254780446

254780446

hypothetical protein CLIBASIA_01655

GeneID in NCBI database:8209432Locus tag:CLIBASIA_01655
Protein GI in NCBI database:254780446Protein Accession:YP_003064859.1
Gene range:-(358257, 358772)Protein Length:171aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOP1 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-
MISAESDTSQNFTIVLSQLTIGLFFAHRLLVVFDSNKEFVAELDGLVVNKDGKFKPIGYLPSDRLKVFEFKYPCLYKEDQEQVVLCSSSEECVMSRWNAAVHTKEILNEKNMPYPFLGIGKNSNSVASTLIRCMGLKELAIPNAKIAPYQGIILLDDRKINEIQNNWIRCY
cccccccccccEEEEHHHHHHHHHHHEEEEEEEEcccHHHHHcccEEEcccccEEEccccccccEEEEEEEccccccccccEEEEEccccHHHHHHHcHHHHHHHHHccccccccEEEEcccccHHHHHHHHHHccHHHcccccccccEEEEEEEccccccHHHcccEEcc
ccccccccccccEEEHHHHEEHEEEcccEEEEEcccccEEEEEccEEEcccccEEEcccccccccEEEEEcccHEEcccccEEEEEcccHHHHHHHHHHHHHHHHHHHHHcccccEccccccccHHHHHHHHHcccccccccccccccccccEEccHHHHHHHHHHHHHcc
misaesdtsqNFTIVLSQLTIGLFFAHRLLVVFDSNKEFVAELDglvvnkdgkfkpigylpsdrlkvfefkypclykedqeqVVLCSSSEECVMSRWNAAVHTKEilneknmpypflgigknsNSVASTLIRCMGLkelaipnakiapyqgiillddRKINEIQNNWIRCY
misaesdtsqnFTIVLSQLTIGLFFAHRLLVVFDSNKEFVAELdglvvnkdgkfkpigylpsdrlKVFEFKYPCLYKEDQEQVVLCSSSEECVMSRWNAAVHTKEILNEKNMPYPFLGIGKNSNSVASTLIRCMGLKELAIPNAKIAPYQGIILLDDRKINEIQNNWIRCY
MISAESDTSQNFTIVLSQLTIGLFFAHRLLVVFDSNKEFVAELDGLVVNKDGKFKPIGYLPSDRLKVFEFKYPCLYKEDQEQVVLCSSSEECVMSRWNAAVHTKEILNEKNMPYPFLGIGKNSNSVASTLIRCMGLKELAIPNAKIAPYQGIILLDDRKINEIQNNWIRCY
************TIVLSQLTIGLFFAHRLLVVFDSNKEFVAELDGLVVNKDGKFKPIGYLPSDRLKVFEFKYPCLYKEDQEQVVLCSSSEECVMSRWNAAVHTKEILNEKNMPYPFLGIGKNSNSVASTLIRCMGLKELAIPNAKIAPYQGIILLDDRKINEIQNNWIRCY
*********QNFTIVLSQLTIGLFFAHRLLVVFDSNKEFVAELDGLVVNKDGKFKPIGYLPSDRLKVFEFKYPCLYKEDQEQVVLCSSSEECVMSRWNAAVHTKEILNEKNMPYPFLGIGKNSNSVASTLIRCMGLKELAIPNAKIAPYQGIILLDDRKINEIQNNWIRCY
*********QNFTIVLSQLTIGLFFAHRLLVVFDSNKEFVAELDGLVVNKDGKFKPIGYLPSDRLKVFEFKYPCLYKEDQEQVVLCSSSEECVMSRWNAAVHTKEILNEKNMPYPFLGIGKNSNSVASTLIRCMGLKELAIPNAKIAPYQGIILLDDRKINEIQNNWIRCY
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MISAESDTSQNFTIVLSQLTIGLFFAHRLLVVFDSNKEFVAELDGLVVNKDGKFKPIGYLPSDRLKVFEFKYPCLYKEDQEQVVLCSSSEECVMSRWNAAVHTKEILNEKNMPYPFLGIGKNSNSVASTLIRCMGLKELAIPNAKIAPYQGIILLDDRKINEIQNNWIRCY
MISAESDTSQNFTIVLSQLTIGLFFAHRLLVVFDSNKEFVAELDGLVVNKDGKFKPIGYLPSDRLKVFEFKYPCLYKEDQEQVVLCSSSEECVMSRWNAAVHTKEILNEKNMPYPFLGIGKNSNSVASTLIRCMGLKELAIPNAKIAPYQGIILLDDRKINEIQNNWIRCY
MISAESDTSQNFTIVLSQLTIGLFFAHRLLVVFDSNKEFVAELDGLVVNKDGKFKPIGYLPSDRLKVFEFKYPCLYKEDQEQVVLCSSSEECVMSRWNAAVHTKEILNEKNMPYPFLGIGKNSNSVASTLIRCMGLKELAIPNAKIAPYQGIILLDDRKINEIQNNWIRCY

