254780448

254780448

hypothetical protein CLIBASIA_01665

GeneID in NCBI database:8209434Locus tag:CLIBASIA_01665
Protein GI in NCBI database:254780448Protein Accession:YP_003064861.1
Gene range:+(359409, 360344)Protein Length:311aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM1 TM-Helix
TOPPRED1 TM-Helix
HMMTOP1 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-
MIPVYGTIQEFKKGNYGWGALGIVSDVALLAIPAAYLGKVLFGLVRGSSIATKIATTGIATVVQEATVMTKTTQEGALLAKEGIEATHIMEGGSTAIKSESVGAKELISASQNSQTVTQTGNISDATKASSTIKDAQSIDRSQAIFQKMPLEEYPRLQKIGINYFRDFKLLGTNKVYKNLLDASRATEFIIDGKKINIDSAQNMLAELNKIFPKDFEKVQLISSYAHEHIFCKPFTKDLLNLANKNIYQLSNPRYSYQFNTLKDKTISFVAKEEGLVTYLNGSLHRNYGIKAEGILSRNAPPELHFSSYVN
cccccccHHHHcccccccHHHHHHHHHHHHHccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcccccccHHHHHccccHHHEEcccccccccccccHHHHHHHcccccEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHccHHHcccHHHHcHHHHHccHHHccHHHHHHHHHHHHccEEEEcccEEcHHHHHHHHHHHHHHccccHHHHHHHHHHHcccEEcccHHHHHHHHHcccEEEEccccEEEEEccccccEEEEEEEcccEEEEEcccEEccccccccccccccccccccHHHccc
cccEEEEHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHcHHHEHHHHHHHcHcHHHHHHHHHccccEEEEEccccccEccccccHHHHHHcccccccEEcccccccHcHccccHHHHHcccHHHHHHHHccHHHcHHHHHHHHHHHHHHHHcccccHHHccccccccEEEEEcccEEEEccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccHHHHHHHHcccccEEEEcccccEEEEEEcccccEEEEEEccccEEEccccccHcccEEEEEEccccccccEEEEEccc
mipvygtiqefkkgnygwgalgIVSDVALLAIPAAYLGKVLFGLVRGSSIATKIATTGIATVVQEATVMTKTTQEGALLAKEGieathimeggstaikseSVGAKELISAsqnsqtvtqtgnisdatkasstikdaqSIDRSQAIFQkmpleeyprlqKIGINYFRDFKLLGTNKVYKNLLDASRATEFIIDGKKINIDSAQNMLAELNkifpkdfeKVQLISSYAhehifckpfTKDLLNLANKniyqlsnprysyqfntlkdktisfVAKEEGLVTYLNgslhrnygikaegilsrnappelhfssyvn
MIPVYGTIQEFKKGNYGWGALGIVSDVALLAIPAAYLGKVLFGLVRGSSIATKIATTGIATVVQEATVMTKTTQEGALLAKEGIEATHIMEGGSTAIKSESVGAKELISAsqnsqtvtqtgnisdatkasstikdaqsiDRSQAIFQKMPLEEYPRLQKIGINYFRDFKLLGTNKVYKNLLDASRATEFIIDGKKINIDSAQNMLAELNKIFPKDFEKVQLISSYAHEHIFCKPFTKDLLNLANKNIYQLSNPRYSYQFNTLKDKTISFVAKEEGLVTYLNGSLHRNYGIKAEGilsrnappelhfssyvn
