254780445

254780445

isoleucyl-tRNA synthetase

GeneID in NCBI database:8209431Locus tag:CLIBASIA_01650
Protein GI in NCBI database:254780445Protein Accession:YP_003064858.1
Gene range:+(354946, 357837)Protein Length:963aa
Gene description:isoleucyl-tRNA synthetase
COG prediction:[J] Isoleucyl-tRNA synthetase
KEGG prediction:ileS; isoleucyl-tRNA synthetase (EC:6.1.1.5); K01870 isoleucyl-tRNA synthetase [EC:6.1.1.5]
SEED prediction:Isoleucyl-tRNA synthetase (EC 6.1.1.5)
Pathway involved in KEGG:Valine, leucine and isoleucine biosynthesis [PATH:las00290]
Aminoacyl-tRNA biosynthesis [PATH:las00970]
Subsystem involved in SEED:tRNA aminoacylation, Ile
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960---
MNSESKANYSGTLYLPRTDFPMRAKLPQKESELITYWQKIRLFDKIRESAVGRKNFTLHDGPPYANGHIHIGHALNKILKDVIVRSFQMRNFNACFVPGWDCHGLPIEWKVENEYLAKGKKKDDIPVNEFRQACRDSASAWVKIQSKEFQRLGIVGDFENPYTTMTRESEAQIASELLKIAESDQIYRGIKPIMWSIAEQTTLAEAEIEYHDVDSDSILVGFPVKSSADYLIKSQIVIWTTTPWTIPGNRAIAFSSNHQYGLYDVISCSGQHTFDTGKKLIISKNLAQSIANQTNVKIALVCDVKAEDLSKTMCSHPLKKLGYTFSVPLIDAEYVANDCGTGFVHVAPSHGVEDFTAWNEAKDILLNRSVDIKVPSPVDGRGFYTTEAPGFSGARVLDDAGEKGNANEVVIAALINACAILNRSIVKHSYPHSWRSKKPIIFRTTSQWFLHMDKKLGDGSTLRSRALSEVEKIRFFPSSGKNRLRSMIENRPDWLLSRQRNWGVPICFFYNEKGEILLDKAINDRIIKTFKDQGSDAWFSEGSRDFFLGDRASEPWIQSKDILDVWFDSACTHTILLGKDPKLAWPADVYLEGSDQHRGWFQHSLLESCATRGSTPFTSLITHGFSVDENGEKMSKSKGNVVFPEEIISESGADVLRYWAVNSDYHDDQRLGKNIIQTNIDTYRKLRNTIRWMLGMLAHDTGNEPSLADMPALEQLMLHRLTELDQVVREAYDAFNFKEVVRQLTNFSNAELSSFYFDIRKDSLYCDSPSSLKRLSSIAVIRILCRHLIIWIAPILPFTAEEAWLSLNPEAVSVHLELFPIIPLEWQNACLSKKWGKILQLRKVVTSALEIERKAKHIGSSLETAPTLYITDSSLISNIEGENLAEICITSDITIVHSNGPTDAFRLSDVPNVSVQCLKAEGKKCARSWRVTKDVGLDASYPDVSARDAAVLHELGYPKNSNV
cccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccccccccccEEEEEEccccccccccHHHHHHHHHHHHHHHHHHHcccEEEEcccccHHHHHHHHHHHHHcccccccHHHccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHcccEEEccEEEEccHHHcHHHHHHHHHHccccccEEEEEEEcccccccccccEEEEEEcccccccccEEEEEcccccEEEEEccccccccccccccEEEEHHHHHHHHHHHccccccccccccHHHHcccEEEccccccccccccEEEEccccccccccEEEEccccccHHHHHHHHHHcccHHHHcccccccccccccccccccccccccccEEcccccccccHHHHHHHHHHcccccccccccccccccccccccEEEEEccccEEEcccccccccHHHHHHHHHHHcccEEcccHHHHHHHHHHcccccEEEEEcccccEEEEEEccccccccccHHHHHHHHHHccccccccccccccccccccccccccccccccccEEEccccccHHHccccHHHccccEEEEEcHHHcHHHHHHHHHHHHHHcccccHHHEEEEccEEcccccEEEEcccccccHHHHHHHccHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHcHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHcccccccccccccccccHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEcccHHHHHHHccccHHHHHEEccEEEEcccccccHHHHccccccEEEEEcccccccccccccccHHccccccccccHHHHHHHHHccccccccc
cccccccccHHHcccccccccccccHHHHHHHHHHHHHHccHHHHHHHHcccccEccEEccccEccccccHHHHHHHHHHHHHHHHHHccccEcccccEEEcccHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEcccHHHHHHHHHHHHHHHHcccEEEEEEEEEEEccccEEccHHHEEEEEEEEEEEEccEcccccccccccccEccEEccHHHccccEccccccccccccccccccccccccccccEEEEHHHHHHHHHHHcccEEEEEEEEcHHHHHEEEEccccccccccccccEEEcccEEcccccccEEccccccHHHHHHccccHcEEEEEcccccccccccccccEccccccccccEEcccccccccHHHccHHHccHHHHccccEEEEEEEEEEcccccEcEEEEEEEEEEcHHHcccccHHHHHHHHHHHHccEEccHHHHHHHHHHHHHcccEEcEEccccccEcccEEcccccEEccHHHHHHHHHHHHHHccHHHHHccHHHHcccccccccEEEcccEEcHHHHHHcHHHHcccccccccccEcEEEEEHHHHccHHHHHHHHHHHHHccccEcEEEEEccEEccccccccccccccccHHHHHHHccHHHHHHHHHcccccccEEccHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHcccHHHccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHccccccEEEHcccccccHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEEcccHHHHHHHccHHHHEEEEEEcEEEccccccccHcHHccccccEEEEEEcccccccccEEEccccccccccccHHHHHHHHHHHccccccccc
mnseskanysgtlylprtdfpmraklpqkeSELITYWQKIRLFDKIREsavgrknftlhdgppyanghihIGHALNKILKDVIVRSFQmrnfnacfvpgwdchglpieWKVENEYLakgkkkddipvnEFRQACRDSASAWVKIQSKEFqrlgivgdfenpyttmtrESEAQIASELLKIAESDQIYRGIKPIMWSIAEQTTLAEAEIEyhdvdsdsilvgfpvkssadyLIKSQIVIwtttpwtipgnraiafssnhqyglydviscsgqhtfdtgkKLIISKNLAQSIANQTNVKIALVCDVkaedlsktmcshplkklgytfsvplidaeyvandcgtgfvhvapshgvedftawNEAKDIllnrsvdikvpspvdgrgfytteapgfsgarvlddagekgnANEVVIAALINACAILNRSIvkhsyphswrskkpiifrTTSQWFLHmdkklgdgstlRSRALSEVEKIRFFPSSGKNRLRSMIENRpdwllsrqrnwgvpicffynekgeillDKAINDRIIKTFKdqgsdawfsegsrdfflgdrasepwiqskdiLDVWFDSACThtillgkdpklawpadvylegsdqhrgwfqHSLLEscatrgstpftslithgfsvdengekmskskgnvvfpeeiisesGADVLRYWAvnsdyhddqrlgKNIIQTNIDTYRKLRNTIRWMLGMLahdtgnepsladmPALEQLMLHRLTELDQVVREAYDAFNFKEVVRQLTNFsnaelssfyfdirkdslycdspsslkrlSSIAVIRILCRHLIIWiapilpftaeEAWLSLNPEAVSVHlelfpiiplewqnaclskkwgkILQLRKVVTSALEIERKAKHIgssletaptlyitdsslisniegenlaeicitsditivhsngptdafrlsdvpnvSVQCLKAEgkkcarswrvtkdvgldasypdvsarDAAVlhelgypknsnv
mnseskanysgtlylprtdfpmraklPQKESELITYWQKIRLFDKIRESAVGRKNFTLHDGPPYANGHIHIGHALNKILKDVIVRSFQMRNFNACFVPGWDCHGLPIEWKVENEYLAKgkkkddipvNEFRQACRDSASAWVKIQSkefqrlgivgdFENPYTTMTRESEAQIASELLKIAESDQIYRGIKPIMWSIAEQTTLAEAEIEYHDVDSDSILVGFPVKSSADYLIKSQIVIWTTTPWTIPGNRAIAFSSNHQYGLYDVISCSGQHTFDTGKKLIISKNLAQSIANQTNVKIALVCDVKAEDLSKTMCSHPLKKLGYTFSVPLIDAEYVANDCGTGFVHVAPSHGVEDFTAWNEAKDILLNRSVDIKVPSPVDGRGFYTTEAPGFSGARVLDDAGEKGNANEVVIAALINACAILNRSIVKHsyphswrskkpIIFRTTSQWFLHMDKKLGDGSTLrsralsevekirffpssgknrlrSMIENRpdwllsrqrnWGVPICFFYNEKGEILLDKAINDRIIKTFkdqgsdawfSEGSRDFFLGDRASEPWIQSKDILDVWFDSACTHTILLGKDPKLAWPADVYLEGSDQHRGWFQHSLLESCATRGSTPFTSLITHgfsvdengekmsKSKGNVVFPEEIISESGADVLRYWAVNSdyhddqrlgkniiqtnidtYRKLRNTIRWMLGMLAHDTGNEPSLADMPALEQLMLHRLTELDQVVREAYDAFNFKEVVRQLTNFSNAELSSFYFDIRKDSLYCDSPSSLKRLSSIAVIRILCRHLIIWIAPILPFTAEEAWLSLNPEAVSVHLELFPIIPLEWQNACLSKKWGKILQLRKVVTSALEIERkakhigssletaptlYITDSSLISNIEGENLAEICITSDITIVHSNGPTDAFRLSDVPNVSVQCLKaegkkcarswrvtkdvgldasypdvsARDAAVlhelgypknsnv
MNSESKANYSGTLYLPRTDFPMRAKLPQKESELITYWQKIRLFDKIRESAVGRKNFTLHDGPPYANGHIHIGHALNKILKDVIVRSFQMRNFNACFVPGWDCHGLPIEWKVENEYLAKGKKKDDIPVNEFRQACRDSASAWVKIQSKEFQRLGIVGDFENPYTTMTRESEAQIASELLKIAESDQIYRGIKPIMWSIAEQTTLAEAEIEYHDVDSDSILVGFPVKSSADYLIKSQIViwtttpwtipGNRAIAFSSNHQYGLYDVISCSGQHTFDTGKKLIISKNLAQSIANQTNVKIALVCDVKAEDLSKTMCSHPLKKLGYTFSVPLIDAEYVANDCGTGFVHVAPSHGVEDFTAWNEAKDILLNRSVDIKVPSPVDGRGFYTTEAPGFSGARVLDDAGEKGNANEVViaalinacailnRSIVKHSYPHSWRSKKPIIFRTTSQWFLHMDKKLGDGSTLRSRALSEVEKIRFFPSSGKNRLRSMIENRPDWLLSRQRNWGVPICFFYNEKGEILLDKAINDRIIKTFKDQGSDAWFSEGSRDFFLGDRASEPWIQSKDILDVWFDSACTHTILLGKDPKLAWPADVYLEGSDQHRGWFQHSLLESCATRGSTPFTSLITHGFSVDENGEKMSKSKGNVVFPEEIISESGADVLRYWAVNSDYHDDQRLGKNIIQTNIDTYRKLRNTIRWMLGMLAHDTGNEPSLADMPALEQLMLHRLTELDQVVREAYDAFNFKEVVRQLTNFSNAELSSFYFDIRKDSLYCDSPSSLKRLSSIAVIRILCRHLIIWIAPILPFTAEEAWLSLNPEAVSVHLELFPIIPLEWQNACLSKKWGKILQLRKVVTSALEIERKAKHIGSSLETAPTLYITDSSLISNIEGENLAEICITSDITIVHSNGPTDAFRLSDVPNVSVQCLKAEGKKCARSWRVTKDVGLDASYPDVSARDAAVLHELGYPKNSNV
