95.86
1eep_A404 Inosine 5'-monophosphate dehydrogenase; alpha-beta barr 95.69
3cuz_A532 MSA, malate synthase A; TIM barrel, cytoplasm, glyoxyla 95.58
1zfj_A491 Inosine monophosphate dehydrogenase; IMPDH, CBS domains 95.41
1jcn_A514 Inosine monophosphate dehydrogenase I; IMPD, IMPDH, gua 94.85
1vrd_A494 Inosine-5'-monophosphate dehydrogenase; TM1347, structu 94.7
2cu0_A486 Inosine-5'-monophosphate dehydrogenase; structural geno 93.32
1ypf_A336 GMP reductase; GUAC, purines, pyrimidines, nucleosides, 93.03
2c6q_A351 GMP reductase 2; TIM barrel, metal-binding, NADP, oxido 91.41
2ols_A 794 Phosphoenolpyruvate synthase; MCSG, structural genomics 96.83
3cwc_A383 Putative glycerate kinase 2; structural genomics, cente 91.0
1t57_A206 Conserved protein MTH1675; structural genomics, FMN, me 95.24
1vp8_A201 Hypothetical protein AF0103; NP_068944.1, structural ge 93.0
1vbg_A876 Pyruvate,orthophosphate dikinase; transferase, maize, r 94.94
1h6z_A913 Pyruvate phosphate dikinase; transferase, tropical para 93.76
3glc_A295 Aldolase LSRF; TIM barrel, cytoplasm, lyase, schiff bas 94.17
2qjg_A273 Putative aldolase MJ0400; beta-alpha barrel, lyase; HET 93.01
1jcn_A514 Inosine monophosphate dehydrogenase I; IMPD, IMPDH, gua 90.97
>2e28_A Pyruvate kinase, PK; allosteric, transferase; 2.40A {Geobacillus stearothermophilus} Back     alignment and structure
Probab=100.00  E-value=0  Score=1181.79  Aligned_cols=475  Identities=38%  Similarity=0.616  Sum_probs=459.3

Q ss_pred             CCCEEEEECCCCCCCHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCEEEEEECCCCC
Q ss_conf             75269994187757999999999739978999888889899999999999999974992799998789867886548981
Q gi|254780442|r    5 RRIKIISTLGPSSFSEDVINRLHEEGTDVFRINMSHTSHDKMCELIKKIRAVELRSRRPIGILIDLQGPKFRVGKFANSK   84 (480)
Q Consensus         5 rktKIi~TlGPas~~~e~i~~l~~aG~nv~RiN~SHg~~e~~~~~i~~ir~~~~~~~~~i~Il~Dl~GpkiR~g~~~~~~   84 (480)
                      |||||||||||||++++.|++|+++|||+||||||||++|||+++++++|+++++.+++++||+||||||||||.|++++
T Consensus         3 RkTKIv~TiGPas~~~e~l~~li~aG~nv~RlN~SHg~~e~h~~~i~~iR~~~~~~~~~vaIllDl~GpkIRtg~~~~~~   82 (587)
T 2e28_A            3 RKTKIVSTIGPASESVDKLVQLMEAGMNVARLNFSHGDHEEHGRRIANIREAAKRTGRTVAILLDTKGPEIRTHNMENGA   82 (587)
T ss_dssp             CCSEEEEECCTTTCSHHHHHHHHHHTEEEEEEETTSSCHHHHHHHHHHHHHHHHHTTCCCEEEEECCCCCCBBCCCTTSC
T ss_pred             CCCEEEEEECCCCCCHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHHHHCCCEEEEEECCCCEEEEEECCCCE
T ss_conf             78769982488869999999999879999999899999999999999999999970998079997999856886327982