MIPVYGTIQEFKKGNYGWGALGIVSDVALLAIPAAYLGKVLFGLVRGSSiatkiattgiatVVQEATVMTKTTQEGALLAKEGIEATHIMEGGSTAIKSESVGAKELISASQNSQTVTQTGNISDATKASSTIKDAQSIDRSQAIFQKMPLEEYPRLQKIGINYFRDFKLLGTNKVYKNLLDASRATEFIIDGKKINIDSAQNMLAELNKIFPKDFEKVQLISSYAHEHIFCKPFTKDLLNLANKNIYQLSNPRYSYQFNTLKDKTISFVAKEEGLVTYLNGSLHRNYGIKAEGILSRNAPPELHFSSYVN
MIPVYGTIQEFKKGNYGWGALGIVSDVALLAIPAAYLGKVLFGLVRGSSIATKIATTGIATVVQEATVMTKTTQEGALLAKEGIEATHIMEGGSTAIK**********************************************I**KMPLEEYPRLQKIGINYFRDFKLLGTNKVYKNLLDASRATEFIIDGKKINIDSAQNMLAELNKIFPKDFEKVQLISSYAHEHIFCKPFTKDLLNLANKNIYQLSNPRYSYQFNTLKDKTISFVAKEEGLVTYLNGSLHRNYGIKAEGILSRNAPPELHFSSYVN
MIPVYGTIQEFKKGNYGWGALGIVSDVALLAIPAAYLGKVLFGLVRGSSIATKIATTGIATVVQEATVMTKTTQEGALLAKEGIEATHIMEGGSTAIKSESVGAKE******************************QSIDRSQAIFQKMPLEEYPRLQKIGINYFRDFKLLGTNKVYKNLLDASRATEFIIDGKKINIDSAQNMLAELNKIFPKDFEKVQLISSYAHEHIFCKPFTKDLLNLANKNIYQLSNPRYSYQFNTLKDKTISFVAKEEGLVTYLNGSLHRNYGIKAEGILSRNAPPELHFSSYVN
MIPVYGTIQEFKKGNYGWGALGIVSDVALLAIPAAYLGKVLFGLVRGSSIATKIATTGIATVVQEATVMTKTTQEGALLAKEGIEATHIMEGGST*I*********************************STIKDAQSIDRSQAIFQKMPLEEYPRLQKIGINYFRDFKLLGTNKVYKNLLDASRATEFIIDGKKINIDSAQNMLAELNKIFPKDFEKVQLISSYAHEHIFCKPFTKDLLNLANKNIYQLSNPRYSYQFNTLKDKTISFVAKEEGLVTYLNGSLHRNYGIKAEGILSRNAPPELHFSSYVN
iiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIPVYGTIQEFKKGNYGWGALGIVSDVALLAIPAAYLGKVLFGLVRGSSIATKIATTGIATVVQEATVMTKTTQEGALLAKEGIEATHIMEGGSTAIKSESVGAKELISASQNSQTVTQTGNISDATKASSTIKDAQSIDRSQAIFQKMPLEEYPRLQKIGINYFRDFKLLGTNKVYKNLLDASRATEFIxxxxxxxxxxxxxxxxxxxxxFPKDFEKVQLISSYAHEHIFCKPFTKDLLNLANKNIYQLSNPRYSYQFNTLKDKTISFVAKEEGLVTYLNGSLHRNYGIKAEGILSRNAPPELHFSSYVN
MIPVYGTIQEFKKGNYGWGALGIVSDVALLAIPAAYLGKVLFGLVRGSSIATKIATTGIATVVQEATVMTKTTQEGALLAKEGIEATHIMEGGSTAIKSESVGAKELISASQNSQTVTQTGNISDATKASSTIKDAQSIDRSQAIFQKMPLEEYPRLQKIGINYFRDFKLLGTNKVYKNLLDASRATEFIIDGKKINIDSAQNMLAELNKIFPKDFEKVQLISSYAHEHIFCKPFTKDLLNLANKNIYQLSNPRYSYQFNTLKDKTISFVAKEEGLVTYLNGSLHRNYGIKAEGILSRNAPPELHFSSYVN
MIPVYGTIQEFKKGNYGWGALGIVSDVALLAIPAAYLGKVLFGLVRGSSIATKIATTGIATVVQEATVMTKTTQEGALLAKEGIEATHIMEGGSTAIKSESVGAKELISASQNSQTVTQTGNISDATKASSTIKDAQSIDRSQAIFQKMPLEEYPRLQKIGINYFRDFKLLGTNKVYKNLLDASRATEFIIDGKKINIDSAQNMLAELNKIFPKDFEKVQLISSYAHEHIFCKPFTKDLLNLANKNIYQLSNPRYSYQFNTLKDKTISFVAKEEGLVTYLNGSLHRNYGIKAEGILSRNAPPELHFSSYVN