******A*YSGTLYLPRTDFPMRAKLPQKESELITYWQKIRLFDKIRESAVGRKNFTLHDGPPYANGHIHIGHALNKILKDVIVRSFQMRNFNACFVPGWDCHGLPIEWKVENEYLA*****DDIPVNEFRQACRDSASAWVKIQSKEFQRLGIVGDFENPYTTMTRESEAQIASELLKIAESDQIYRGIKPIMWSIAEQTTLAEAEIEYHDVDSDSILVGFPVKSSADYLIKSQIVIWTTTPWTIPGNRAIAFSSNHQYGLYDVISCSGQHTFDTGKKLIISKNLAQSIANQTNVKIALVCDVKAEDLSKTMCSHPLKKLGYTFSVPLIDAEYVANDCGTGFVHVAPSHGVEDFTAWNEAKDILLNRSVDIKVPSPVDGRGFYTTEAPGFSGARVLDDAGEKGNANEVVIAALINACAILNRSIVKHSYPHSWRSKKPIIFRTTSQWFLHMDKKLGDGSTLRSRALSEVEKIRFFPSSGKNRLRSMIENRPDWLLSRQRNWGVPICFFYNEKGEILLDKAINDRIIKTFKDQGSDAWFSEGSRDFFLGDRASEPWIQSKDILDVWFDSACTHTILLGKDPKLAWPADVYLEGSDQHRGWFQHSLLESCATRGSTPFTSLITHGFSVDENGEKMSKSKGNVVFPEEIISESGADVLRYWAVNSDYHDDQRLGKNIIQTNIDTYRKLRNTIRWMLGMLAHDTGNEPSLADMPALEQLMLHRLTELDQVVREAYDAFNFKEVVRQLTNFSNAELSSFYFDIRKDSLYCDSPSSLKRLSSIAVIRILCRHLIIWIAPILPFTAEEAWLSLNPEAVSVHLELFPIIPLEWQNACLSKKWGKILQLRKVVTSALEIERKAKHIGSSLETAPTLYITDSSLISNIEGENLAEICITSDITIVHSNGPTDAFRLSDVPNVSVQCLKAEGKKCARSWRVTKDVGLDASYPDVSARDAAVLHEL********
*********SGTLYLPRTDFPMRAKLPQKESELITYWQKIRLFDKIRESAVGRKNFTLHDGPPYANGHIHIGHALNKILKDVIVRSFQMRNFNACFVPGWDCHGLPIEWKVENEYLAKGKKKDDIPVNEFRQACRDSASAWVKIQSKEFQRLGIVGDFENPYTTMTRESEAQIASELLKIAESDQIYRGIKPIMWSIAEQTTLAEAEIEYHDVDSDSILVGFPVKSSADYLIKSQIVIWTTTPWTIPGNRAIAFSSNHQYGLYDVISCSGQHTFDTGKKLIISKNLAQSIANQTNVKIALVCDVKAEDLSKTMCSHPLKKLGYTFSVPLIDAEYVANDCGTGFVHVAPSHGVEDFTAWNEAKDILLNRSVDIKVPSPVDGRGFYTTEAPGFSGARVLDDAGEKGNANEVVIAALINACAILNRSIVKHSYPHSWRSKKPIIFRTTSQWFLHMDKKLGDGSTLRSRALSEVEKIRFFPSSGKNRLRSMIENRPDWLLSRQRNWGVPICFFYNEKGEILLDKAINDRIIKTFKDQGSDAWFSEGSRDFFLGDRASEPWIQSKDILDVWFDSACTHTILLGKDPKLAWPADVYLEGSDQHRGWFQHSLLESCATRGSTPFTSLITHGFSVDENGEKMSKSKGNVVFPEEIISESGADVLRYWAVNSDYHDDQRLGKNIIQTNIDTYRKLRNTIRWMLGMLAHDTGNEPSLADMPALEQLMLHRLTELDQVVREAYDAFNFKEVVRQLTNFSNAELSSFYFDIRKDSLYCDSPSSLKRLSSIAVIRILCRHLIIWIAPILPFTAEEAWLSLNPEAVSVHLELFPIIPLEWQNACLSKKWGKILQLRKVVTSALEIERKAKHIGSSLETAPTLYITDSSLISNIEGENLAEICITSDITIVHSNGPTDAFRLSDVPNVSVQCLKAEGKKCARSWRVTKDVGLDASYPDVSARDAAVLHELGYPKNSNV
*****KANYSGTLYLPRTDFPMRAKLPQKESELITYWQKIRLFDKIRESAVGRKNFTLHDGPPYANGHIHIGHALNKILKDVIVRSFQMRNFNACFVPGWDCHGLPIEWKVENEYLAKGKKKDDIPVNEFRQACRDSASAWVKIQSKEFQRLGIVGDFENPYTTMTRESEAQIASELLKIAESDQIYRGIKPIMWSIAEQTTLAEAEIEYHDVDSDSILVGFPVKSSADYLIKSQIVIWTTTPWTIPGNRAIAFSSNHQYGLYDVISCSGQHTFDTGKKLIISKNLAQSIANQTNVKIALVCDVKAEDLSKTMCSHPLKKLGYTFSVPLIDAEYVANDCGTGFVHVAPSHGVEDFTAWNEAKDILLNRSVDIKVPSPVDGRGFYTTEAPGFSGARVLDDAGEKGNANEVVIAALINACAILNRSIVKHSYPHSWRSKKPIIFRTTSQWFLHMDKKLGDGSTLRSRALSEVEKIRFFPSSGKNRLRSMIENRPDWLLSRQRNWGVPICFFYNEKGEILLDKAINDRIIKTFKDQGSDAWFSEGSRDFFLGDRASEPWIQSKDILDVWFDSACTHTILLGKDPKLAWPADVYLEGSDQHRGWFQHSLLESCATRGSTPFTSLITHGFSVDENGEKMSKSKGNVVFPEEIISESGADVLRYWAVNSDYHDDQRLGKNIIQTNIDTYRKLRNTIRWMLGMLAHDTGNEPSLADMPALEQLMLHRLTELDQVVREAYDAFNFKEVVRQLTNFSNAELSSFYFDIRKDSLYCDSPSSLKRLSSIAVIRILCRHLIIWIAPILPFTAEEAWLSLNPEAVSVHLELFPIIPLEWQNACLSKKWGKILQLRKVVTSALEIERKAKHIGSSLETAPTLYITDSSLISNIEGENLAEICITSDITIVHSNGPTDAFRLSDVPNVSVQCLKAEGKKCARSWRVTKDVGLDASYPDVSARDAAVLHELGYP*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNSESKANYSGTLYLPRTDFPMRAKLPQKESELITYWQKIRLFDKIRESAVGRKNFTLHDGPPYANGHIHIGHALNKILKDVIVRSFQMRNFNACFVPGWDCHGLPIEWKVENEYLAKGKKKDDIPVNEFRQACRDSASAWVKIQSKEFQRLGIVGDFENPYTTMTRESEAQIASELLKIAESDQIYRGIKPIMWSIAEQTTLAEAEIEYHDVDSDSILVGFPVKSSADYLIKSQIVIWTTTPWTIPGNRAIAFSSNHQYGLYDVISCSGQHTFDTGKKLIISKNLAQSIANQTNVKIALVCDVKAEDLSKTMCSHPLKKLGYTFSVPLIDAEYVANDCGTGFVHVAPSHGVEDFTAWNEAKDILLNRSVDIKVPSPVDGRGFYTTEAPGFSGARVLDDAGEKGNANEVVIAALINACAILNRSIVKHSYPHSWRSKKPIIFRTTSQWFLHMDKKLGDGSTLRSRALSEVEKIRFFPSSGKNRLRSMIENRPDWLLSRQRNWGVPICFFYNEKGEILLDKAINDRIIKTFKDQGSDAWFSEGSRDFFLGDRASEPWIQSKDILDVWFDSACTHTILLGKDPKLAWPADVYLEGSDQHRGWFQHSLLESCATRGSTPFTSLITHGFSVDENGEKMSKSKGNVVFPEEIISESGADVLRYWAVNSDYHDDQRLGKNIIQTNIDTYRKLRNTIRWMLGMLAHDTGNEPSLADMPALEQLMLHRLTELDQVVREAYDAFNFKEVVRQLTNFSNAELSSFYFDIRKDSLYCDSPSSLKRLSSIAVIRILCRHLIIWIAPILPFTAEEAWLSLNPEAVSVHLELFPIIPLEWQNACLSKKWGKILQLRKVVTSALEIERKAKHIGSSLETAPTLYITDSSLISNIEGENLAEICITSDITIVHSNGPTDAFRLSDVPNVSVQCLKAEGKKCARSWRVTKDVGLDASYPDVSARDAAVLHELGYPKNSNV
MNSESKANYSGTLYLPRTDFPMRAKLPQKESELITYWQKIRLFDKIRESAVGRKNFTLHDGPPYANGHIHIGHALNKILKDVIVRSFQMRNFNACFVPGWDCHGLPIEWKVENEYLAKGKKKDDIPVNEFRQACRDSASAWVKIQSKEFQRLGIVGDFENPYTTMTRESEAQIASELLKIAESDQIYRGIKPIMWSIAEQTTLAEAEIEYHDVDSDSILVGFPVKSSADYLIKSQIVIWTTTPWTIPGNRAIAFSSNHQYGLYDVISCSGQHTFDTGKKLIISKNLAQSIANQTNVKIALVCDVKAEDLSKTMCSHPLKKLGYTFSVPLIDAEYVANDCGTGFVHVAPSHGVEDFTAWNEAKDILLNRSVDIKVPSPVDGRGFYTTEAPGFSGARVLDDAGEKGNANEVVIAALINACAILNRSIVKHSYPHSWRSKKPIIFRTTSQWFLHMDKKLGDGSTLRSRALSEVEKIRFFPSSGKNRLRSMIENRPDWLLSRQRNWGVPICFFYNEKGEILLDKAINDRIIKTFKDQGSDAWFSEGSRDFFLGDRASEPWIQSKDILDVWFDSACTHTILLGKDPKLAWPADVYLEGSDQHRGWFQHSLLESCATRGSTPFTSLITHGFSVDENGEKMSKSKGNVVFPEEIISESGADVLRYWAVNSDYHDDQRLGKNIIQTNIDTYRKLRNTIRWMLGMLAHDTGNEPSLADMPALEQLMLHRLTELDQVVREAYDAFNFKEVVRQLTNFSNAELSSFYFDIRKDSLYCDSPSSLKRLSSIAVIRILCRHLIIWIAPILPFTAEEAWLSLNPEAVSVHLELFPIIPLEWQNACLSKKWGKILQLRKVVTSALEIERKAKHIGSSLETAPTLYITDSSLISNIEGENLAEICITSDITIVHSNGPTDAFRLSDVPNVSVQCLKAEGKKCARSWRVTKDVGLDASYPDVSARDAAVLHELGYPKNSNV
MNSESKANYSGTLYLPRTDFPMRAKLPQKESELITYWQKIRLFDKIRESAVGRKNFTLHDGPPYANGHIHIGHALNKILKDVIVRSFQMRNFNACFVPGWDCHGLPIEWKVENEYLAKGKKKDDIPVNEFRQACRDSASAWVKIQSKEFQRLGIVGDFENPYTTMTRESEAQIASELLKIAESDQIYRGIKPIMWSIAEQTTLAEAEIEYHDVDSDSILVGFPVKSSADYLIKSQIVIWTTTPWTIPGNRAIAFSSNHQYGLYDVISCSGQHTFDTGKKLIISKNLAQSIANQTNVKIALVCDVKAEDLSKTMCSHPLKKLGYTFSVPLIDAEYVANDCGTGFVHVAPSHGVEDFTAWNEAKDILLNRSVDIKVPSPVDGRGFYTTEAPGFSGARVLDDAGEKGNANEVVIAALINACAILNRSIVKHSYPHSWRSKKPIIFRTTSQWFLHMDKKLGDGSTLRSRALSEVEKIRFFPSSGKNRLRSMIENRPDWLLSRQRNWGVPICFFYNEKGEILLDKAINDRIIKTFKDQGSDAWFSEGSRDFFLGDRASEPWIQSKDILDVWFDSACTHTILLGKDPKLAWPADVYLEGSDQHRGWFQHSLLESCATRGSTPFTSLITHGFSVDENGEKMSKSKGNVVFPEEIISESGADVLRYWAVNSDYHDDQRLGKNIIQTNIDTYRKLRNTIRWMLGMLAHDTGNEPSLADMPALEQLMLHRLTELDQVVREAYDAFNFKEVVRQLTNFSNAELSSFYFDIRKDSLYCDSPSSLKRLSSIAVIRILCRHLIIWIAPILPFTAEEAWLSLNPEAVSVHLELFPIIPLEWQNACLSKKWGKILQLRKVVTSALEIERKAKHIGSSLETAPTLYITDSSLISNIEGENLAEICITSDITIVHSNGPTDAFRLSDVPNVSVQCLKAEGKKCARSWRVTKDVGLDASYPDVSARDAAVLHELGYPKNSNV