Q ss_pred             EEECCCCEEEEECCCCCCCCCCCCCCCCCCHHHCCCCCEEEEECCCEEECCCCCCC--CEEEEEECCCCEEECCCCCCCC
Q ss_conf             89658999999532455644422126644222113365267406842210234454--1124551388087114564467
Q gi|254780442|r   85 VDLTEGQIFTLDNKDSLGSSDRVMLPHPEIFASIKIGDRLLIDDGRVKLCVQEKGI--GFIKCKVIAGISIADRKGISFP  162 (480)
Q Consensus        85 i~l~~G~~v~l~~~~~~~~~~~i~i~y~~l~~~ik~Gd~I~idDG~i~l~V~~~~~--~~i~c~V~~gG~l~s~Kgvnip  162 (480)
                      ++|++|++++|+.++..++++.++++|++|++++++||.|++|||.+.|+|.+++.  +.+.|+|++||.|+++||||+|
T Consensus        83 i~L~~G~~v~l~~~~~~g~~~~i~v~y~~l~~~v~~Gd~IlidDG~i~l~v~~v~~~~~~i~~~V~~gG~L~~~KgVn~P  162 (587)
T 2e28_A           83 IELKEGSKLVISMSEVLGTPEKISVTYPSLIDDVSVGAKILLDDGLISLEVNAVDKQAGEIVTTVLNGGVLKNKKGVNVP  162 (587)
T ss_dssp             BCCCSSCEEEEESSCCCCCSSEEEBSCTTSTTTCCTTCEEEETTTTEEEEEEEEETTTTEEEEECCSCCCBCSSCBEECT
T ss_pred             EEECCCCEEEEECCCCCCCCCEEECCCHHHHHHCCCCCEEEEECCCEEEEEEEEECCCCEEEEEECCCEEECCCCEEECC
T ss_conf             89658999999568868976789745088797667998799944836999999715653899997303598699716527


Q ss_pred             CCCCCCCCCCHHHHHHHHHHHHCCCCCEECCCCCCCCHHHHHHHHHHHCC---CCEEEEEECCHHHHHHHHHHHHHHHEE
Q ss_conf             85445556765567789988734885325058557734799999862003---433555327856631178887533124
Q gi|254780442|r  163 DTFLTTQALTQKDREDLHAALQTCEVDWVALSFIQSADDLLEIRKIISQN---KIGLMSKIEKPRAIEYASEIIQLSDAV  239 (480)
Q Consensus       163 ~~~i~l~~ltekD~~di~~a~~~~~vD~ialSfVr~~~di~~~r~~l~~~---~~~IiaKIE~~~al~nl~eI~~~sDgi  239 (480)
                      |..+++|+||+||++||+||+++ ++||||+||||+++||.++|++|.+.   +++||||||+++|++|||||+++||||
T Consensus       163 ~~~~~lp~lTekD~~di~f~~~~-~vD~ialSFVr~a~DV~~iR~~l~~~~~~~i~IIAKIE~~~av~NldeIi~~sDGI  241 (587)
T 2e28_A          163 GVKVNLPGITEKDRADILFGIRQ-GIDFIAASFVRRASDVLEIRELLEAHDALHIQIIAKIENEEGVANIDEILEAADGL  241 (587)
T ss_dssp             TSCCCCCSCCHHHHHHHHHHHHH-TCSEEEESSCCSHHHHHHHHHHHHHTTCTTSEEEEEECSHHHHHTHHHHHHHSSEE
T ss_pred             CCCCCCCCCCHHHHHHHHHHHHC-CCCEEEECCCCCHHHHHHHHHHHHHHCCCCCCEEEEEECCHHHHHHHHHHHHCCEE
T ss_conf             98678733445459999876123-89899856768635699999877652166665578970545776599988756589


Q ss_pred             EEECCCCCHHCCHHHHHHHHHHHHHHHHHCCCEEEEEHHHHHHHHHCCCCCHHHHHHHHHHHHCCCCEEEECCCCCCCCC
Q ss_conf             75222200215876736899999999851398399805767888828898403477899998519968998144435446
Q gi|254780442|r  240 MVARGDLGVEMALELIPGIQKKLIRIARQLGKPVVIATQMLESMVTSPFPTRAEVSDVATAVFEEADAIMLSAETASGSY  319 (480)
Q Consensus       240 miaRGDLg~e~~~e~vp~~Qk~ii~~~~~~~kpvivATq~leSM~~~p~PTRaEv~Dvanav~dG~D~imLs~ETa~G~y  319 (480)
                      ||||||||+|+|+|+||.+||+||++||++|||||+||||||||++||+|||||++||||||+||+||+|||+|||+|+|
T Consensus       242 MVARGDLGvEip~e~VP~vQK~II~kc~~~gKPVI~ATQMLeSMi~nprPTRAEvsDVANAV~DGtDavMLSgETA~G~y  321 (587)
T 2e28_A          242 MVARGDLGVEIPAEEVPLIQKLLIKKSNMLGKPVITATQMLDSMQRNPRPTRAEASDVANAIFDGTDAVMLSGETAAGQY  321 (587)
T ss_dssp             EEEHHHHHHHSCGGGHHHHHHHHHHHHHHHTCCEEEESSSSGGGGTCSSCCHHHHHHHHHHHHHTCSEEEESHHHHTCSC
T ss_pred             EEECCCCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEEHHHHHHHHHCCCCCCHHHHHHHHHHHCCCCEEEECCCCCCCCC
T ss_conf             99766631328999989999999999998199599816877767528999744567799998637856887465446758


