254780449

254780449

hypothetical protein CLIBASIA_01670

GeneID in NCBI database:8209435Locus tag:CLIBASIA_01670
Protein GI in NCBI database:254780449Protein Accession:YP_003064862.1
Gene range:+(360594, 361973)Protein Length:459aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM1 TM-Helix
TOPPRED1 TM-Helix
HMMTOP2 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------46
MNISEINKYFPPNNNIERKEIADKLIKNISIVDKTMDVLPLYHQVRELTQNKASTEQVIDISTKVKDVAVDVAVSMIPIYGTYREFKKGNYGWGIVGAISDAALLIPVVGYGARAAINLVRGGSIALKAGTAGTMIAAKEACTIAQATEKTAKLTALTKEGITSIRTIEGSSVTIKSESIGTKASISSTNTAEKSAISQKITTNSTTEIGKTTEVVEESISKINSQLSKSTPQGIWTKALTKADPALESIYQRGKIFSNTIKNNAFIEKLAHTTKAIDKKIPFIGNQWRDINTAHSEFKMVPLSDQTLFRDFQGLCGKNIDNQFILDLNRASFIFNGKKLARDNSAEAIQKLMNQFAKNPKQLQLISSYANQSIFADSVVHLMQSIPEFAKYASKSGSASKFTAKTLTNGEVAFTAKYTTKVQAVDKIAGKPLKEYGLKISGILSPDKATELQRSFYLK
ccHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEHHHHHHHHEEEEEEEEEcccHHHHHcccccccEEEEEccccEEEEEHHccccHHHEEEEEcccEEEEccccccEEHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEccEEEEEcccccccccccccccHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHcccHHHHHHHHHccHHHHHcccHHHHHHHHHHHHHHHHcccccccccccccccccEEEEEEcccHHHHHHHHHHHccccccEEEEEEcccEEEEccHHHccccHHHHHHHHHHHHHccHHHEEEEHHHccccHHHHHHHHHHHHHHHHHHHHccccccccEEEEEcccccEEEEEEccHHHHHHHHHccccHHHccEEEEEEEcccHHHHHHHHHccc
ccHHHHHHcccccccHHHHHHHHHHHHHHcHHcccccHccHHHHHHHHHHccccccEEEEEcccccHEEEEEEEEEccEcccHHHccccccccEEEEHHHHHHHHcHHHcHHHHHHHHHHHccHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEcccEEEEEEcccccEEEEcccccHHHHHHHcEEccccccccccccEEEHHHHHHHHHHccccccccHHHHHHHcccHHHHHHHHcccHcccHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHccccccccccHHHHHHHHccccccccHHHHccccEEEEEcccEEccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHcccccccccEEEEEEEcccEEEEEEEEEEEEEEEEccccccHHHcEEEEEEEcccccccEEEEEEEcc
