254780453

254780453

orotidine 5'-phosphate decarboxylase

GeneID in NCBI database:8209439Locus tag:CLIBASIA_01690
Protein GI in NCBI database:254780453Protein Accession:YP_003064866.1
Gene range:-(369502, 370218)Protein Length:238aa
Gene description:orotidine 5'-phosphate decarboxylase
COG prediction:[F] Orotidine-5'-phosphate decarboxylase
KEGG prediction:pyrE; orotidine 5'-phosphate decarboxylase (EC:4.1.1.23); K01591 orotidine-5'-phosphate decarboxylase [EC:4.1.1.23]
SEED prediction:Orotidine-phosphate decarboxylase (EC 4.1.1.23)
Pathway involved in KEGG:Pyrimidine metabolism [PATH:las00240]
Subsystem involved in SEED:De Novo Pyrimidine Synthesis
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------24
MDAGLIIDVDEKKRLVVGLDLPTVKEAERIVSILSDTVSFYKIGYHLSFSGGLELARDLISDGKSVFLDMKLFDIGSSVTAAIEHIANMGVAMLTVHAYPQTMRSAVSVVRDTGICLLAVTVLTSMDDFDLRESGYEKDISDMVRMRAVQARDIGMGGIVCSPQEVRMVREIVGHNMVIVTPGIRMLGSATDGQKRFATPETALKYGASHIVVSRPIVRAADPVSAAQEFQRAISLIS
ccccccccccccccEEEEEccccHHHHHHHHHHccccccEEEEcHHHHHcccHHHHHHHHHcccEEEEEEEEcccHHHHHHHHHHHHHccccEEEEEccHHHHHHHHHHHHccccEEEEEEEcccccHHHHHHccccccHHHHHHHHHHHHHHccccEEEccHHHHHHHHHHcccccEEEEcccccccccccccEEEccHHHHHHHcccEEEEccHHcccccHHHHHHHHHHHHHHcc
ccccccccccccccEEEEEccccHHHHHHHHHHccHHHcEEEEHHHHHHcccHHHHHHHHHccccEEEEccccccccHHHHHHHHHHHccccEEEEccccHHHHHHHHHHcccccEEEEEcccccccHHHHHcccccccHHHHHHHHHHHHHHccccEEEccHHHHHHHHHHHccccEEEEccEcccccccccccccEcHHHHHHccccEEEEcHHHHccccHHHHHHHHHHHcHccc
mdagliidvdekkrlvvgldlptvkEAERIVSILSDTVSFYKIGYHLSFSGGLELARDLISDGKSVFLDMKLFDIGSSVTAAIEHIANMGVAMLTVHAYPQTMRSAVSVVRDTGICLLAVTVLtsmddfdlresgyekdiSDMVRMRAVQArdigmggivcspqEVRMVREIVGHNMVIVTpgirmlgsatdgqkrfatpetaLKYGAShivvsrpivraadpvsAAQEFQRAISLIS
mdagliidvdekkrlvvgldlptvkeaeriVSILSDTVSFYKIGYHLSFSGGLELARDLISDGKSVFLDMKLFDIGSSVTAAIEHIANMGVAMLTVHAYPQTMRSAVSVVRDTGICLLAVTvltsmddfdlresgyekdisdmVRMRAVQARDIGMGGIVCSPQEVRMVREIVGHNMVIVTPGIRMLGSATDGQKRFATPETALKYGASHIVVSRPIVRAADPVSAAQEFQRAISLIS
MDAGLIIDVDEKKRLVVGLDLPTVKEAERIVSILSDTVSFYKIGYHLSFSGGLELARDLISDGKSVFLDMKLFDIGSSVTAAIEHIANMGVAMLTVHAYPQTMRSAVSVVRDTGICLLAVTVLTSMDDFDLRESGYEKDISDMVRMRAVQARDIGMGGIVCSPQEVRMVREIVGHNMVIVTPGIRMLGSATDGQKRFATPETALKYGASHIVVSRPIVRAADPVSAAQEFQRAISLIS