Q ss_pred             HHHHHHHHHHHHHHHHCCHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCHHHHHHHHHHCCCCCEEE
Q ss_conf             58999999998876301012444444320387888878999999998610478689997088379999984188886999
Q gi|254780442|r  320 PVDAVRTMSLVASSAERDSSWLEMRSLRRIEPNETGADVISSAARQIAETLRLSAIFCYTASGATGLRAARERPKLEIIA  399 (480)
Q Consensus       320 P~~~v~~~~~i~~~~E~~~~~~~~~~~~~~~~~~~~~~aIa~aav~lA~~l~a~aIiv~T~sG~tA~~iS~~RP~~pIia  399 (480)
                      |+++|++|++||+++|++.++.............+.++++|.||+++|++++|++|+++|+||+||+++|||||++||+|
T Consensus       322 PveaV~~m~~I~~~aE~~~~~~~~~~~~~~~~~~~~~~aia~aa~~~A~~l~a~aIv~~T~SG~TAr~iSk~RP~~PIiA  401 (587)
T 2e28_A          322 PVEAVKTMHQIALRTEQALEHRDILSQRTKESQTTITDAIGQSVAHTALNLDVAAIVTPTVSGKTPQMVAKYRPKAPIIA  401 (587)
T ss_dssp             HHHHHHHHHHHHHHHHTTCCHHHHHHHHHTTCCCCHHHHHHHHHHHHHHHTTCSEEEEECSSSHHHHHHHHTCCSSCEEE
T ss_pred             HHHHHHHHHHHHHHHHHHCCHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHCCCCCEEE
T ss_conf             78999999999999985002345555420355687799999999999864899889998899779999983395998999


Q ss_pred             EECCHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCEEEEEEEECCCCCCCCCEEEEEEECHHHCCC
Q ss_conf             92998999876665393799936879999999999999998888778877999852227888864159999945041157
Q gi|254780442|r  400 LSPMIQTARRLALVWGIHCVVTEDASDSDDMVNRACRIVVEQGFGKPGDRIIISAGLPLGTPGSTNMLRIAYIGADGLSG  479 (480)
Q Consensus       400 iT~~~~t~r~l~L~~GV~p~~~~~~~~~~~~i~~a~~~l~~~g~i~~GD~VVvv~G~p~~~~G~TN~irv~~Vg~~~~~g  479 (480)
                      +|++++++|||+|+|||+|+++++.++.+++++.++++++++|++++||.||+|+|+|.|.+|+||+|||++||+.+.+|
T Consensus       402 ~T~~~~~~R~L~L~wGV~p~~~~~~~~~d~~i~~a~~~~~~~g~v~~GD~VVvtaG~p~g~~G~TN~ikV~~Vg~~l~~g  481 (587)
T 2e28_A          402 VTSNEAVSRRLALVWGVYTKEAPHVNTTDEMLDVAVDAAVRSGLVKHGDLVVITAGVPVGETGSTNLMKVHVISDLLAKG  481 (587)
T ss_dssp             EESSHHHHHHGGGSTTEEEEECCCCCSHHHHHHHHHHHHHHHTCCCTTCEEEEEECSSCSSCCCCCEEEEEECSCEEEEC
T ss_pred             ECCCHHHHHHHHECCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCCCCCEEEEEECCCCCCCCCCEEEEEEEEHHHHHCC
T ss_conf             85998999876450680798778889999999999999997698789598999834569989877599999931225367


Q ss_pred             C
Q ss_conf             9
Q gi|254780442|r  480 M  480 (480)
Q Consensus       480 ~  480 (480)
                      .
T Consensus       482 ~  482 (587)
T 2e28_A          482 Q  482 (587)
T ss_dssp             E
T ss_pred             E
T ss_conf             0