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target311 hypothetical protein CLIBASIA_01665 [Candidatus Liberib
254780449459 hypothetical protein CLIBASIA_01670 [Candidatus Li 6e-35
>gi|254780449|ref|YP_003064862.1| hypothetical protein CLIBASIA_01670 [Candidatus Liberibacter asiaticus str. psy62] Length = 459 Back     alignment
 Score =  139 bits (350), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 118/384 (30%), Positives = 179/384 (46%), Gaps = 75/384 (19%)

Query: 1   MIPVYGTIQEFKKGNYGWGALGIVSDVALLAIPAAYLGKVLFGLVRGSSIATKIATTGIA 60
           MIP+YGT +EFKKGNYGWG +G +SD ALL     Y  +    LVRG SIA K  T G  
Sbjct: 76  MIPIYGTYREFKKGNYGWGIVGAISDAALLIPVVGYGARAAINLVRGGSIALKAGTAGTM 135

Query: 61  TVVQEATVMTKTTQEGA---LLAKEGIEATHIMEGGSTAIKSESVGAKELISASQNSQ-- 115
              +EA  + + T++ A    L KEGI +   +EG S  IKSES+G K  IS++  ++  
Sbjct: 136 IAAKEACTIAQATEKTAKLTALTKEGITSIRTIEGSSVTIKSESIGTKASISSTNTAEKS 195

Query: 116 ---------TVTQTGNISDA---------------------TKA---------------- 129
                    + T+ G  ++                      TKA                
Sbjct: 196 AISQKITTNSTTEIGKTTEVVEESISKINSQLSKSTPQGIWTKALTKADPALESIYQRGK 255

Query: 130 --SSTIKDAQSIDR----SQAIFQKMPL------------EEYPRLQKIGINYFRDFK-L 170
             S+TIK+   I++    ++AI +K+P              E+  +       FRDF+ L
Sbjct: 256 IFSNTIKNNAFIEKLAHTTKAIDKKIPFIGNQWRDINTAHSEFKMVPLSDQTLFRDFQGL 315

Query: 171 LGTNKVYKNLLDASRATEFIIDGKKINIDSAQNMLAELNKIFPKDFEKVQLISSYAHEHI 230
            G N   + +LD +RA+ FI +GKK+  D++   + +L   F K+ +++QLISSYA++ I
Sbjct: 316 CGKNIDNQFILDLNRAS-FIFNGKKLARDNSAEAIQKLMNQFAKNPKQLQLISSYANQSI 374

Query: 231 FCKPFTKDLLNLANKNIY-QLSNPRYSYQFNTLKDKTISFVAKEEGLVTYLN---GSLHR 286
           F       + ++     Y   S     +   TL +  ++F AK    V  ++   G   +
Sbjct: 375 FADSVVHLMQSIPEFAKYASKSGSASKFTAKTLTNGEVAFTAKYTTKVQAVDKIAGKPLK 434

Query: 287 NYGIKAEGILSRNAPPELHFSSYV 310
            YG+K  GILS +   EL  S Y+
Sbjct: 435 EYGLKISGILSPDKATELQRSFYL 458

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target311 hypothetical protein CLIBASIA_01665 [Candidatus Liberib
315122104335 hypothetical protein CKC_01770 [Candidatus Liberibacter 1 4e-47
254780449459 hypothetical protein CLIBASIA_01670 [Candidatus Liberib 1 5e-31
315122103464 hypothetical protein CKC_01765 [Candidatus Liberibacter 1 9e-12
315122103464 hypothetical protein CKC_01765 [Candidatus Liberibacter 1 2e-08
320538773210 hypothetical protein SSYM_0353 [Serratia symbiotica str 1 3e-05
27905000398 hypothetical protein bbp529 [Buchnera aphidicola str. B 2 8e-15
257471634205 hypothetical protein BaphL_02905 [Buchnera aphidicola s 2 2e-12
311086306205 hypothetical protein CWO_03065 [Buchnera aphidicola str 2 3e-12
15617174367 hypothetical protein BU584 [Buchnera aphidicola str. AP 2 4e-12
219681925367 hypothetical protein BUAP5A_577 [Buchnera aphidicola st 2 4e-12
>gi|315122104|ref|YP_004062593.1| hypothetical protein CKC_01770 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 335 Back     alignment and organism information
 Score =  192 bits (489), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 125/311 (40%), Positives = 172/311 (55%), Gaps = 41/311 (13%)