**************LVVGLDLPTVKEAERIVSILSDTVSFYKIGYHLSFSGGLELARDLISDGKSVFLDMKLFDIGSSVTAAIEHIANMGVAMLTVHAYPQTMRSAVSVVRDTGICLLAVTVLTSMDDFDLRESGYEKDISDMVRMRAVQARDIGMGGIVCSPQEVRMVREIVGHNMVIVTPGIRMLGSATDGQKRFATPETALKYGASHIVVSRPIVRAADPVSAAQEFQRAISLI*
MDAGLIIDVDEKKRLVVGLDLPTVKEAERIVSILSDTVSFYKIGYHLSFSGGLELARDLISDGKSVFLDMKLFDIGSSVTAAIEHIANMGVAMLTVHAYPQTMRSAVSVVRDTGICLLAVTVLTSMDDFDLRESGYEKDISDMVRMRAVQARDIGMGGIVCSPQEVRMVREIVGHNMVIVTPGIRMLGSATDGQKRFATPETALKYGASHIVVSRPIVRAADPVSAAQEFQRAISLIS
*DAGLIIDVDEKKRLVVGLDLPTVKEAERIVSILSDTVSFYKIGYHLSFSGGLELARDLISDGKSVFLDMKLFDIGSSVTAAIEHIANMGVAMLTVHAYPQTMRSAVSVVRDTGICLLAVTVLTSMDDFDLRESGYEKDISDMVRMRAVQARDIGMGGIVCSPQEVRMVREIVGHNMVIVTPGIRMLGSATDGQKRFATPETALKYGASHIVVSRPIVRAADPVSAAQEFQRAI****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDAGLIIDVDEKKRLVVGLDLPTVKEAERIVSILSDTVSFYKIGYHLSFSGGLELARDLISDGKSVFLDMKLFDIGSSVTAAIEHIANMGVAMLTVHAYPQTMRSAVSVVRDTGICLLAVTVLTSMDDFDLRESGYEKDISDMVRMRAVQARDIGMGGIVCSPQEVRMVREIVGHNMVIVTPGIRMLGSATDGQKRFATPETALKYGASHIVVSRPIVRAADPVSAAQEFQRAISLIS
MDAGLIIDVDEKKRLVVGLDLPTVKEAERIVSILSDTVSFYKIGYHLSFSGGLELARDLISDGKSVFLDMKLFDIGSSVTAAIEHIANMGVAMLTVHAYPQTMRSAVSVVRDTGICLLAVTVLTSMDDFDLRESGYEKDISDMVRMRAVQARDIGMGGIVCSPQEVRMVREIVGHNMVIVTPGIRMLGSATDGQKRFATPETALKYGASHIVVSRPIVRAADPVSAAQEFQRAISLIS
MDAGLIIDVDEKKRLVVGLDLPTVKEAERIVSILSDTVSFYKIGYHLSFSGGLELARDLISDGKSVFLDMKLFDIGSSVTAAIEHIANMGVAMLTVHAYPQTMRSAVSVVRDTGICLLAVTVLTSMDDFDLRESGYEKDISDMVRMRAVQARDIGMGGIVCSPQEVRMVREIVGHNMVIVTPGIRMLGSATDGQKRFATPETALKYGASHIVVSRPIVRAADPVSAAQEFQRAISLIS

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target238 orotidine 5'-phosphate decarboxylase [Candidatus Liberi
315122099247 orotidine 5'-phosphate decarboxylase [Candidatus Liberi 1 5e-98
222147279231 orotidine 5'-phosphate decarboxylase [Agrobacterium vit 1 2e-69
159184246235 orotidine 5'-phosphate decarboxylase [Agrobacterium tum 1 1e-68
325291732235 orotidine 5`-phosphate decarboxylase [Agrobacterium sp. 1 4e-68
15964085234 orotidine 5'-phosphate decarboxylase [Sinorhizobium mel 1 2e-67
20139722234 RecName: Full=Orotidine 5'-phosphate decarboxylase; Alt 1 3e-67
227824171234 orotidine 5'-phosphate decarboxylase [Sinorhizobium fre 1 5e-67
218679746235 orotidine 5'-phosphate decarboxylase [Rhizobium etli CI 1 2e-66
150398724232 orotidine 5'-phosphate decarboxylase [Sinorhizobium med 1 4e-66
241207269235 orotidine 5'-phosphate decarboxylase [Rhizobium legumin 1 6e-66
>gi|315122099|ref|YP_004062588.1| orotidine 5'-phosphate decarboxylase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 247 Back     alignment and organism information
 Score =  361 bits (926), Expect = 5e-98,   Method: Compositional matrix adjust.