>3gr4_A Pyruvate kinase isozymes M1/M2; activator, acetylation, allosteric enzyme, alternative splicing, glycolysis, magnesium, metal-binding; HET: FBP TLA DYY ADP; 1.60A {Homo sapiens} PDB: 3gqy_A* 3h6o_A* 3me3_A* 1zjh_A 3g2g_A 1t5a_A* 3bjt_A 3bjf_A* 1f3x_A 3n25_A 1f3w_A 1a49_A* 1a5u_A* 1aqf_A* 1pkm_A 2g50_A* 1pkn_A 2vgb_A* 2vgf_A* 2vgg_A* ... Back     alignment and structure
>3ma8_A Pyruvate kinase; parasitology, pyruvate kiase, glycol kinase, magnesium, transferase, structural genomi structural genomics consortium; HET: CIT; 2.64A {Cryptosporidium parvum} Back     alignment and structure
>3gg8_A Pyruvate kinase; malaria, genomics, proteomics, glycolysis, magnesium, transferase, structural genomics, structural genomics consortium, SGC; 2.21A {Toxoplasma gondii} PDB: 3eoe_A Back     alignment and structure
>1e0t_A Pyruvate kinase, PK; phosphotransferase, glycolysis, allostery; 1.8A {Escherichia coli} SCOP: b.58.1.1 c.1.12.1 c.49.1.1 PDB: 1pky_A 1e0u_A Back     alignment and structure
>3khd_A Pyruvate kinase; malaria, structural genomics, structural genomics consortium, SGC; 2.70A {Plasmodium falciparum 3D7} Back     alignment and structure
>3hqn_D Pyruvate kinase, PK; TIM barrel, T-state enzyme, transferase, allosteric enzyme, binding, glycolysis, magnesium, metal-binding, NUCL binding; 2.00A {Leishmania mexicana} PDB: 1pkl_A 3hqo_K* 3hqp_A* 3hqq_A* 3is4_A* 3ktx_A* 3e0w_A 3e0v_A Back     alignment and structure
>1a3w_A Pyruvate kinase; allosteric regulation, tranferase, transferase; HET: FBP; 3.00A {Saccharomyces cerevisiae} SCOP: b.58.1.1 c.1.12.1 c.49.1.1 PDB: 1a3x_A Back     alignment and structure
>1izc_A Macrophomate synthase intermolecular diels- alderase; TIM-barrel, pyruvate Mg(II) complex, lyase; 1.70A {Macrophoma commelinae} SCOP: c.1.12.5 Back     alignment and structure
>2v5j_A 2,4-dihydroxyhept-2-ENE-1,7-dioic acid aldolase; lyase, class II aldolase, homoprotocatechuate, aromatic degradation; 1.60A {Escherichia coli} PDB: 2v5k_A Back     alignment and structure
>2vws_A YFAU, 2-keto-3-deoxy sugar aldolase; lyase, escherichia coli K-12 protein YFAU, degradation of homoprotocatechuate, class II aldolase; 1.39A {Escherichia coli} PDB: 2vwt_A Back     alignment and structure
>1dxe_A 2-dehydro-3-deoxy-galactarate aldolase; class II aldolase; 1.8A {Escherichia coli} SCOP: c.1.12.5 PDB: 1dxf_A Back     alignment and structure
>1sgj_A Citrate lyase, beta subunit; trimer, TIM barrel, structural genomics, PSI, protein structure initiative; 1.84A {Deinococcus radiodurans} SCOP: c.1.12.5 Back     alignment and structure
>1u5h_A CITE; TIM barrel, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC, lyase; 1.65A {Mycobacterium tuberculosis} SCOP: c.1.12.5 PDB: 1u5v_A* 1z6k_A Back     alignment and structure
>3cux_A Malate synthase; TIM barrel, glyoxylate bypass, transferase, tricarboxylic acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>3khj_A Inosine-5-monophosphate dehydrogenase; enzyme-inhibitor complex, oxidoreductase; HET: IMP C64; 2.80A {Cryptosporidium parvum} Back     alignment and structure
>2wqd_A Phosphoenolpyruvate-protein phosphotransferase; kinase, cytoplasm, transport, magnesium, PEP- utilising enzyme, phosphotransferase system; 2.40A {Staphylococcus aureus} PDB: 2hro_A Back     alignment and structure
>3ffs_A Inosine-5-monophosphate dehydrogenase; beta-alpha barrel, TIM fold, oxidoreductase; 3.19A {Cryptosporidium parvum} Back     alignment and structure
>2bg5_A Enzyme I, phosphoenolpyruvate-protein kinase; phosphotransferase system, thermophilic, bacteria, PEP-utilising enzyme; 1.82A {Thermoanaerobacter tengcongensis} Back     alignment and structure
>2hwg_A Phosphoenolpyruvate-protein phosphotransferase; enzyme I, phosphoenolpyruvate:sugar phosphotransferase system, PTS; HET: NEP; 2.70A {Escherichia coli} PDB: 2kx9_A 2xdf_A Back     alignment and structure