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target963 isoleucyl-tRNA synthetase [Candidatus Liberibacter asia
254780933947 valyl-tRNA synthetase [Candidatus Liberibacter asi 4e-39
254780802869 leucyl-tRNA synthetase [Candidatus Liberibacter as 2e-11
254780802869 leucyl-tRNA synthetase [Candidatus Liberibacter as 3e-08
255764461511 methionyl-tRNA synthetase [Candidatus Liberibacter 2e-09
255764461511 methionyl-tRNA synthetase [Candidatus Liberibacter 1e-04
>gi|254780933|ref|YP_003065346.1| valyl-tRNA synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 947 Back     alignment
 Score =  155 bits (391), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 196/829 (23%), Positives = 326/829 (39%), Gaps = 121/829 (14%)

Query: 30  ESELITYWQKIRLFDKIRESAVGRKNFTLHDGPPYANGHIHIGHALNKILKDVIVRSFQM 89
           E + +  W  +  F       +G   F +   PP   G +H+GHA N  ++D+++R  +M
Sbjct: 13  EQKSVEKWNSVDAFRIDVAPKLGSGVFCIAMPPPNVTGSLHMGHAFNTTIQDIMIRFERM 72

Query: 90  RNFNACFVPGWDCHGLPIEWKVENEYLAKGK-KKDDIPVNEFRQACRDSASAWVKIQS-- 146
           R  N  + PG D  G+  +  VE+   A+    ++DI     R A  +    W K     
Sbjct: 73  RGKNVLWQPGTDHAGIATQITVESRLFAQSSLTREDIG----RDAFIEKVWEWKKESGGS 128

Query: 147 --KEFQRLGIVGDFENPYTTMTRESEAQIASELLKIAESDQIYRGIKPIMWSIAEQTTLA 204
              + +RLG   D+     TM       + +  + + +   IYR  + + W  + +T+++
Sbjct: 129 ILSQLKRLGASCDWSRERFTMDEGMSNAVRNAFVVLYKDGLIYRDKRIVNWDPSLKTSVS 188

Query: 205 EAEIEYHDVDSDSILVGFPVKSSA---------------DYLIKSQIVIWTTTPWTIPGN 249
           + E+   +VD +   V +P+                   D+ ++  I++ TT P T+ G+
Sbjct: 189 DLEVIQKEVDGNLWYVRYPLVEGVTYRHPIKFDDDAKPIDWEVRDYIIVSTTRPETMFGD 248

Query: 250 RAIAFSSNHQYGLYDVISCSGQHTFDTGKKLIISKNLAQSIANQTNVKIALVCDVKAEDL 309
            AIA                  H  D   K +I K     I  +                
Sbjct: 249 VAIAV-----------------HPDDYRYKELIGKYATLPIVGRL--------------- 276

Query: 310 SKTMCSHPLKKLGYTFSVPLIDAEYVANDCGTGFVHVAPSHGVEDFTAWNEAKDILLNRS 369
                            +P++   Y   + G G V V P+H   DF     AK   L   
Sbjct: 277 -----------------IPIVSDVYPDPEFGDGAVKVTPAHDFNDFEI---AKRHGLG-F 315

Query: 370 VDIKVPSPVDGRGFYTTEAPGFSGARVLDDA---------GEKGNANEVVIAALINACAI 420
           ++I  P        + +E   F    VL D          G    A    I +L+    +
Sbjct: 316 INILTPEA----KIFLSENESFLENIVLSDEARNIFSEFEGLDCFAARSKIVSLLEKSNL 371