 Identities = 174/237 (73%), Positives = 201/237 (84%)

Query: 1   MDAGLIIDVDEKKRLVVGLDLPTVKEAERIVSILSDTVSFYKIGYHLSFSGGLELARDLI 60
           M   L +D+ ++ RL+VGLDLPTVKEAERIVS+LSDTVS YKIGY L F+GGLELARDL 
Sbjct: 11  MSVALKVDLLKRNRLIVGLDLPTVKEAERIVSVLSDTVSSYKIGYQLFFAGGLELARDLA 70

Query: 61  SDGKSVFLDMKLFDIGSSVTAAIEHIANMGVAMLTVHAYPQTMRSAVSVVRDTGICLLAV 120
            DGKSVFLDMKL DI ++V +AIEHIA MG+ MLTVHAYPQTMR AV   R TGICLLAV
Sbjct: 71  LDGKSVFLDMKLLDIENTVASAIEHIAKMGILMLTVHAYPQTMRIAVDAARGTGICLLAV 130

Query: 121 TVLTSMDDFDLRESGYEKDISDMVRMRAVQARDIGMGGIVCSPQEVRMVREIVGHNMVIV 180
           T+LTSMD+ DL+ESGYEK+IS +V+MRA QARDIGMGGIVCSP+E  MVR+IVG++M +V
Sbjct: 131 TILTSMDELDLKESGYEKNISTIVKMRATQARDIGMGGIVCSPREAMMVRKIVGNHMAVV 190

Query: 181 TPGIRMLGSATDGQKRFATPETALKYGASHIVVSRPIVRAADPVSAAQEFQRAISLI 237
           TPGIRM+G ATD QKRFATPE A+ YGASHIVVSRPIVRAADP+  A+ FQ  ISL+
Sbjct: 191 TPGIRMIGDATDDQKRFATPEEAINYGASHIVVSRPIVRAADPLLEAKRFQHVISLV 247


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222147279|ref|YP_002548236.1| orotidine 5'-phosphate decarboxylase [Agrobacterium vitis S4] Length = 231 Back     alignment and organism information
>gi|159184246|ref|NP_353328.2| orotidine 5'-phosphate decarboxylase [Agrobacterium tumefaciens str. C58] Length = 235 Back     alignment and organism information
>gi|325291732|ref|YP_004277596.1| orotidine 5`-phosphate decarboxylase [Agrobacterium sp. H13-3] Length = 235 Back     alignment and organism information
>gi|15964085|ref|NP_384438.1| orotidine 5'-phosphate decarboxylase [Sinorhizobium meliloti 1021] Length = 234 Back     alignment and organism information
>gi|20139722|sp|Q9EYV3|PYRF_RHIFR RecName: Full=Orotidine 5'-phosphate decarboxylase; AltName: Full=OMP decarboxylase; Short=OMPDCase; Short=OMPdecase Length = 234 Back     alignment and organism information
>gi|227824171|ref|YP_002828144.1| orotidine 5'-phosphate decarboxylase [Sinorhizobium fredii NGR234] Length = 234 Back     alignment and organism information
>gi|218679746|ref|ZP_03527643.1| orotidine 5'-phosphate decarboxylase [Rhizobium etli CIAT 894] Length = 235 Back     alignment and organism information
>gi|150398724|ref|YP_001329191.1| orotidine 5'-phosphate decarboxylase [Sinorhizobium medicae WSM419] Length = 232 Back     alignment and organism information
>gi|241207269|ref|YP_002978365.1| orotidine 5'-phosphate decarboxylase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 235 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target238 orotidine 5'-phosphate decarboxylase [Candidatus Liberi
PRK00230230 PRK00230, PRK00230, orotidine 5'-phosphate decarboxylas 1e-73
cd04725216 cd04725, OMP_decarboxylase_like, Orotidine 5'-phosphate 2e-49
TIGR01740213 TIGR01740, pyrF, orotidine 5'-phosphate decarboxylase, 2e-47
pfam00215218 pfam00215, OMPdecase, Orotidine 5'-phosphate decarboxyl 8e-43
PRK13813215 PRK13813, PRK13813, orotidine 5'-phosphate decarboxylas 2e-26
cd04726202 cd04726, KGPDC_HPS, 3-Keto-L-gulonate 6-phosphate decar 1e-07
COG0269217 COG0269, SgbH, 3-hexulose-6-phosphate synthase and rela 1e-07
COG0284240 COG0284, PyrF, Orotidine-5'-phosphate decarboxylase [Nu 4e-51
>gnl|CDD|178939 PRK00230, PRK00230, orotidine 5'-phosphate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|73387 cd04725, OMP_decarboxylase_like, Orotidine 5'-phosphate decarboxylase (ODCase) is a dimeric enzyme that decarboxylates orotidine 5'-monophosphate (OMP) to form uridine 5'-phosphate (UMP), an essential step in the pyrimidine biosynthetic pathway Back     alignment and domain information
>gnl|CDD|162513 TIGR01740, pyrF, orotidine 5'-phosphate decarboxylase, subfamily 1 Back     alignment and domain information
>gnl|CDD|143972 pfam00215, OMPdecase, Orotidine 5'-phosphate decarboxylase / HUMPS family Back     alignment and domain information
>gnl|CDD|184343 PRK13813, PRK13813, orotidine 5'-phosphate decarboxylase; Provisional Back     alignment and domain information
>gnl|CDD|73388 cd04726, KGPDC_HPS, 3-Keto-L-gulonate 6-phosphate decarboxylase (KGPDC) and D-arabino-3-hexulose-6-phosphate synthase (HPS) Back     alignment and domain information
>gnl|CDD|30618 COG0269, SgbH, 3-hexulose-6-phosphate synthase and related proteins [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|30632 COG0284, PyrF, Orotidine-5'-phosphate decarboxylase [Nucleotide transport and metabolism] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 238 orotidine 5'-phosphate decarboxylase [Candidatus Liberi