Query: 2   IPVYGTIQEFKKGNYGWGALGIVSDVALLAIPAAYLGKVLFGLVRGSSIATKIATTGIAT 61
           IP+YGTIQ FK+   GWG LGI +DV  L                           GI  
Sbjct: 56  IPIYGTIQAFKEKESGWGILGITTDVLTL--------------------------IGIGY 89

Query: 62  VVQEATVMTKTTQEGALLAKEGIEATHIMEGGSTAIKSESVGAKELISASQNSQTVTQTG 121
            ++ A  + + +   A  A     +T I EGG+  IKS +V     +  S+N+   T  G
Sbjct: 90  GIKGAAALIRGSSAAATAAMAAGTSTAI-EGGNALIKSSAV-----LVESKNTLKHTDMG 143

Query: 122 NISDATKASSTIKDAQSIDRSQAIFQKMPL-EEYPRLQKIGINYFRDFKLLGTNKVYKNL 180
                  A++   D+ + + S++I   +P+  E PRL+KI  NYF DFKLL  NK YK L
Sbjct: 144 -------ANTIHIDSLAQNSSKSIGTIIPVVSENPRLKKIATNYFYDFKLLSPNKAYKGL 196

Query: 181 LDASRATEFIIDGKKINIDSAQNMLAELNKIFPKDFEKVQLISSYAHEHIFCKPFTKDLL 240
            DAS+A+EFI++GKKINID+ + ML  L +IFP DFEKVQLIS YAHE IF  PFT  L 
Sbjct: 197 RDASKASEFIVNGKKINIDTPEKMLENLKEIFPNDFEKVQLISCYAHEGIFDAPFTHKLF 256

Query: 241 NLANKNIYQLSNPRYSYQFNTLKDKTISFVAKEEGLVTYLNGSLH-RNYGIKAEGILSRN 299
           ++ N   Y       SY+F+ L+D TI+F A  +G  + ++GS     YG+K +GILS+ 
Sbjct: 257 SINNPKNYTGVKTYNSYKFDALEDGTINFSATYKGNFSPVDGSPSTHGYGVKVDGILSKQ 316

Query: 300 APPELHFSSYV 310
           + PELHF+  +
Sbjct: 317 SIPELHFTPII 327


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|254780449|ref|YP_003064862.1| hypothetical protein CLIBASIA_01670 [Candidatus Liberibacter asiaticus str. psy62] Length = 459 Back     alignment and organism information
>gi|315122103|ref|YP_004062592.1| hypothetical protein CKC_01765 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 464 Back     alignment and organism information
>gi|315122103|ref|YP_004062592.1| hypothetical protein CKC_01765 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 464 Back     alignment and organism information
>gi|320538773|ref|ZP_08038451.1| hypothetical protein SSYM_0353 [Serratia symbiotica str. Tucson] Length = 210 Back     alignment and organism information
>gi|27905000|ref|NP_778126.1| hypothetical protein bbp529 [Buchnera aphidicola str. Bp (Baizongia pistaciae)] Length = 398 Back     alignment and organism information
>gi|257471634|ref|ZP_05635633.1| hypothetical protein BaphL_02905 [Buchnera aphidicola str. LSR1 (Acyrthosiphon pisum)] Length = 205 Back     alignment and organism information
>gi|311086306|gb|ADP66388.1| hypothetical protein CWO_03065 [Buchnera aphidicola str. LL01 (Acyrthosiphon pisum)] Length = 205 Back     alignment and organism information
>gi|15617174|ref|NP_240387.1| hypothetical protein BU584 [Buchnera aphidicola str. APS (Acyrthosiphon pisum)] Length = 367 Back     alignment and organism information
>gi|219681925|ref|YP_002468311.1| hypothetical protein BUAP5A_577 [Buchnera aphidicola str. 5A (Acyrthosiphon pisum)] Length = 367 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

No hit with probability above 90.00


Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00