Query: 421 LNRS-IVKHSYPHSWRSKKPIIFRTTSQWFLHMDKKLGDGSTLRSRALSEVEKIRFFPSS 479
           L+++   +H  PH  RS   I    T QW+L  D K+   S +RS   ++   + F P S
Sbjct: 372 LDKTDSYRHIVPHCERSGVTIEPCITEQWYL--DAKVLAESAIRS---AKNGCLSFIPQS 426

Query: 480 GKNRLRSMIENRPDWLLSRQRNWGVPICFFYNEKGEILLDKAINDRI---IKTFKDQGSD 536
                   +EN   W +SRQ  WG  I  +Y+  G++ ++   +  +   I  +  Q +D
Sbjct: 427 WDKSYYEWLENIQPWCISRQIWWGHQIPVWYSPDGKLFVENTEDAALRSAIDYYLSQDND 486

Query: 537 AWFSEGSRDFFLGDRASEPWIQSKDILDVWFDSACTHTILLG-----KDPKLAWPADVYL 591
              +   R        S+   + +D+LD WF SA      LG      + K  +P  V +
Sbjct: 487 --MTVKVRKMIKDGNISDLLKRDEDVLDTWFSSALWPFASLGWPEQTAELKTYYPTSVLV 544

Query: 592 EGSDQHRGWFQHSLL------ESCATRGSTPFTSLITHGFSVDENGEKMSKSKGNVVFPE 645
            G D    W    ++      +    +G  PF  +  H    D+NG+KMSKSKGNVV P 
Sbjct: 545 TGFDILFFWVARMMMMGLYFMKDAEGKGIEPFHIVYMHALVRDKNGQKMSKSKGNVVDPI 604

Query: 646 EIISESGADVLR-YWAVNSDYHDDQRLGKNIIQTNIDTYRKLRNTIRW-MLGMLAHDTGN 703
           ++I + GAD LR Y+++ +    D  L    I    +   K  N IR+  +    H    
Sbjct: 605 DVIDQYGADALRFYFSIMAVQGRDINLDLERIAGYRNFITKFWNAIRFSKMKNARHSVSF 664

Query: 704 EPSLADMPALEQLMLHRLTELDQVVREAYDAFNFKEVVRQLTNFSNAELSSFYFDIRKDS 763
            P       + + ++ RL  +   V    +   F +V   L  F   EL  +Y +  K  
Sbjct: 665 VPQDVKW-IVNKWIIKRLATVINDVTVGMENHRFNDVSAVLYRFVWDELCDWYVEFIKSI 723

Query: 764 L-YCDSPSSLKRLSSIA-VIRILCRHLIIWIAPILPFTAEEAWLSLNPE 810
           L   DS    + LS  + V+  +C+ L     PI+PF  E+ +  ++P+
Sbjct: 724 LNQKDSELVSETLSCFSYVLYNVCKLL----HPIIPFVTEDLYSHVSPQ 768

>gi|254780802|ref|YP_003065215.1| leucyl-tRNA synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 869 Back     alignment
 Score = 63.2 bits (152), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 98/423 (23%), Positives = 157/423 (37%), Gaps = 98/423 (23%)

Query: 457 GDGSTLRSRALSEVEKIRFFPSSGKNRLRSMIENRP-----------DWLLSRQRNWGVP 505
           GDG  + S  L  +       +   +  +  I+N P           DW +SRQR+WG P
Sbjct: 384 GDGIMINSSFLDGMTNTEALQAVMSHLEKQNIKNSPIGKRKINFRLRDWCISRQRSWGCP 443

Query: 506 ICFFYNEK-GEILLDKAINDRIIKTFKD-----QGSDAWFSEGSRDFFLGDRASEPWIQS 559
           I   + +K G + L K   D  ++  +D      G+        +  F     SE  ++ 
Sbjct: 444 IPVIHCQKCGIVELPK--EDLPVQLPEDLDFTLPGNPLENHPTWKKIFCVKCGSEA-LRE 500

Query: 560 KDILDVWFDSACTHTILL---GKDP------KLAWPADVYLEGSDQ------HRGWFQHS 604
            D +D + DS+  +   +    KDP      +  +P D Y+ G +       +  +F H 
Sbjct: 501 TDTMDTFVDSSWYYMRYMTPHAKDPINKELVRQWFPVDQYIGGIEHAVLHLLYARFFAHI 560

Query: 605 LLESCATRGSTPFTSLITHGFSVDENG--------------------------------- 631
           L +        PF  L T G  V E                                   
Sbjct: 561 LKKIGYIEIDEPFKRLFTQGMVVHETYYQLEGIKKKYLKPDEVILRNIEGENCAFRLSDN 620

Query: 632 --------EKMSKSKGNVVFPEEIISESGADVLRYWAVNSDYHDDQRLGKNIIQTN--ID 681
                   EKMSKSK NV+ P ++I   GAD  R + ++    D     ++II +N  +D
Sbjct: 621 SKVVIGPLEKMSKSKKNVIDPMKVIKSYGADTARLFVLSDSPPD-----RDIIWSNKGVD 675

Query: 682 TYRKLRNTIRWMLGMLAHDTGNEPSLADMPALEQLMLHRLTELDQVVREAYDAFNFKEVV 741
           +  +    I W L   A D     S     +L    + + T+  + + E Y   +F + V
Sbjct: 676 STYQFIQQI-WRLIYNAKDELQTSSTKKDISL----ISKSTKFLERIEENYQNLSFNKAV 730

Query: 742 RQLTNFSNAELSSFYFDIRKDSLYCDSPSSLKRLSSIAVIRILCRHLIIWIAPILPFTAE 801
             +    N  +S    +I K     D          I+ IR +   LII ++P++P  AE
Sbjct: 731 ANIHELVNV-ISKPLMEIAKKKSNAD---------RISTIRYILEKLIIMMSPMIPHLAE 780

Query: 802 EAW 804
           E W
Sbjct: 781 ECW 783

>gi|254780802|ref|YP_003065215.1| leucyl-tRNA synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 869 Back     alignment
 Score = 52.8 bits (125), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 37/168 (22%), Positives = 66/168 (39%), Gaps = 30/168 (17%)

Query: 48  ESAVGRKNFTLHDGPPYANGHIHIGHALNKILKDVIVRSFQMRNFNACFVPGWDCHGLPI 107
           E+   +K + + +  PY +G+IH+GH  N ++ DV+ R  +   ++     GWD  G+P 
Sbjct: 28  ENGKNKKKYFVLEMFPYPSGNIHMGHLRNYVIGDVVARFMRASGYSVLHPMGWDAFGMPA 87

Query: 108 EWKVENEYLAKGKKKDDIPVNEFRQACRD---SASAW----VKIQSKEFQRLGIVGDFEN 160
           E                        A R+       W    +K+  K+ Q +G+  D+  
Sbjct: 88  E-----------------------NAAREHNVHPKMWTYQNIKVMRKQLQSIGLSIDWSK 124

Query: 161 PYTTMTRESEAQIASELLKIAESDQIYRGIKPIMWSIAEQTTLAEAEI 208
            + T   +         L   + + I R    + W   EQT LA  ++
Sbjct: 125 DFATCDVDYYHCQQLLFLDFMKHNVIVRKTAQVNWDPVEQTVLANEQV 172

>gi|255764461|ref|YP_003064629.2| methionyl-tRNA synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 511 Back     alignment
 Score = 56.6 bits (135), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 69/269 (25%), Positives = 115/269 (42%), Gaps = 47/269 (17%)

Query: 562 ILDVWFDSACTHTILLG--KDPKLA----WPADVYLEGSDQHRGWFQHSLLESCATRGST 615
           I+ VW D+   +    G   +P  +    WPAD+++ G D  R  F      +     + 
Sbjct: 227 IMYVWIDALTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILR--FHAIYWPAFLLSANL 284

Query: 616 PF-TSLITHGFSVDENGEKMSKSKGNVVFPEEIISESGADVLRYWAV------NSDYHDD 668
           P    + +HGF +   GEK+SKS GNV+ P E+I E G D LRY+ V         ++D 
Sbjct: 285 PLPKKVFSHGFIL-HKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGFYDK 343

Query: 669 QRLGKNIIQTNIDTYRKLRNTIRWMLGMLAHD-TGNEPSLADMPALEQLMLHRLTELDQV 727
             L K +   N D    + N +   + M+  D  G  P+       ++ +L   + + Q 
Sbjct: 344 DGLKKRV---NADLANGIGNLVSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQE 400

Query: 728 VREAYDAFNFKEVVRQLTNFSNAELSSF------YFDIRKDSLYCDSPSSLK-----RLS 776
           +RE         +  QL + + A++ S       YFD +K       P  LK     R S
Sbjct: 401 IRE--------NMQNQLIHRALAQVISLVSEVDRYFDAQK-------PWELKKTNPDRAS 445

Query: 777 SIAVIRI-LCRHLIIWIAPILPFTAEEAW 804
           ++  + + + R L I +   +P  A + +
Sbjct: 446 TVLYVTVEVIRQLAILLQAFVPKLANKIF 474

>gi|255764461|ref|YP_003064629.2| methionyl-tRNA synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 511 Back     alignment
 Score = 40.8 bits (94), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 34/158 (21%), Positives = 58/158 (36%), Gaps = 22/158 (13%)

Query: 53  RKNFTLHDGPPYANGHIHIGHALNKILKDVIVRSFQMRNFNACFVPGWDCHGLPIEWKVE 112
           R+   +     Y N   HIGHA   I+ DV+ R  ++   +  F  G D HG  I    +
Sbjct: 4   REKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQ 63