PRK00230231 orotidine 5'-phosphate decarboxylase; Reviewed 100.0
TIGR01740233 pyrF orotidine 5'-phosphate decarboxylase; InterPro: IP 100.0
COG0284240 PyrF Orotidine-5'-phosphate decarboxylase [Nucleotide t 100.0
cd04725216 OMP_decarboxylase_like Orotidine 5'-phosphate decarboxy 100.0
pfam00215218 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS 100.0
PRK13813215 orotidine 5'-phosphate decarboxylase; Provisional 100.0
cd04726202 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxylase ( 100.0
TIGR03128206 RuMP_HxlA 3-hexulose-6-phosphate synthase. at the cost 100.0
PRK13306216 ulaD 3-keto-L-gulonate-6-phosphate decarboxylase; Provi 100.0
PRK13305220 sgbH 3-keto-L-gulonate-6-phosphate decarboxylase; Provi 99.95
PRK07028 429 bifunctional hexulose-6-phosphate synthase/ribonuclease 99.95
COG0269217 SgbH 3-hexulose-6-phosphate synthase and related protei 99.93
PRK13307392 bifunctional formaldehyde-activating enzyme/3-hexulose- 99.92
PRK05500 478 bifunctional orotidine 5'-phosphate decarboxylase/orota 99.92
PRK00125277 pyrF orotidine 5'-phosphate decarboxylase; Reviewed 99.88
KOG1377261 consensus 99.86
TIGR02127306 pyrF_sub2 orotidine 5'-phosphate decarboxylase; InterPr 99.8
PTZ00170224 D-ribulose-5-phosphate 3-epimerase; Provisional 99.15
PRK08745223 ribulose-phosphate 3-epimerase; Provisional 99.02
PRK08883220 ribulose-phosphate 3-epimerase; Provisional 99.01
PRK08091235 ribulose-phosphate 3-epimerase; Validated 98.91
PRK08005210 ribulose-phosphate 3-epimerase; Validated 98.86
PRK05581220 ribulose-phosphate 3-epimerase; Validated 98.86
TIGR01163216 rpe ribulose-phosphate 3-epimerase; InterPro: IPR000056 98.69
cd00429211 RPE Ribulose-5-phosphate 3-epimerase (RPE). This enzyme 98.67
PRK09722227 allulose-6-phosphate 3-epimerase; Provisional 98.6
COG0036220 Rpe Pentose-5-phosphate-3-epimerase [Carbohydrate trans 98.59
KOG3111224 consensus 98.58
pfam00834201 Ribul_P_3_epim Ribulose-phosphate 3 epimerase family. T 98.08
PRK13125247 trpA tryptophan synthase subunit alpha; Provisional 98.04
PRK13127262 consensus 97.69
PRK13113263 consensus 97.66
PRK13135267 consensus 97.64
pfam00290258 Trp_syntA Tryptophan synthase alpha chain. 97.63
PRK13124257 consensus 97.63
cd04722200 TIM_phosphate_binding TIM barrel proteins share a struc 97.61
CHL00200263 trpA tryptophan synthase alpha subunit; Provisional 97.61
PRK13117268 consensus 97.6
PRK13139254 consensus 97.57
PRK13129267 consensus 97.55
PRK13111256 trpA tryptophan synthase subunit alpha; Provisional 97.54
PRK13118269 consensus 97.53
PRK13114266 consensus 97.51
PRK13140257 consensus 97.5
PRK08227291 aldolase; Validated 97.45
PRK13119261 consensus 97.45
PRK13126237 consensus 97.42
PRK13131257 consensus 97.42
PRK13121265 consensus 97.39
cd00958235 DhnA Class I fructose-1,6-bisphosphate (FBP) aldolases 97.36
PRK13133267 consensus 97.32
PRK13137266 consensus 97.24
PRK06512221 thiamine-phosphate pyrophosphorylase; Provisional 97.23
PRK13112279 consensus 97.18
PRK13123256 consensus 97.17
PRK13122242 consensus 97.15
PRK13138264 consensus 97.14
PRK13597252 imidazole glycerol phosphate synthase subunit HisF; Pro 97.14
PRK13132246 consensus 97.11
PRK13115269 consensus 97.09
cd04724242 Tryptophan_synthase_alpha Ttryptophan synthase (TRPS) a 96.92
PRK01130222 N-acetylmannosamine-6-phosphate 2-epimerase; Provisiona 96.87
pfam05690246 ThiG Thiazole biosynthesis protein ThiG. This family co 96.84
PRK07455210 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphoglucon 96.83
PRK13134257 consensus 96.78
PRK13116278 consensus 96.72
cd04728248 ThiG Thiazole synthase (ThiG) is the tetrameric enzyme 96.67
TIGR01949259 AroFGH_arch predicted phospho-2-dehydro-3-deoxyheptonat 96.61
PRK00208256 thiG thiazole synthase; Reviewed 96.57
PRK13136253 consensus 96.57
PRK07114223 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphoglucon 96.54
COG3010229 NanE Putative N-acetylmannosamine-6-phosphate epimerase 96.22
PRK00043210 thiE thiamine-phosphate pyrophosphorylase; Reviewed 96.2
PRK06552209 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphoglucon 96.05
PRK13120285 consensus 95.95
cd04727283 pdxS PdxS is a subunit of the pyridoxal 5'-phosphate (P 95.91
PRK04180293 pyridoxine biosynthesis protein; Provisional 95.79
PRK09140206 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; Review 95.68
PRK07695202 transcriptional regulator TenI; Provisional 95.46
COG0159265 TrpA Tryptophan synthase alpha chain [Amino acid transp 95.29