mniseinkyfppnnnieRKEIADKLIKNISIvdktmdvlplYHQVRELTQNKASTEQVIDISTKVKDVAVDVAVSmipiygtyrefkkgnygwgivgaisdaallipvVGYGARAAINLVRGgsialkagtaGTMIAAKEACTIAQATEKTAKLTALTKEGITsirtiegssvtiksesigtkasisstntAEKSAISQkittnstteigKTTEVVEESISKINSqlskstpqgiWTKALTKADPALESIYQRGKIFSNTIKNNAFIEKLAHTTKaidkkipfignqWRDINtahsefkmvplsdqtLFRDFQglcgknidnqfilDLNRASFIFNGKKLARDNSAEAIQKLMNQFAKNPKQLQLISSYANQSIFADSVVHLMQSIPEFAKyasksgsaskftaktltngevaftAKYTTKVQAVDkiagkplkeyglkisgilspdkaTELQRSFYLK
mniseinkyfppnnnieRKEIADKLIKNISIVDKTMDVLPLYHQVReltqnkasteqvidistkvkdVAVDVAVSMIPIYGTYREFKKGNYGWGIVGAISDAALLIPVVGYGARAAINLVRGGSIALKAGTAGTMIAAKEACTIAQATektakltaltkegitsirtiegssvtiksesigtkasisstntaeksaisqkittnstteigktTEVVEESISKInsqlskstpqgiWTKALTKADPALESIYQRGKIFSNTIKNNAFIEKLAHTTKAIDKKIPFIGNQWRDINTAHSEFKMVPLSDQTLFRDFQGLCGKNIDNQFILDLNRASFIFNGKKLARDNSAEAIQKLMNQFAKNPKQLQLISSYANQSIFADSVVHLMQSIPEFAKYASKSGSASKFtaktltngevaftakyttkvqavdkiagkplkeyglkisgilspdkatelqrsfylk
MNISEINKYFPPNNNIERKEIADKLIKNISIVDKTMDVLPLYHQVRELTQNKASTEQVIDISTkvkdvavdvavSMIPIYGTYREFKKGNYGWGIVGAISDAALLIPVVGYGARAAINLVRGGSIALKAGTAGTMIAAKEACTIAQatektakltaltkeGITSIRTIEGSSVTIKSESIGTKASISSTNTAEKSAISQKITTNSTTEIGKTTEVVEESISKINSQLSKSTPQGIWTKALTKADPALESIYQRGKIFSNTIKNNAFIEKLAHTTKAIDKKIPFIGNQWRDINTAHSEFKMVPLSDQTLFRDFQGLCGKNIDNQFILDLNRASFIFNGKKLARDNSAEAIQKLMNQFAKNPKQLQLISSYANQSIFADSVVHLMQSIPEFakyasksgsaskFTAKTLTNGEVAFTAKYTTKVQAVDKIAGKPLKEYGLKISGILSPDKATELQRSFYLK
******NKYFPPNNNIERKEIADKLIKNISIVDKTMDVLPLYHQVRELTQNKASTEQVIDISTKVKDVAVDVAVSMIPIYGTYREFKKGNYGWGIVGAISDAALLIPVVGYGARAAINLVRGGSIALKAGTAGTMIAAKEACTIAQATEKTAKLTALTKEGITSIRTIEGSSVTIKSESIGTKA***********AISQKITTNSTTEIGKTTEVVEE*******************KALTKADPALESIY*************************IDKKIPFIGNQWRDINTAHSE**MVPLSDQTLFRDFQGLCGKNIDNQFILDLNRASFIFNGKKLARDNSAEAIQKLMNQFAKNPKQLQLISSYANQSIFADSVVHLMQSIPEFAKYASKSGSASKFTAKTLTNGEVAFTAKYTTKVQAVDKIAGKPLKEYGLKISGILSPDKATELQRSFYLK
MNISEINKYFPPNNNIERKEIADKLIKNISIVDKTMDVLPLYHQVRELTQNKASTEQVIDISTKVKDVAVDVAVSMIPIYGTYREFKKGNYGWGIVGAISDAALLIPVVGYGARAAINLVRGGSIALKAGTAGTMIAAKEACTIAQATEKTAKLTALTKEGITSIRTIEGSSVTIKSESIG******************KITTNSTTEIGKTTEVVEESISKINSQLSKSTPQGIWTKALTKADPALESIYQRGKIFSNTIKNNAFIEKLAHTTKAIDKKIPFIGNQWRDINTAHSEFKMVPLSDQTLFRDFQGLCGKNIDNQFILDLNRASFIFNGKKLARDNSAEAIQKLMNQFAKNPKQLQLISSYANQSIFADSVVHLMQSIPEFAKYASKSGSASKFTAKTLTNGEVAFTAKYTTKVQAVDKIAGKPLKEYGLKISGILSPDKATELQRSFYLK