Query: 113 NEYLAKGKKKDDIPVNEFRQACRDSASAWVKIQSKEFQRLGIVGDFENPYTTMTRESEAQ 172
           N  +                    +   +V   S+ F+ +  V D        T E    
Sbjct: 64  NAGV--------------------TTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHH 103

Query: 173 IASELL--KIAESDQIYRGIKPIMWSIAEQTTLAEAEI 208
               +L  KI++   IY+G     +S+ ++    + E+
Sbjct: 104 DTCRILWKKISDKGDIYKGCYSGWYSLRDEAYYNDDEV 141

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target963 isoleucyl-tRNA synthetase [Candidatus Liberibacter asia
315122106960 isoleucyl-tRNA synthetase [Candidatus Liberibacter sola 1 0.0
222085012960 isoleucyl-tRNA synthetase protein [Agrobacterium radiob 1 0.0
15888029967 isoleucyl-tRNA synthetase [Agrobacterium tumefaciens st 1 0.0
15964550969 isoleucyl-tRNA synthetase [Sinorhizobium meliloti 1021] 1 0.0
227820993973 isoleucyl-tRNA synthetase [Sinorhizobium fredii NGR234] 1 0.0
325292070967 Isoleucyl-tRNA synthetase [Agrobacterium sp. H13-3] Len 1 0.0
150395637969 isoleucyl-tRNA synthetase [Sinorhizobium medicae WSM419 1 0.0
116250663982 isoleucyl-tRNA synthetase [Rhizobium leguminosarum bv. 1 0.0
241203267963 isoleucyl-tRNA synthetase [Rhizobium leguminosarum bv. 1 0.0
209548081963 isoleucyl-tRNA synthetase [Rhizobium leguminosarum bv. 1 0.0
>gi|315122106|ref|YP_004062595.1| isoleucyl-tRNA synthetase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 960 Back     alignment and organism information
 Score = 1602 bits (4148), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 745/960 (77%), Positives = 852/960 (88%)

Query: 1   MNSESKANYSGTLYLPRTDFPMRAKLPQKESELITYWQKIRLFDKIRESAVGRKNFTLHD 60
           MN+  K NYS TL+LP+TDFPMRA+LPQKE +LI +W++IRLFDK+RE+AV RK F LHD
Sbjct: 1   MNTSQKPNYSSTLFLPKTDFPMRAQLPQKEPKLIAHWKEIRLFDKLRENAVDRKKFVLHD 60

Query: 61  GPPYANGHIHIGHALNKILKDVIVRSFQMRNFNACFVPGWDCHGLPIEWKVENEYLAKGK 120
           GPPYANGH+HIGHALNKILKDV+VRSFQMR F+AC VPGWDCHGLPIEWKVE+EYLA+GK
Sbjct: 61  GPPYANGHLHIGHALNKILKDVVVRSFQMRGFDACLVPGWDCHGLPIEWKVESEYLAQGK 120

Query: 121 KKDDIPVNEFRQACRDSASAWVKIQSKEFQRLGIVGDFENPYTTMTRESEAQIASELLKI 180
            KD +PVNEFRQ CR+ A  WVKIQS+EF+RLG+V DFENPYTTM  +SE+ IASELLK 
Sbjct: 121 NKDIVPVNEFRQECRNYAREWVKIQSEEFERLGVVADFENPYTTMDNKSESLIASELLKF 180

Query: 181 AESDQIYRGIKPIMWSIAEQTTLAEAEIEYHDVDSDSILVGFPVKSSADYLIKSQIVIWT 240
           A + QIYRG+KP+MWSIAEQTTLAEAEIEYH+VD+DSI+VGF +KS+ DYL ++QIVIWT
Sbjct: 181 ATTHQIYRGVKPVMWSIAEQTTLAEAEIEYHNVDTDSIVVGFSIKSAPDYLREAQIVIWT 240

Query: 241 TTPWTIPGNRAIAFSSNHQYGLYDVISCSGQHTFDTGKKLIISKNLAQSIANQTNVKIAL 300
           TTPWTIPGNRAIAFSS+HQYGLY V+S    HTFD  K L++SKNLAQ IA+QT + I L
Sbjct: 241 TTPWTIPGNRAIAFSSHHQYGLYKVLSSDETHTFDIEKNLVLSKNLAQEIASQTKITIEL 300

Query: 301 VCDVKAEDLSKTMCSHPLKKLGYTFSVPLIDAEYVANDCGTGFVHVAPSHGVEDFTAWNE 360
           VC+VKAEDLSK  CSHPL+KLGYT SVPLIDA+YVAN+ GTGFVHVAPSHGV+DF  WN+
Sbjct: 301 VCEVKAEDLSKVTCSHPLEKLGYTCSVPLIDADYVANNLGTGFVHVAPSHGVDDFDIWNK 360

Query: 361 AKDILLNRSVDIKVPSPVDGRGFYTTEAPGFSGARVLDDAGEKGNANEVVIAALINACAI 420
           AK++L + S+D ++PSPVD RGFYT +APGF GARVLDD GEKGNANE VI ALINA A+
Sbjct: 361 AKNVLQSCSIDTRIPSPVDERGFYTKDAPGFVGARVLDDMGEKGNANEEVIIALINAHAL 420

Query: 421 LNRSIVKHSYPHSWRSKKPIIFRTTSQWFLHMDKKLGDGSTLRSRALSEVEKIRFFPSSG 480
           LNR ++KH YPHSWRSKKPIIFR  SQWF+H+DKKL DG TLRSRAL E++KIRFFPS+G
Sbjct: 421 LNRQVIKHLYPHSWRSKKPIIFRAISQWFIHVDKKLEDGKTLRSRALGEIDKIRFFPSAG 480

Query: 481 KNRLRSMIENRPDWLLSRQRNWGVPICFFYNEKGEILLDKAINDRIIKTFKDQGSDAWFS 540
           KNRLRSMIE RPDW+LSRQR+WGVP+C F+NE+GEILLD+++N RII+TFK+QGSDAWF+
Sbjct: 481 KNRLRSMIEQRPDWVLSRQRHWGVPVCLFFNEEGEILLDESVNRRIIETFKEQGSDAWFA 540

Query: 541 EGSRDFFLGDRASEPWIQSKDILDVWFDSACTHTILLGKDPKLAWPADVYLEGSDQHRGW 600
           E  RDFFLG+RASEPWIQS DILDVWFDSACTH I L ++PKL WPA+VYLEGSDQHRGW
Sbjct: 541 ENIRDFFLGERASEPWIQSMDILDVWFDSACTHAITLEENPKLQWPANVYLEGSDQHRGW 600

Query: 601 FQHSLLESCATRGSTPFTSLITHGFSVDENGEKMSKSKGNVVFPEEIISESGADVLRYWA 660
           FQHSLLESCATRGSTPFTSLITHGF+VDENGEKMSKSKGNV+FP+ IISESGAD+LR+W 
Sbjct: 601 FQHSLLESCATRGSTPFTSLITHGFAVDENGEKMSKSKGNVIFPDTIISESGADILRFWV 660

Query: 661 VNSDYHDDQRLGKNIIQTNIDTYRKLRNTIRWMLGMLAHDTGNEPSLADMPALEQLMLHR 720
           VNSDYHDDQRLGKNIIQTNID YRKLRNTIRWMLG+LAHDTG EPSL+D+P LE+ +LHR
Sbjct: 661 VNSDYHDDQRLGKNIIQTNIDAYRKLRNTIRWMLGVLAHDTGKEPSLSDVPELERFILHR 720

Query: 721 LTELDQVVREAYDAFNFKEVVRQLTNFSNAELSSFYFDIRKDSLYCDSPSSLKRLSSIAV 780
           +TELDQ VREAYD F+FK +VR L NFSN ELSSFYFDIRKDSLYCDSPSSLKRLSSIAV
Sbjct: 721 ITELDQTVREAYDNFDFKTIVRTLMNFSNFELSSFYFDIRKDSLYCDSPSSLKRLSSIAV 780

Query: 781 IRILCRHLIIWIAPILPFTAEEAWLSLNPEAVSVHLELFPIIPLEWQNACLSKKWGKILQ 840
           IR LCR LI+W+AP+LPFTAEEAW  L   A SVHLE FP IP EW++A LSKKW +IL+
Sbjct: 781 IRKLCRSLILWLAPMLPFTAEEAWSCLESNASSVHLEQFPTIPTEWKDAELSKKWNRILK 840

Query: 841 LRKVVTSALEIERKAKHIGSSLETAPTLYITDSSLISNIEGENLAEICITSDITIVHSNG 900
           LRKVVTSALEIERK K IGSSLET+P LYITDSSLI++IEG++LAEICITSD+T+VHS G
Sbjct: 841 LRKVVTSALEIERKEKRIGSSLETSPILYITDSSLIADIEGQDLAEICITSDVTVVHSEG 900

Query: 901 PTDAFRLSDVPNVSVQCLKAEGKKCARSWRVTKDVGLDASYPDVSARDAAVLHELGYPKN 960
           P+DAFRL  V  VS++C KA GKKCARSWR+T+DVG D+SYPDVSARDAAVLHELGYPKN
Sbjct: 901 PSDAFRLLGVSQVSIECKKAIGKKCARSWRITQDVGSDSSYPDVSARDAAVLHELGYPKN 960