PRK06015212 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphoglucon 95.17
PRK02145257 consensus 94.84
pfam01081196 Aldolase KDPG and KHG aldolase. This family includes th 94.74
PRK09517 738 multifunctional thiamine-phosphate pyrophosphorylase/sy 94.59
CHL00162267 thiG thiamin biosynthesis protein G; Validated 94.12
PRK11858 378 aksA trans-homoaconitate synthase; Reviewed 94.01
COG2022262 ThiG Uncharacterized enzyme of thiazole biosynthesis [N 93.44
PRK08104212 consensus 93.42
PRK11840327 bifunctional sulfur carrier protein/thiazole synthase p 93.42
TIGR02146 355 LysS_fung_arch homocitrate synthase; InterPro: IPR01187 93.32
cd00945201 Aldolase_Class_I Class I aldolases. The class I aldolas 93.31
PRK00507221 deoxyribose-phosphate aldolase; Provisional 93.08
cd04729219 NanE N-acetylmannosamine-6-phosphate epimerase (NanE) c 93.08
cd00959203 DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of the D 92.87
TIGR03217333 4OH_2_O_val_ald 4-hydroxy-2-oxovalerate aldolase. Membe 92.17
cd00331217 IGPS Indole-3-glycerol phosphate synthase (IGPS); an en 92.07
PRK08195337 4-hydroxy-2-ketovalerate aldolase; Validated 91.8
PRK01362214 putative translaldolase; Provisional 91.59
PRK06857209 consensus 91.33
PRK05718212 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphoglucon 90.86
PRK00915 511 2-isopropylmalate synthase; Validated 90.68
cd04732234 HisA HisA. Phosphoribosylformimino-5-aminoimidazole car 90.57
KOG4175268 consensus 90.15
pfam04131192 NanE Putative N-acetylmannosamine-6-phosphate epimerase 97.26
COG0214296 SNZ1 Pyridoxine biosynthesis enzyme [Coenzyme metabolis 95.6
PRK03512211 thiamine-phosphate pyrophosphorylase; Provisional 94.53
KOG1606296 consensus 94.09
PRK13802 695 bifunctional indole-3-glycerol phosphate synthase/trypt 93.58
TIGR00343298 TIGR00343 pyridoxine biosynthesis protein; InterPro: IP 93.48
PRK00278261 trpC indole-3-glycerol-phosphate synthase; Reviewed 92.67
PRK07226266 fructose-bisphosphate aldolase; Provisional 97.12
COG1830265 FbaB DhnA-type fructose-1,6-bisphosphate aldolase and r 96.35
PRK02621254 consensus 94.82
PRK03220257 consensus 94.71
pfam03060330 NPD 2-nitropropane dioxygenase. Members of this family 94.61
cd04730236 NPD_like 2-Nitropropane dioxygenase (NPD), one of the n 94.53
TIGR00007241 TIGR00007 phosphoribosylformimino-5-aminoimidazole carb 94.48
cd04731243 HisF The cyclase subunit of imidazoleglycerol phosphate 94.37
PRK13587234 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylid 93.89
COG0106241 HisA Phosphoribosylformimino-5-aminoimidazole carboxami 93.72
cd04735353 OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN bind 92.9
PRK01659252 consensus 91.61
PRK13523337 NADPH dehydrogenase NamA; Provisional 91.3
PRK04302223 triosephosphate isomerase; Provisional 91.21
PRK02083253 imidazole glycerol phosphate synthase subunit HisF; Pro 91.17
PRK06852303 aldolase; Validated 91.0
cd02931382 ER_like_FMN Enoate reductase (ER)-like FMN-binding doma 90.89
cd02803327 OYE_like_FMN_family Old yellow enzyme (OYE)-like FMN bi 90.59
PRK12330 499 oxaloacetate decarboxylase; Provisional 90.57
cd02930353 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-binding dom 90.36
PRK00748241 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylid 90.18
PRK02615345 thiamine-phosphate pyrophosphorylase; Provisional 97.04
pfam01884231 PcrB PcrB family. This family contains proteins that ar 96.58
PRK04169229 geranylgeranylglyceryl phosphate synthase-like protein; 96.33
cd02812219 PcrB_like PcrB_like proteins. One member of this family 96.24
COG0352211 ThiE Thiamine monophosphate synthase [Coenzyme metaboli 95.96
cd02809299 alpha_hydroxyacid_oxid_FMN Family of homologous FMN-dep 95.85
pfam01070301 FMN_dh FMN-dependent dehydrogenase. 95.45
cd02811326 IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl diphosp 95.3
cd03332383 LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-binding dom 95.3
cd04737351 LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding domain 95.3
PRK11197381 lldD L-lactate dehydrogenase; Provisional 95.19
cd00564196 TMP_TenI Thiamine monophosphate synthase (TMP synthase) 94.87
cd04736361 MDH_FMN Mandelate dehydrogenase (MDH)-like FMN-binding 94.36
cd02922344 FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding domain. 94.24
KOG0538363 consensus 92.43
pfam00218254 IGPS Indole-3-glycerol phosphate synthase. 92.43
PRK06512221 thiamine-phosphate pyrophosphorylase; Provisional 92.2