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target171 hypothetical protein CLIBASIA_01655 [Candidatus Liberib
315122105179 hypothetical protein CKC_01775 [Candidatus Liberibacter 1 1e-64
28198734168 hypothetical protein PD0829 [Xylella fastidiosa Temecul 1 3e-42
187477982174 phage protein [Bordetella avium 197N] Length = 174 1 5e-38
332969447240 hypothetical protein HMPREF0476_1333 [Kingella kingae A 1 6e-28
298369422251 conserved hypothetical protein [Neisseria sp. oral taxo 1 4e-26
15838567130 hypothetical protein XF1973 [Xylella fastidiosa 9a5c] L 1 5e-25
21232575 333 hypothetical protein XCC3145 [Xanthomonas campestris pv 2 4e-13
254469764 433 conserved hypothetical protein [Pseudovibrio sp. JE062] 2 7e-06
285019902 346 hypothetical protein XALc_3140 [Xanthomonas albilineans 2 8e-04
270158753175 conserved hypothetical protein [Legionella longbeachae 2 0.002
>gi|315122105|ref|YP_004062594.1| hypothetical protein CKC_01775 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 179 Back     alignment and organism information
 Score =  249 bits (635), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 123/171 (71%), Positives = 144/171 (84%), Gaps = 1/171 (0%)

Query: 1   MISAESDTS-QNFTIVLSQLTIGLFFAHRLLVVFDSNKEFVAELDGLVVNKDGKFKPIGY 59
           ++ AES+ + Q +TIVLSQ  IGL FAHRLL VFDSNK FVAELDGLVVNK+GK KPIGY
Sbjct: 9   VVKAESNCNVQGYTIVLSQWDIGLIFAHRLLTVFDSNKRFVAELDGLVVNKNGKIKPIGY 68

Query: 60  LPSDRLKVFEFKYPCLYKEDQEQVVLCSSSEECVMSRWNAAVHTKEILNEKNMPYPFLGI 119
           L SDRLKVFEFK P LY+EDQEQVVL SS++E VM +W+ A+  K+ILNEK +PYPFLG+
Sbjct: 69  LRSDRLKVFEFKSPHLYREDQEQVVLFSSTKEYVMRKWHLALRAKDILNEKYLPYPFLGM 128

Query: 120 GKNSNSVASTLIRCMGLKELAIPNAKIAPYQGIILLDDRKINEIQNNWIRC 170
           G+NSNSVASTLI+CMGL+EL IP+AKIAPYQG ILLDD  I +IQN+ I C
Sbjct: 129 GENSNSVASTLIKCMGLEELEIPHAKIAPYQGRILLDDSVITQIQNSRIHC 179


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|28198734|ref|NP_779048.1| hypothetical protein PD0829 [Xylella fastidiosa Temecula1] Length = 168 Back     alignment and organism information
>gi|187477982|ref|YP_786006.1| phage protein [Bordetella avium 197N] Length = 174 Back     alignment and organism information
>gi|332969447|gb|EGK08469.1| hypothetical protein HMPREF0476_1333 [Kingella kingae ATCC 23330] Length = 240 Back     alignment and organism information
>gi|298369422|ref|ZP_06980740.1| conserved hypothetical protein [Neisseria sp. oral taxon 014 str. F0314] Length = 251 Back     alignment and organism information
>gi|15838567|ref|NP_299255.1| hypothetical protein XF1973 [Xylella fastidiosa 9a5c] Length = 130 Back     alignment and organism information
>gi|21232575|ref|NP_638492.1| hypothetical protein XCC3145 [Xanthomonas campestris pv. campestris str. ATCC 33913] Length = 333 Back     alignment and organism information
>gi|254469764|ref|ZP_05083169.1| conserved hypothetical protein [Pseudovibrio sp. JE062] Length = 433 Back     alignment and organism information
>gi|285019902|ref|YP_003377613.1| hypothetical protein XALc_3140 [Xanthomonas albilineans GPE PC73] Length = 346 Back     alignment and organism information
>gi|270158753|ref|ZP_06187410.1| conserved hypothetical protein [Legionella longbeachae D-4968] Length = 175 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

No hit with probability above 90.00


Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00