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222085012|ref|YP_002543541.1| isoleucyl-tRNA synthetase protein [Agrobacterium radiobacter K84] Length = 960 Back     alignment and organism information
>gi|15888029|ref|NP_353710.1| isoleucyl-tRNA synthetase [Agrobacterium tumefaciens str. C58] Length = 967 Back     alignment and organism information
>gi|15964550|ref|NP_384903.1| isoleucyl-tRNA synthetase [Sinorhizobium meliloti 1021] Length = 969 Back     alignment and organism information
>gi|227820993|ref|YP_002824963.1| isoleucyl-tRNA synthetase [Sinorhizobium fredii NGR234] Length = 973 Back     alignment and organism information
>gi|325292070|ref|YP_004277934.1| Isoleucyl-tRNA synthetase [Agrobacterium sp. H13-3] Length = 967 Back     alignment and organism information
>gi|150395637|ref|YP_001326104.1| isoleucyl-tRNA synthetase [Sinorhizobium medicae WSM419] Length = 969 Back     alignment and organism information
>gi|116250663|ref|YP_766501.1| isoleucyl-tRNA synthetase [Rhizobium leguminosarum bv. viciae 3841] Length = 982 Back     alignment and organism information
>gi|241203267|ref|YP_002974363.1| isoleucyl-tRNA synthetase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 963 Back     alignment and organism information
>gi|209548081|ref|YP_002279998.1| isoleucyl-tRNA synthetase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 963 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target963 isoleucyl-tRNA synthetase [Candidatus Liberibacter asia
KOG0433937 KOG0433, KOG0433, KOG0433, Isoleucyl-tRNA synthetase [T 0.0
PRK13804961 PRK13804, ileS, isoleucyl-tRNA synthetase; Provisional 0.0
PRK05743912 PRK05743, ileS, isoleucyl-tRNA synthetase; Reviewed 0.0
PLN02843974 PLN02843, PLN02843, isoleucyl-tRNA synthetase 0.0
KOG0434 1070 KOG0434, KOG0434, KOG0434, Isoleucyl-tRNA synthetase [T 3e-88
TIGR00395938 TIGR00395, leuS_arch, leucyl-tRNA synthetase, archaeal 1e-31
COG0060933 COG0060, IleS, Isoleucyl-tRNA synthetase [Translation, 0.0
TIGR00392861 TIGR00392, ileS, isoleucyl-tRNA synthetase 0.0
PRK06039975 PRK06039, ileS, isoleucyl-tRNA synthetase; Reviewed 1e-130
COG0525877 COG0525, ValS, Valyl-tRNA synthetase [Translation, ribo 1e-100
KOG0432995 KOG0432, KOG0432, KOG0432, Valyl-tRNA synthetase [Trans 3e-56
pfam00133606 pfam00133, tRNA-synt_1, tRNA synthetases class I (I, L, 1e-161
PTZ00427 1205 PTZ00427, PTZ00427, isoleucine-tRNA ligase, putative; P 2e-60
TIGR00422861 TIGR00422, valS, valyl-tRNA synthetase 5e-87
PLN02882 1159 PLN02882, PLN02882, aminoacyl-tRNA ligase 3e-76
PRK14900 1052 PRK14900, valS, valyl-tRNA synthetase; Provisional 6e-49
COG0495814 COG0495, LeuS, Leucyl-tRNA synthetase [Translation, rib 2e-36
PLN023811066 PLN02381, PLN02381, valyl-tRNA synthetase 2e-31
cd00818338 cd00818, IleRS_core, catalytic core domain of isoleucyl 1e-60
cd00817382 cd00817, ValRS_core, catalytic core domain of valyl-tRN 2e-34
cd00668312 cd00668, Ile_Leu_Val_MetRS_core, catalytic core domain 3e-30
cd00812314 cd00812, LeuRS_core, catalytic core domain of leucyl-tR 7e-13
pfam09334388 pfam09334, tRNA-synt_1g, tRNA synthetases class I (M) 2e-11
cd00814319 cd00814, MetRS_core, catalytic core domain of methionin 2e-10
cd07960180 cd07960, Anticodon_Ia_Ile_BEm, Anticodon-binding domain 3e-56
cd07961183 cd07961, Anticodon_Ia_Ile_ABEc, Anticodon-binding domai 8e-09
cd00818338 cd00818, IleRS_core, catalytic core domain of isoleucyl 2e-52
cd00668312 cd00668, Ile_Leu_Val_MetRS_core, catalytic core domain 3e-32
cd00817382 cd00817, ValRS_core, catalytic core domain of valyl-tRN 8e-27
COG0143558 COG0143, MetG, Methionyl-tRNA synthetase [Translation, 8e-12
pfam09334388 pfam09334, tRNA-synt_1g, tRNA synthetases class I (M) 2e-10
PRK12268556 PRK12268, PRK12268, methionyl-tRNA synthetase; Reviewed 4e-08
PRK11893511 PRK11893, PRK11893, methionyl-tRNA synthetase; Reviewed 6e-05
PRK13208800 PRK13208, valS, valyl-tRNA synthetase; Reviewed 3e-47
COG0143558 COG0143, MetG, Methionyl-tRNA synthetase [Translation, 6e-21
PLN02943958 PLN02943, PLN02943, aminoacyl-tRNA ligase 9e-44
PRK13208800 PRK13208, valS, valyl-tRNA synthetase; Reviewed 2e-38
PRK05729874 PRK05729, valS, valyl-tRNA synthetase; Reviewed 1e-13
PTZ00419995 PTZ00419, PTZ00419, valyl-tRNA synthetase-like protein; 1e-33
PRK05729874 PRK05729, valS, valyl-tRNA synthetase; Reviewed 2e-28
PRK12268556 PRK12268, PRK12268, methionyl-tRNA synthetase; Reviewed 3e-13
pfam08264148 pfam08264, Anticodon_1, Anticodon-binding domain 1e-22
PRK12300897 PRK12300, leuS, leucyl-tRNA synthetase; Reviewed 9e-16
PRK00390805 PRK00390, leuS, leucyl-tRNA synthetase; Validated 3e-11
KOG04371080 KOG0437, KOG0437, KOG0437, Leucyl-tRNA synthetase [Tran 3e-05
PLN029591084 PLN02959, PLN02959, aminoacyl-tRNA ligase 6e-04
PRK11893511 PRK11893, PRK11893, methionyl-tRNA synthetase; Reviewed 4e-15
PRK00133673 PRK00133, metG, methionyl-tRNA synthetase; Reviewed 1e-12
KOG0436578 KOG0436, KOG0436, KOG0436, Methionyl-tRNA synthetase [T 6e-12
KOG0435876 KOG0435, KOG0435, KOG0435, Leucyl-tRNA synthetase [Tran 1e-12
TIGR00398530 TIGR00398, metG, methionyl-tRNA synthetase 2e-12
TIGR00398530 TIGR00398, metG, methionyl-tRNA synthetase 8e-11
cd00814319 cd00814, MetRS_core, catalytic core domain of methionin 6e-10
cd00812314 cd00812, LeuRS_core, catalytic core domain of leucyl-tR 2e-08
PRK00133673 PRK00133, metG, methionyl-tRNA synthetase; Reviewed 7e-08
PLN02563963 PLN02563, PLN02563, aminoacyl-tRNA ligase 2e-04
PRK00390805 PRK00390, leuS, leucyl-tRNA synthetase; Validated 4e-04
PRK12267648 PRK12267, PRK12267, methionyl-tRNA synthetase; Reviewed 6e-04
KOG0435876 KOG0435, KOG0435, KOG0435, Leucyl-tRNA synthetase [Tran 3e-09
TIGR00396842 TIGR00396, leuS_bact, leucyl-tRNA synthetase, eubacteri 6e-06
PRK12267648 PRK12267, PRK12267, methionyl-tRNA synthetase; Reviewed 3e-09
COG0215464 COG0215, CysS, Cysteinyl-tRNA synthetase [Translation, 5e-08
PRK00260463 PRK00260, cysS, cysteinyl-tRNA synthetase; Validated 5e-06
cd00672213 cd00672, CysRS_core, catalytic core domain of cysteinyl 3e-05
PRK00750510 PRK00750, lysK, lysyl-tRNA synthetase; Reviewed 2e-04
pfam01921355 pfam01921, tRNA-synt_1f, tRNA synthetases class I (K) 0.002
TIGR00396842 TIGR00396, leuS_bact, leucyl-tRNA synthetase, eubacteri 1e-07
cd07375117 cd07375, Anticodon_Ia_like, Anticodon-binding domain of 3e-07
cd07962135 cd07962, Anticodon_Ia_Val, Anticodon-binding domain of 3e-07
cd07959117 cd07959, Anticodon_Ia_Leu_AEc, Anticodon-binding domain 5e-05
PLN02224616 PLN02224, PLN02224, methionine-tRNA ligase 3e-07
PLN02563963 PLN02563, PLN02563, aminoacyl-tRNA ligase 1e-04
cd07957129 cd07957, Anticodon_Ia_Met, Anticodon-binding domain of 0.001
PRK12300897 PRK12300, leuS, leucyl-tRNA synthetase; Reviewed 0.001
PRK00390805 PRK00390, leuS, leucyl-tRNA synthetase; Validated 0.003
TIGR00435465 TIGR00435, cysS, cysteinyl-tRNA synthetase 0.003
>gnl|CDD|35654 KOG0433, KOG0433, KOG0433, Isoleucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|184337 PRK13804, ileS, isoleucyl-tRNA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|180231 PRK05743, ileS, isoleucyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|178436 PLN02843, PLN02843, isoleucyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|35655 KOG0434, KOG0434, KOG0434, Isoleucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|161856 TIGR00395, leuS_arch, leucyl-tRNA synthetase, archaeal and cytosolic family Back     alignment and domain information
>gnl|CDD|30409 COG0060, IleS, Isoleucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|161854 TIGR00392, ileS, isoleucyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|180364 PRK06039, ileS, isoleucyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|30871 COG0525, ValS, Valyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|35653 KOG0432, KOG0432, KOG0432, Valyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|143905 pfam00133, tRNA-synt_1, tRNA synthetases class I (I, L, M and V) Back     alignment and domain information
>gnl|CDD|173617 PTZ00427, PTZ00427, isoleucine-tRNA ligase, putative; Provisional Back     alignment and domain information
>gnl|CDD|161872 TIGR00422, valS, valyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|178470 PLN02882, PLN02882, aminoacyl-tRNA ligase Back     alignment and domain information