TIGR01768242 GGGP-family geranylgeranylglyceryl phosphate synthase f 92.08
PRK05437351 isopentenyl pyrophosphate isomerase; Provisional 92.06
PRK02615345 thiamine-phosphate pyrophosphorylase; Provisional 91.82
COG1646240 Predicted phosphate-binding enzymes, TIM-barrel fold [G 91.22
cd01573272 modD_like ModD; Quinolinate phosphoribosyl transferase 90.78
cd01572268 QPRTase Quinolinate phosphoribosyl transferase (QAPRTas 90.45
pfam02679245 ComA (2R)-phospho-3-sulfolactate synthase (ComA). In me 96.91
PRK09310 477 aroDE bifunctional 3-dehydroquinate dehydratase/shikima 93.9
pfam01487222 DHquinase_I Type I 3-dehydroquinase. Type I 3-dehydroqu 90.02
PRK13585240 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylid 94.58
KOG3157244 consensus 93.89
pfam00977229 His_biosynth Histidine biosynthesis protein. Proteins i 91.38
cd02809299 alpha_hydroxyacid_oxid_FMN Family of homologous FMN-dep 94.5
TIGR03470318 HpnH hopanoid biosynthesis associated radical SAM prote 92.31
TIGR00959 439 ffh signal recognition particle protein; InterPro: IPR0 92.07
>PRK00230 orotidine 5'-phosphate decarboxylase; Reviewed Back     alignment and domain information
>TIGR01740 pyrF orotidine 5'-phosphate decarboxylase; InterPro: IPR014732 Orotidine 5'-phosphate decarboxylase (OMPdecase) (4 Back     alignment and domain information
>COG0284 PyrF Orotidine-5'-phosphate decarboxylase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd04725 OMP_decarboxylase_like Orotidine 5'-phosphate decarboxylase (ODCase) is a dimeric enzyme that decarboxylates orotidine 5'-monophosphate (OMP) to form uridine 5'-phosphate (UMP), an essential step in the pyrimidine biosynthetic pathway Back     alignment and domain information
>pfam00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family Back     alignment and domain information
>PRK13813 orotidine 5'-phosphate decarboxylase; Provisional Back     alignment and domain information
>cd04726 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxylase (KGPDC) and D-arabino-3-hexulose-6-phosphate synthase (HPS) Back     alignment and domain information
>TIGR03128 RuMP_HxlA 3-hexulose-6-phosphate synthase Back     alignment and domain information
>PRK13306 ulaD 3-keto-L-gulonate-6-phosphate decarboxylase; Provisional Back     alignment and domain information
>PRK13305 sgbH 3-keto-L-gulonate-6-phosphate decarboxylase; Provisional Back     alignment and domain information
>PRK07028 bifunctional hexulose-6-phosphate synthase/ribonuclease regulator; Validated Back     alignment and domain information
>COG0269 SgbH 3-hexulose-6-phosphate synthase and related proteins [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK13307 bifunctional formaldehyde-activating enzyme/3-hexulose-6-phosphate synthase; Provisional Back     alignment and domain information
>PRK05500 bifunctional orotidine 5'-phosphate decarboxylase/orotate phosphoribosyltransferase protein; Validated Back     alignment and domain information
>PRK00125 pyrF orotidine 5'-phosphate decarboxylase; Reviewed Back     alignment and domain information
>KOG1377 consensus Back     alignment and domain information
>TIGR02127 pyrF_sub2 orotidine 5'-phosphate decarboxylase; InterPro: IPR011995 Orotidine 5'-phosphate decarboxylase (OMPdecase) , catalyzes the last step in the de novo biosynthesis of pyrimidines, the decarboxylation of OMP into UMP Back     alignment and domain information
>PTZ00170 D-ribulose-5-phosphate 3-epimerase; Provisional Back     alignment and domain information
>PRK08745 ribulose-phosphate 3-epimerase; Provisional Back     alignment and domain information
>PRK08883 ribulose-phosphate 3-epimerase; Provisional Back     alignment and domain information
>PRK08091 ribulose-phosphate 3-epimerase; Validated Back     alignment and domain information
>PRK08005 ribulose-phosphate 3-epimerase; Validated Back     alignment and domain information
>PRK05581 ribulose-phosphate 3-epimerase; Validated Back     alignment and domain information
>TIGR01163 rpe ribulose-phosphate 3-epimerase; InterPro: IPR000056 Ribulose-phosphate 3-epimerase (5 Back     alignment and domain information
>cd00429 RPE Ribulose-5-phosphate 3-epimerase (RPE) Back     alignment and domain information
>PRK09722 allulose-6-phosphate 3-epimerase; Provisional Back     alignment and domain information
>COG0036 Rpe Pentose-5-phosphate-3-epimerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG3111 consensus Back     alignment and domain information