MNISEINKYFPPNNNIERKEIADKLIKNISIVDKTMDVLPLYHQVRELTQNKASTEQVIDISTKVKDVAVDVAVSMIPIYGTYREFKKGNYGWGIVGAISDAALLIPVVGYGARAAINLVRGGSIALKAGTAGTMIAAKEACTIAQATEKTAKLTALTKEGITSIRTIEGSSVTIKSESIGTKASISST*TA*KS***Q*ITTNSTTEIGKTTEVVEESISKINSQLSKSTPQGIWTKALTKADPALESIYQRGKIFSNTIKNNAFIEKLAHTTKAIDKKIPFIGNQWRDINTAHSEFKMVPLSDQTLFRDFQGLCGKNIDNQFILDLNRASFIFNGKKLARDNSAEAIQKLMNQFAKNPKQLQLISSYANQSIFADSVVHLMQSIPEFAKYASKSGSASKFTAKTLTNGEVAFTAKYTTKVQAVDKIAGKPLKEYGLKISGILSPDKATELQRSFYLK
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNISEINKYFPPNNNIERKEIADKLIKNISIVDKTMDVLPLYHQVRELTQNKASTEQVIDISTKVKDVAVDVAVSMIPIYGTYREFKKGNYGWGIVGAISDAALLIPVVGYGARAAINLVRGGSIALKAGTAGTMIAAKEACTIAQATEKTAKLTALTKEGITSIRTIEGSSVTIKSESIGTKASISSTNTAEKSAISQKITTNSTTEIGKTTEVVEESISKINSQLSKSTPQGIWTKALTKADPALESIYQRGKIFSNTIKNNAFIEKLAHTTKAIDKKIPFIGNQWRDINTAHSEFKMVPLSDQTLFRDFQGLCGKNIDNQFILDLNRASFIFNGKKLARDNSAEAIQKLMNQFAKNPKQLQLISSYANQSIFADSVVHLMQSIPEFAKYASKSGSASKFTAKTLTNGEVAFTAKYTTKVQAVDKIAGKPLKEYGLKISGILSPDKATELQRSFYLK
MNISEINKYFPPNNNIERKEIADKLIKNISIVDKTMDVLPLYHQVRELTQNKASTEQVIDISTKVKDVAVDVAVSMIPIYGTYREFKKGNYGWGIVGAISDAALLIPVVGYGARAAINLVRGGSIALKAGTAGTMIAAKEACTIAQATEKTAKLTALTKEGITSIRTIEGSSVTIKSESIGTKASISSTNTAEKSAISQKITTNSTTEIGKTTEVVEESISKINSQLSKSTPQGIWTKALTKADPALESIYQRGKIFSNTIKNNAFIEKLAHTTKAIDKKIPFIGNQWRDINTAHSEFKMVPLSDQTLFRDFQGLCGKNIDNQFILDLNRASFIFNGKKLARDNSAEAIQKLMNQFAKNPKQLQLISSYANQSIFADSVVHLMQSIPEFAKYASKSGSASKFTAKTLTNGEVAFTAKYTTKVQAVDKIAGKPLKEYGLKISGILSPDKATELQRSFYLK
MNISEINKYFPPNNNIERKEIADKLIKNISIVDKTMDVLPLYHQVRELTQNKASTEQVIDISTKVKDVAVDVAVSMIPIYGTYREFKKGNYGWGIVGAISDAALLIPVVGYGARAAINLVRGGSIALKAGTAGTMIAAKEACTIAQATEKTAKLTALTKEGITSIRTIEGSSVTIKSESIGTKASISSTNTAEKSAISQKITTNSTTEIGKTTEVVEESISKINSQLSKSTPQGIWTKALTKADPALESIYQRGKIFSNTIKNNAFIEKLAHTTKAIDKKIPFIGNQWRDINTAHSEFKMVPLSDQTLFRDFQGLCGKNIDNQFILDLNRASFIFNGKKLARDNSAEAIQKLMNQFAKNPKQLQLISSYANQSIFADSVVHLMQSIPEFAKYASKSGSASKFTAKTLTNGEVAFTAKYTTKVQAVDKIAGKPLKEYGLKISGILSPDKATELQRSFYLK