>gnl|CDD|184893 PRK14900, valS, valyl-tRNA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|30841 COG0495, LeuS, Leucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|178007 PLN02381, PLN02381, valyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|173909 cd00818, IleRS_core, catalytic core domain of isoleucyl-tRNA synthetases Back     alignment and domain information
>gnl|CDD|185677 cd00817, ValRS_core, catalytic core domain of valyl-tRNA synthetases Back     alignment and domain information
>gnl|CDD|185674 cd00668, Ile_Leu_Val_MetRS_core, catalytic core domain of isoleucyl, leucyl, valyl and methioninyl tRNA synthetases Back     alignment and domain information
>gnl|CDD|173906 cd00812, LeuRS_core, catalytic core domain of leucyl-tRNA synthetases Back     alignment and domain information
>gnl|CDD|117876 pfam09334, tRNA-synt_1g, tRNA synthetases class I (M) Back     alignment and domain information
>gnl|CDD|173907 cd00814, MetRS_core, catalytic core domain of methioninyl-tRNA synthetases Back     alignment and domain information
>gnl|CDD|153414 cd07960, Anticodon_Ia_Ile_BEm, Anticodon-binding domain of bacterial and eukaryotic mitochondrial isoleucyl tRNA synthetases Back     alignment and domain information
>gnl|CDD|153415 cd07961, Anticodon_Ia_Ile_ABEc, Anticodon-binding domain of archaeal, bacterial, and eukaryotic cytoplasmic isoleucyl tRNA synthetases Back     alignment and domain information
>gnl|CDD|173909 cd00818, IleRS_core, catalytic core domain of isoleucyl-tRNA synthetases Back     alignment and domain information
>gnl|CDD|185674 cd00668, Ile_Leu_Val_MetRS_core, catalytic core domain of isoleucyl, leucyl, valyl and methioninyl tRNA synthetases Back     alignment and domain information
>gnl|CDD|185677 cd00817, ValRS_core, catalytic core domain of valyl-tRNA synthetases Back     alignment and domain information
>gnl|CDD|30492 COG0143, MetG, Methionyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|117876 pfam09334, tRNA-synt_1g, tRNA synthetases class I (M) Back     alignment and domain information
>gnl|CDD|183390 PRK12268, PRK12268, methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|183364 PRK11893, PRK11893, methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|183895 PRK13208, valS, valyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|30492 COG0143, MetG, Methionyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|166584 PLN02943, PLN02943, aminoacyl-tRNA ligase Back     alignment and domain information
>gnl|CDD|183895 PRK13208, valS, valyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|180225 PRK05729, valS, valyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|185605 PTZ00419, PTZ00419, valyl-tRNA synthetase-like protein; Provisional Back     alignment and domain information
>gnl|CDD|180225 PRK05729, valS, valyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|183390 PRK12268, PRK12268, methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|149360 pfam08264, Anticodon_1, Anticodon-binding domain Back     alignment and domain information
>gnl|CDD|183418 PRK12300, leuS, leucyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|178996 PRK00390, leuS, leucyl-tRNA synthetase; Validated Back     alignment and domain information
>gnl|CDD|35658 KOG0437, KOG0437, KOG0437, Leucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|178544 PLN02959, PLN02959, aminoacyl-tRNA ligase Back     alignment and domain information
>gnl|CDD|183364 PRK11893, PRK11893, methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|178889 PRK00133, metG, methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|35657 KOG0436, KOG0436, KOG0436, Methionyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|35656 KOG0435, KOG0435, KOG0435, Leucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|161858 TIGR00398, metG, methionyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|161858 TIGR00398, metG, methionyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|173907 cd00814, MetRS_core, catalytic core domain of methioninyl-tRNA synthetases Back     alignment and domain information
>gnl|CDD|173906 cd00812, LeuRS_core, catalytic core domain of leucyl-tRNA synthetases Back     alignment and domain information
>gnl|CDD|178889 PRK00133, metG, methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|178177 PLN02563, PLN02563, aminoacyl-tRNA ligase Back     alignment and domain information
>gnl|CDD|178996 PRK00390, leuS, leucyl-tRNA synthetase; Validated Back     alignment and domain information
>gnl|CDD|183389 PRK12267, PRK12267, methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|35656 KOG0435, KOG0435, KOG0435, Leucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|161857 TIGR00396, leuS_bact, leucyl-tRNA synthetase, eubacterial and mitochondrial family Back     alignment and domain information
>gnl|CDD|183389 PRK12267, PRK12267, methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|30564 COG0215, CysS, Cysteinyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|178951 PRK00260, cysS, cysteinyl-tRNA synthetase; Validated Back     alignment and domain information
>gnl|CDD|173899 cd00672, CysRS_core, catalytic core domain of cysteinyl tRNA synthetase Back     alignment and domain information
>gnl|CDD|179109 PRK00750, lysK, lysyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|145212 pfam01921, tRNA-synt_1f, tRNA synthetases class I (K) Back     alignment and domain information
>gnl|CDD|161857 TIGR00396, leuS_bact, leucyl-tRNA synthetase, eubacterial and mitochondrial family Back     alignment and domain information
>gnl|CDD|153408 cd07375, Anticodon_Ia_like, Anticodon-binding domain of class Ia aminoacyl tRNA synthetases and similar domains Back     alignment and domain information
>gnl|CDD|153416 cd07962, Anticodon_Ia_Val, Anticodon-binding domain of valyl tRNA synthetases Back     alignment and domain information
>gnl|CDD|153413 cd07959, Anticodon_Ia_Leu_AEc, Anticodon-binding domain of archaeal and eukaryotic cytoplasmic leucyl tRNA synthetases Back     alignment and domain information
>gnl|CDD|177869 PLN02224, PLN02224, methionine-tRNA ligase Back     alignment and domain information
>gnl|CDD|178177 PLN02563, PLN02563, aminoacyl-tRNA ligase Back     alignment and domain information
>gnl|CDD|153411 cd07957, Anticodon_Ia_Met, Anticodon-binding domain of methionyl tRNA synthetases Back     alignment and domain information
>gnl|CDD|183418 PRK12300, leuS, leucyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|178996 PRK00390, leuS, leucyl-tRNA synthetase; Validated Back     alignment and domain information
>gnl|CDD|161877 TIGR00435, cysS, cysteinyl-tRNA synthetase Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 963 isoleucyl-tRNA synthetase [Candidatus Liberibacter asia
PRK05743910 ileS isoleucyl-tRNA synthetase; Reviewed 100.0
PRK13804966 ileS isoleucyl-tRNA synthetase; Provisional 100.0
COG0060933 IleS Isoleucyl-tRNA synthetase [Translation, ribosomal 100.0
KOG0433937 consensus 100.0
TIGR00392938 ileS isoleucyl-tRNA synthetase; InterPro: IPR002301 The 100.0
TIGR00396916 leuS_bact leucyl-tRNA synthetase; InterPro: IPR002302 T 100.0
TIGR003951109 leuS_arch leucyl-tRNA synthetase; InterPro: IPR004493 T 100.0
PRK06039 1042 ileS isoleucyl-tRNA synthetase; Reviewed 100.0
PRK05729877 valS valyl-tRNA synthetase; Reviewed 100.0
TIGR00422970 valS valyl-tRNA synthetase; InterPro: IPR002303 The ami 100.0
PRK13208809 valS valyl-tRNA synthetase; Reviewed 100.0
COG0525877 ValS Valyl-tRNA synthetase [Translation, ribosomal stru 100.0
KOG0434 1070 consensus 100.0
KOG0432995 consensus 100.0
pfam00133606 tRNA-synt_1 tRNA synthetases class I (I, L, M and V). O 100.0
cd00817363 ValRS_core This is the catalytic core domain of valine 100.0
cd00818339 IleRS_core This is the catalytic core domain of isoleuc 100.0
cd00668334 Ile_Leu_Val_MetRS_core This is the catalytic core domai 100.0
pfam09334388 tRNA-synt_1g tRNA synthetases class I (M). This family 100.0
cd00812376 LeuRS_core This is the catalytic core domain of leucyl 100.0
PRK12300888 leuS leucyl-tRNA synthetase; Reviewed 100.0
PRK00390822 leuS leucyl-tRNA synthetase; Validated 100.0
COG0495814 LeuS Leucyl-tRNA synthetase [Translation, ribosomal str 100.0
KOG0435876 consensus 100.0
KOG04371080 consensus 100.0
PRK12268558 methionyl-tRNA synthetase; Reviewed 100.0
PRK11893512 methionyl-tRNA synthetase; Reviewed 100.0
PRK00133666 metG methionyl-tRNA synthetase; Reviewed 100.0