>pfam00834 Ribul_P_3_epim Ribulose-phosphate 3 epimerase family Back     alignment and domain information
>PRK13125 trpA tryptophan synthase subunit alpha; Provisional Back     alignment and domain information
>PRK13127 consensus Back     alignment and domain information
>PRK13113 consensus Back     alignment and domain information
>PRK13135 consensus Back     alignment and domain information
>pfam00290 Trp_syntA Tryptophan synthase alpha chain Back     alignment and domain information
>PRK13124 consensus Back     alignment and domain information
>cd04722 TIM_phosphate_binding TIM barrel proteins share a structurally conserved phosphate binding motif and in general share an eight beta/alpha closed barrel structure Back     alignment and domain information
>CHL00200 trpA tryptophan synthase alpha subunit; Provisional Back     alignment and domain information
>PRK13117 consensus Back     alignment and domain information
>PRK13139 consensus Back     alignment and domain information
>PRK13129 consensus Back     alignment and domain information
>PRK13111 trpA tryptophan synthase subunit alpha; Provisional Back     alignment and domain information
>PRK13118 consensus Back     alignment and domain information
>PRK13114 consensus Back     alignment and domain information
>PRK13140 consensus Back     alignment and domain information
>PRK08227 aldolase; Validated Back     alignment and domain information
>PRK13119 consensus Back     alignment and domain information
>PRK13126 consensus Back     alignment and domain information
>PRK13131 consensus Back     alignment and domain information
>PRK13121 consensus Back     alignment and domain information
>cd00958 DhnA Class I fructose-1,6-bisphosphate (FBP) aldolases of the archaeal type (DhnA homologs) found in bacteria and archaea Back     alignment and domain information
>PRK13133 consensus Back     alignment and domain information
>PRK13137 consensus Back     alignment and domain information
>PRK06512 thiamine-phosphate pyrophosphorylase; Provisional Back     alignment and domain information
>PRK13112 consensus Back     alignment and domain information
>PRK13123 consensus Back     alignment and domain information
>PRK13122 consensus Back     alignment and domain information
>PRK13138 consensus Back     alignment and domain information
>PRK13597 imidazole glycerol phosphate synthase subunit HisF; Provisional Back     alignment and domain information
>PRK13132 consensus Back     alignment and domain information
>PRK13115 consensus Back     alignment and domain information
>cd04724 Tryptophan_synthase_alpha Ttryptophan synthase (TRPS) alpha subunit (TSA) Back     alignment and domain information
>PRK01130 N-acetylmannosamine-6-phosphate 2-epimerase; Provisional Back     alignment and domain information
>pfam05690 ThiG Thiazole biosynthesis protein ThiG Back     alignment and domain information
>PRK07455 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PRK13134 consensus Back     alignment and domain information
>PRK13116 consensus Back     alignment and domain information
>cd04728 ThiG Thiazole synthase (ThiG) is the tetrameric enzyme that is involved in the formation of the thiazole moiety of thiamin pyrophosphate, an essential ubiquitous cofactor that plays an important role in carbohydrate and amino acid metabolism Back     alignment and domain information
>TIGR01949 AroFGH_arch predicted phospho-2-dehydro-3-deoxyheptonate aldolase; InterPro: IPR010210 This entry represents a clade of primarily archaeal sequences related to fructose-bisphosphate aldolase Back     alignment and domain information
>PRK00208 thiG thiazole synthase; Reviewed Back     alignment and domain information
>PRK13136 consensus Back     alignment and domain information
>PRK07114 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>COG3010 NanE Putative N-acetylmannosamine-6-phosphate epimerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK00043 thiE thiamine-phosphate pyrophosphorylase; Reviewed Back     alignment and domain information
>PRK06552 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PRK13120 consensus Back     alignment and domain information
>cd04727 pdxS PdxS is a subunit of the pyridoxal 5'-phosphate (PLP) synthase, an important enzyme in deoxyxylulose 5-phosphate (DXP)-independent pathway for de novo biosynthesis of PLP, present in some eubacteria, in archaea, fungi, plants, plasmodia, and some metazoa Back     alignment and domain information