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target459 hypothetical protein CLIBASIA_01670 [Candidatus Liberib
254780448311 hypothetical protein CLIBASIA_01665 [Candidatus Li 9e-35
>gi|254780448|ref|YP_003064861.1| hypothetical protein CLIBASIA_01665 [Candidatus Liberibacter asiaticus str. psy62] Length = 311 Back     alignment
 Score =  139 bits (350), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 118/384 (30%), Positives = 179/384 (46%), Gaps = 75/384 (19%)

Query: 76  MIPIYGTYREFKKGNYGWGIVGAISDAALLIPVVGYGARAAINLVRGGSIALKAGTAGTM 135
           MIP+YGT +EFKKGNYGWG +G +SD ALL     Y  +    LVRG SIA K  T G  
Sbjct: 1   MIPVYGTIQEFKKGNYGWGALGIVSDVALLAIPAAYLGKVLFGLVRGSSIATKIATTGIA 60

Query: 136 IAAKEACTIAQATEKTAKLTALTKEGITSIRTIEGSSVTIKSESIGTKASISSTNTAEKS 195
              +EA  + + T++ A    L KEGI +   +EG S  IKSES+G K  IS++  ++  
Sbjct: 61  TVVQEATVMTKTTQEGA---LLAKEGIEATHIMEGGSTAIKSESVGAKELISASQNSQ-- 115

Query: 196 AISQKITTNSTTEIGKTTEVVEESISKINSQLSKSTPQGIWTKALTKADPALESIYQRGK 255
                    + T+ G  ++                      TKA                
Sbjct: 116 ---------TVTQTGNISDA---------------------TKA---------------- 129

Query: 256 IFSNTIKNNAFIEKLAHTTKAIDKKIPFIGNQWRDINTAHSEFKMVPLSDQTLFRDFQGL 315
             S+TIK+   I++    ++AI +K+P              E+  +       FRDF+ L
Sbjct: 130 --SSTIKDAQSIDR----SQAIFQKMPL------------EEYPRLQKIGINYFRDFK-L 170

Query: 316 CGKNIDNQFILDLNRAS-FIFNGKKLARDNSAEAIQKLMNQFAKNPKQLQLISSYANQSI 374
            G N   + +LD +RA+ FI +GKK+  D++   + +L   F K+ +++QLISSYA++ I
Sbjct: 171 LGTNKVYKNLLDASRATEFIIDGKKINIDSAQNMLAELNKIFPKDFEKVQLISSYAHEHI 230

Query: 375 FADSVVHLMQSIPEFAKYASKSGSASKFTAKTLTNGEVAFTAKYTTKVQAVDKIAGKPLK 434
           F       + ++     Y   S     +   TL +  ++F AK    V  ++   G   +
Sbjct: 231 FCKPFTKDLLNLANKNIY-QLSNPRYSYQFNTLKDKTISFVAKEEGLVTYLN---GSLHR 286

Query: 435 EYGLKISGILSPDKATELQRSFYL 458
            YG+K  GILS +   EL  S Y+
Sbjct: 287 NYGIKAEGILSRNAPPELHFSSYV 310

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target459 hypothetical protein CLIBASIA_01670 [Candidatus Liberib
315122103464 hypothetical protein CKC_01765 [Candidatus Liberibacter 1 4e-63
254780448311 hypothetical protein CLIBASIA_01665 [Candidatus Liberib 1 9e-31
315122104335 hypothetical protein CKC_01770 [Candidatus Liberibacter 1 4e-08
315122104335 hypothetical protein CKC_01770 [Candidatus Liberibacter 1 0.002
320538773210 hypothetical protein SSYM_0353 [Serratia symbiotica str 1 8e-07
15617174367 hypothetical protein BU584 [Buchnera aphidicola str. AP 1 0.002
219681925367 hypothetical protein BUAP5A_577 [Buchnera aphidicola st 1 0.002
219682480367 hypothetical protein BUAPTUC7_578 [Buchnera aphidicola 1 0.002
257471634205 hypothetical protein BaphL_02905 [Buchnera aphidicola s 1 0.003
311086306205 hypothetical protein CWO_03065 [Buchnera aphidicola str 1 0.003
>gi|315122103|ref|YP_004062592.1| hypothetical protein CKC_01765 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 464 Back     alignment and organism information
 Score =  247 bits (630), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 163/418 (38%), Positives = 241/418 (57%), Gaps = 30/418 (7%)