PRK12267644 methionyl-tRNA synthetase; Reviewed 100.0
COG0143558 MetG Methionyl-tRNA synthetase [Translation, ribosomal 100.0
TIGR00398573 metG methionyl-tRNA synthetase; InterPro: IPR002304 The 100.0
KOG0436578 consensus 100.0
KOG1247567 consensus 99.97
cd00814319 MetRS_core This is the catalytic core domain of methion 100.0
pfam01406301 tRNA-synt_1e tRNA synthetases class I (C) catalytic dom 100.0
COG0018577 ArgS Arginyl-tRNA synthetase [Translation, ribosomal st 98.85
PRK12451562 arginyl-tRNA synthetase; Reviewed 98.79
TIGR00456600 argS arginyl-tRNA synthetase; InterPro: IPR001278 The a 98.76
PRK01611570 argS arginyl-tRNA synthetase; Reviewed 98.76
pfam00750345 tRNA-synt_1d tRNA synthetases class I (R). Other tRNA s 98.36
cd00672213 CysRS_core This is the catalytic core domain of cystein 97.97
PRK04156566 gltX glutamyl-tRNA synthetase; Provisional 97.89
PRK12410433 glutamyl-tRNA synthetase; Provisional 97.87
cd00807238 Gln_GluRS_non_core Glutaminyl-tRNA synthetase (GlnRS) a 97.79
PRK12558461 glutamyl-tRNA synthetase; Provisional 97.75
pfam00749314 tRNA-synt_1c tRNA synthetases class I (E and Q), cataly 97.66
PRK01406467 gltX glutamyl-tRNA synthetase; Reviewed 97.59
PRK00574489 gltX glutamyl-tRNA synthetase; Reviewed 97.57
COG0008472 GlnS Glutamyl- and glutaminyl-tRNA synthetases [Transla 97.55
PRK05347556 glutaminyl-tRNA synthetase; Provisional 97.51
PRK05710299 glutamyl-Q tRNA(Asp) synthetase; Reviewed 97.39
cd00418223 GlxRS_core Glutamyl-tRNA synthetase(GluRS)/Glutaminyl-t 97.34
TIGR00440564 glnS glutaminyl-tRNA synthetase; InterPro: IPR004514 Th 97.08
TIGR00463600 gltX_arch glutamyl-tRNA synthetase; InterPro: IPR004526 96.77
TIGR00464513 gltX_bact glutamyl-tRNA synthetase; InterPro: IPR004527 94.67
cd07960180 Anticodon_Ia_Ile_BEm Anticodon-binding domain of bacter 100.0
cd07961183 Anticodon_Ia_Ile_ABEc Anticodon-binding domain of archa 100.0
cd07962135 Anticodon_Ia_Val Anticodon-binding domain of valyl tRNA 99.97
cd07375117 Anticodon_Ia_like Anticodon-binding domain of class Ia 99.86
cd07958117 Anticodon_Ia_Leu_BEm Anticodon-binding domain of bacter 99.75
cd07959117 Anticodon_Ia_Leu_AEc Anticodon-binding domain of archae 99.73
cd07956156 Anticodon_Ia_Arg Anticodon-binding domain of arginyl tR 96.52
pfam08264148 Anticodon_1 Anticodon-binding domain. This domain is fo 99.96
PRK00260460 cysS cysteinyl-tRNA synthetase; Validated 99.94
COG0215464 CysS Cysteinyl-tRNA synthetase [Translation, ribosomal 99.87
TIGR03447411 mycothiol_MshC cysteine--1-D-myo-inosityl 2-amino-2-deo 99.86
PRK12418384 cysteinyl-tRNA synthetase; Provisional 99.85
KOG2007586 consensus 99.79
TIGR00435660 cysS cysteinyl-tRNA synthetase; InterPro: IPR002308 The 99.65
cd00802142 class_I_aaRS_core Class I amino acyl-tRNA synthetase (a 99.74
cd00674354 LysRS_core_class_I This is the catalytic core domain of 98.77
PRK00750513 lysK lysyl-tRNA synthetase; Reviewed 98.68
pfam01921355 tRNA-synt_1f tRNA synthetases class I (K). This family 98.66
COG1384521 LysS Lysyl-tRNA synthetase (class I) [Translation, ribo 98.05
cd02156147 nt_trans nt_trans (nucleotidyl transferase) This superf 94.51
cd00672213 CysRS_core This is the catalytic core domain of cystein 99.21
pfam00750345 tRNA-synt_1d tRNA synthetases class I (R). Other tRNA s 98.74
pfam01921355 tRNA-synt_1f tRNA synthetases class I (K). This family 97.71
cd00674354 LysRS_core_class_I This is the catalytic core domain of 97.62
PRK00750513 lysK lysyl-tRNA synthetase; Reviewed 97.47
COG1384521 LysS Lysyl-tRNA synthetase (class I) [Translation, ribo 96.4
PRK00927325 tryptophanyl-tRNA synthetase; Reviewed 96.24
PRK12282333 tryptophanyl-tRNA synthetase II; Reviewed 95.84
cd07957129 Anticodon_Ia_Met Anticodon-binding domain of methionyl 99.2
PRK01611570 argS arginyl-tRNA synthetase; Reviewed 99.13
TIGR00456600 argS arginyl-tRNA synthetase; InterPro: IPR001278 The a 99.03
PRK12451562 arginyl-tRNA synthetase; Reviewed 99.01
COG0018577 ArgS Arginyl-tRNA synthetase [Translation, ribosomal st 99.01
cd00671267 ArgRS_core This is the catalytic core domain of Arginyl 98.57
TIGR00435660 cysS cysteinyl-tRNA synthetase; InterPro: IPR002308 The 97.77
cd00808239 GluRS_core Descriminating Glutamyl-tRNA synthetase (Glu 95.96
PRK08560333 tyrosyl-tRNA synthetase; Validated 91.21
pfam00579291 tRNA-synt_1b tRNA synthetases class I (W and Y). 90.08
TIGR00396 916 leuS_bact leucyl-tRNA synthetase; InterPro: IPR002302 T 97.67
PRK13354405 tyrosyl-tRNA synthetase; Provisional 97.67
cd00805268 TyrRS_core Tyrosinyl-tRNA synthetase (TyrRS) catalytic 97.4
PRK12284436 tryptophanyl-tRNA synthetase; Reviewed 97.23
PRK05912402 tyrosyl-tRNA synthetase; Validated 96.91
pfam00579291 tRNA-synt_1b tRNA synthetases class I (W and Y). 96.84
cd00395274 Tyr_Trp_RS_core Tyrosinyl-tRNA synthetase (TyrRS)/Trypt 96.74
COG0162401 TyrS Tyrosyl-tRNA synthetase [Translation, ribosomal st 96.33
PRK12556328 tryptophanyl-tRNA synthetase; Provisional 96.3
cd00806282 TrpRS_core Tryptophanyl-tRNA synthetase (TrpRS) catalyt 96.13
PRK08560333 tyrosyl-tRNA synthetase; Validated 96.02
COG0180314 TrpS Tryptophanyl-tRNA synthetase [Translation, ribosom 95.6
PTZ00126399 tyrosyl-tRNA synthetase; Provisional 93.5
PRK12285369 tryptophanyl-tRNA synthetase; Reviewed 90.11
pfam0682730 zf-FPG_IleRS Zinc finger found in FPG and IleRS. This z 97.48
KOG1147712 consensus 96.59
PRK00390822 leuS leucyl-tRNA synthetase; Validated 96.54
KOG1148764 consensus 96.54
COG0495814 LeuS Leucyl-tRNA synthetase [Translation, ribosomal str 96.39
KOG4426656 consensus 95.37
PRK12283398 tryptophanyl-tRNA synthetase; Reviewed 95.26
>PRK05743 ileS isoleucyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK13804 ileS isoleucyl-tRNA synthetase; Provisional Back     alignment and domain information
>COG0060 IleS Isoleucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0433 consensus Back     alignment and domain information
>TIGR00392 ileS isoleucyl-tRNA synthetase; InterPro: IPR002301 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>TIGR00396 leuS_bact leucyl-tRNA synthetase; InterPro: IPR002302 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>TIGR00395 leuS_arch leucyl-tRNA synthetase; InterPro: IPR004493 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>PRK06039 ileS isoleucyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK05729 valS valyl-tRNA synthetase; Reviewed Back     alignment and domain information
>TIGR00422 valS valyl-tRNA synthetase; InterPro: IPR002303 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>PRK13208 valS valyl-tRNA synthetase; Reviewed Back     alignment and domain information
>COG0525 ValS Valyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0434 consensus Back     alignment and domain information
>KOG0432 consensus Back     alignment and domain information
>pfam00133 tRNA-synt_1 tRNA synthetases class I (I, L, M and V) Back     alignment and domain information
>cd00817 ValRS_core This is the catalytic core domain of valine amino-acyl tRNA synthetases (ValRS) Back     alignment and domain information
>cd00818 IleRS_core This is the catalytic core domain of isoleucine amino-acyl tRNA synthetases (IleRS) Back     alignment and domain information
>cd00668 Ile_Leu_Val_MetRS_core This is the catalytic core domain of isoleucyl, leucyl, valyl and methioninyl tRNA synthetases Back     alignment and domain information
>pfam09334 tRNA-synt_1g tRNA synthetases class I (M) Back     alignment and domain information
>cd00812 LeuRS_core This is the catalytic core domain of leucyl tRNA synthetase (LeuRS) Back     alignment and domain information
>PRK12300 leuS leucyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK00390 leuS leucyl-tRNA synthetase; Validated Back     alignment and domain information
>COG0495 LeuS Leucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0435 consensus Back     alignment and domain information
>KOG0437 consensus Back     alignment and domain information
>PRK12268 methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK11893 methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK00133 metG methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK12267 methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>COG0143 MetG Methionyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00398 metG methionyl-tRNA synthetase; InterPro: IPR002304 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information