Query: 62  STKVKDVAVDVAVSMIPIYGTYREFKKGNYGWGIVGAISDAALLIPVVGYGARAAINLVR 121
           S+K+ + A +  +S+IPIYGT + FKKG  GWGI GAI+D   L+PVVGYGA+    L R
Sbjct: 53  SSKIGETAKEALLSLIPIYGTIQSFKKGEIGWGIFGAITDVLTLVPVVGYGAKMVGALAR 112

Query: 122 GGSIALKAGTAGTMIAAKEACTIAQATEKTAKL------TALTKEGITSIR----TIEGS 171
           GG+ A+K   AG + A+  A T A AT   A L      T    EG ++      T++ +
Sbjct: 113 GGNAAIKISKAGAIAASATASTYAAATRGGAALADGALITKYAMEGESAFNAGSATVKAT 172

Query: 172 SVTIKSESIGTKASISSTNTAEKSAISQKITTNS------TTEIGK-TTEVVEESISKI- 223
           S T+   ++ TKA+ S+ +T +K+AI   I+ N+      T E+ K   +VVE+S  K  
Sbjct: 173 SSTLYESNVITKAAESTHSTLDKAAI-LPISKNTIKTSVNTAEMDKIAAKVVEQSTKKTT 231

Query: 224 --NSQLSKSTPQGIWTKALTKADPALESIYQRGKIFSNTIKNNAFIEKLAHTTKAIDKKI 281
             N +  K   +  +  +L   DP LE +YQ GK  +   K+ +  EK+  T+ ++ K  
Sbjct: 232 LSNKKTIKQASKKFFIASLRAVDPGLELLYQGGK--AAIRKSRSIPEKIMKTSHSLPK-- 287

Query: 282 PFIGNQWRDINTAHSEFKMVPLSDQTLFRDFQGLCGKNIDNQFILDLNRASFIFNGKKLA 341
               N W++I++  SE+KMV LSD++LFR+F+ L    +D QF+LDLNRA +I NGK + 
Sbjct: 288 ----NTWKNIDSIPSEYKMVSLSDESLFRNFKQLNKNELDQQFLLDLNRAEYIINGKNMR 343

Query: 342 RDNSAEAIQKLMNQFAKNPKQLQLISSYANQSIFADSVVHLMQSIPEFAKYASKSGSASK 401
             N    +  L   FA +P++LQ+IS+YA+Q IFAD + +LM++IP    Y SK+G  + 
Sbjct: 344 DTNQKSQLAYLQKTFANDPQKLQIISAYAHQGIFADGISYLMETIPNMLSYGSKNGKTT- 402

Query: 402 FTAKTLTNGEVAFTAKYTTKVQAVDKIAGKPLKEYGLKISGILSPDKATELQRSFYLK 459
           F   TL    V  +AKYT  +   ++    PL+EYGLKI  IL P+KA +  + FY K
Sbjct: 403 FQINTLGEEGVRLSAKYTASLVTENQAIKNPLREYGLKIDTILFPNKAPQFTQYFYTK 460


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|254780448|ref|YP_003064861.1| hypothetical protein CLIBASIA_01665 [Candidatus Liberibacter asiaticus str. psy62] Length = 311 Back     alignment and organism information
>gi|315122104|ref|YP_004062593.1| hypothetical protein CKC_01770 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 335 Back     alignment and organism information
>gi|315122104|ref|YP_004062593.1| hypothetical protein CKC_01770 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 335 Back     alignment and organism information
>gi|320538773|ref|ZP_08038451.1| hypothetical protein SSYM_0353 [Serratia symbiotica str. Tucson] Length = 210 Back     alignment and organism information
>gi|15617174|ref|NP_240387.1| hypothetical protein BU584 [Buchnera aphidicola str. APS (Acyrthosiphon pisum)] Length = 367 Back     alignment and organism information
>gi|219681925|ref|YP_002468311.1| hypothetical protein BUAP5A_577 [Buchnera aphidicola str. 5A (Acyrthosiphon pisum)] Length = 367 Back     alignment and organism information
>gi|219682480|ref|YP_002468864.1| hypothetical protein BUAPTUC7_578 [Buchnera aphidicola str. Tuc7 (Acyrthosiphon pisum)] Length = 367 Back     alignment and organism information
>gi|257471634|ref|ZP_05635633.1| hypothetical protein BaphL_02905 [Buchnera aphidicola str. LSR1 (Acyrthosiphon pisum)] Length = 205 Back     alignment and organism information
>gi|311086306|gb|ADP66388.1| hypothetical protein CWO_03065 [Buchnera aphidicola str. LL01 (Acyrthosiphon pisum)] Length = 205 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

No hit with probability above 90.00


Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target459 hypothetical protein CLIBASIA_01670 [Candidatus Liberib
2pff_A 1688 Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carr 2e-09
>2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 1688 Back     alignment and structure
 Score = 59.4 bits (143), Expect = 2e-09
 Identities = 101/436 (23%), Positives = 169/436 (38%), Gaps = 106/436 (24%)

Query: 62   STKVKDVAVDVAVS---MIPIYGTYREFKK-GNYGWGIVGAISD-----------AALLI 106
            S +  D+ V+  +S    I I G Y +F++ G++ +G + A S+           A +  
Sbjct: 1109 SVESVDIGVETILSGKARICIVGGYDDFQEEGSFEFGNMKATSNTLEEFEHGRTPAEMSR 1168

Query: 107  PVV----GY--GARAAINLVRGGSIALKAGTAGTMIAAKEACTIAQATEKTAKLTALTKE 160
            P      G+     A I ++    +ALK G     I A      A AT+K  +      +
Sbjct: 1169 PATTTRNGFMEAQGAGIQIIMQADLALKMGVPIYGIVA----MAATATDKIGRSVPAPGK 1224

Query: 161  GITSIRTIEGSSVTIKSESIGTK----------ASISSTNTAEKSAI---SQKITTNSTT 207
            GI +      SSV   S ++  K          A I      E  A+   +++I +    
Sbjct: 1225 GILTTAREHHSSVKYASPNLNMKYRKRQLVTREAQIKDWVENELEALKLEAEEIPSEDQN 1284

Query: 208  E--IGKTTEVVEESISKINSQLSKSTPQGIWTKALTKADPALESIYQRGKI--FSNTIKN 263
            E  + +T E+  E+     SQL  +  Q  W     K DP +  +  RG +  +  TI +
Sbjct: 1285 EFLLERTREIHNEA----ESQLRAAQQQ--WGNDFYKRDPRIAPL--RGALATYGLTIDD 1336

Query: 264  NAFIEKLAHTTKAIDKKIPFIGNQWRDINTAHSEFKMVPLSDQT----LFRDF-----QG 314
                     +TKA DK      N+   IN      K +  S+      +F+ F     +G
Sbjct: 1337 LGVASFHGTSTKANDK------NESATINEM---MKHLGRSEGNPVIGVFQKFLTGHPKG 1387

Query: 315  LCGKNIDNQFILDLNRASFIFNGKKLARDNSAEAIQKLMNQF--AKNP-KQLQL------ 365
              G  +       +N A  I N   +  + +A+ + K++ QF     P K L+       
Sbjct: 1388 AAGAWM-------MNGALQILNSGIIPGNRNADNVDKILEQFEYVLYPSKTLKTDGVRAV 1440

Query: 366  -ISSY-----ANQSIFADSVVH---LMQSIPE--FAKYASKSGSASKFTAKTLTNGEV-- 412
             I+S+       Q+I    VVH   L  +I E  + +Y +K  +  K   K   NG +  
Sbjct: 1441 SITSFGFGQKGGQAI----VVHPDYLYGAITEDRYNEYVAKVSAREKSAYKFFHNGMIYN 1496

Query: 413  -AFTAK----YTTKVQ 423
              F +K    YT +++
Sbjct: 1497 KLFVSKEHAPYTDELE 1512


Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00