>PRK04180 pyridoxine biosynthesis protein; Provisional Back     alignment and domain information
>PRK09140 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; Reviewed Back     alignment and domain information
>PRK07695 transcriptional regulator TenI; Provisional Back     alignment and domain information
>COG0159 TrpA Tryptophan synthase alpha chain [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06015 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PRK02145 consensus Back     alignment and domain information
>pfam01081 Aldolase KDPG and KHG aldolase Back     alignment and domain information
>PRK09517 multifunctional thiamine-phosphate pyrophosphorylase/synthase/phosphomethylpyrimidine kinase; Provisional Back     alignment and domain information
>CHL00162 thiG thiamin biosynthesis protein G; Validated Back     alignment and domain information
>PRK11858 aksA trans-homoaconitate synthase; Reviewed Back     alignment and domain information
>COG2022 ThiG Uncharacterized enzyme of thiazole biosynthesis [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK08104 consensus Back     alignment and domain information
>PRK11840 bifunctional sulfur carrier protein/thiazole synthase protein; Provisional Back     alignment and domain information
>TIGR02146 LysS_fung_arch homocitrate synthase; InterPro: IPR011872 This entry includes the yeast LYS21 gene which carries out the first step of the alpha-aminoadipate (AAA) lysine biosynthesis pathway Back     alignment and domain information
>cd00945 Aldolase_Class_I Class I aldolases Back     alignment and domain information
>PRK00507 deoxyribose-phosphate aldolase; Provisional Back     alignment and domain information
>cd04729 NanE N-acetylmannosamine-6-phosphate epimerase (NanE) converts N-acetylmannosamine-6-phosphate to N-acetylglucosamine-6-phosphate Back     alignment and domain information
>cd00959 DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of the DeoC family Back     alignment and domain information
>TIGR03217 4OH_2_O_val_ald 4-hydroxy-2-oxovalerate aldolase Back     alignment and domain information
>cd00331 IGPS Indole-3-glycerol phosphate synthase (IGPS); an enzyme in the tryptophan biosynthetic pathway, catalyzing the ring closure reaction of 1-(o-carboxyphenylamino)-1-deoxyribulose-5-phosphate (CdRP) to indole-3-glycerol phosphate (IGP), accompanied by the release of carbon dioxide and water Back     alignment and domain information
>PRK08195 4-hydroxy-2-ketovalerate aldolase; Validated Back     alignment and domain information
>PRK01362 putative translaldolase; Provisional Back     alignment and domain information
>PRK06857 consensus Back     alignment and domain information
>PRK05718 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PRK00915 2-isopropylmalate synthase; Validated Back     alignment and domain information
>cd04732 HisA HisA Back     alignment and domain information
>KOG4175 consensus Back     alignment and domain information
>pfam04131 NanE Putative N-acetylmannosamine-6-phosphate epimerase Back     alignment and domain information
>COG0214 SNZ1 Pyridoxine biosynthesis enzyme [Coenzyme metabolism] Back     alignment and domain information
>PRK03512 thiamine-phosphate pyrophosphorylase; Provisional Back     alignment and domain information
>KOG1606 consensus Back     alignment and domain information
>PRK13802 bifunctional indole-3-glycerol phosphate synthase/tryptophan synthase subunit beta; Provisional Back     alignment and domain information
>TIGR00343 TIGR00343 pyridoxine biosynthesis protein; InterPro: IPR001852 Snz1p is a highly conserved protein involved in growth arrest in S Back     alignment and domain information
>PRK00278 trpC indole-3-glycerol-phosphate synthase; Reviewed Back     alignment and domain information
>PRK07226 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>COG1830 FbaB DhnA-type fructose-1,6-bisphosphate aldolase and related enzymes [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK02621 consensus Back     alignment and domain information
>PRK03220 consensus Back     alignment and domain information
>pfam03060 NPD 2-nitropropane dioxygenase Back     alignment and domain information
>cd04730 NPD_like 2-Nitropropane dioxygenase (NPD), one of the nitroalkane oxidizing enzyme families, catalyzes oxidative denitrification of nitroalkanes to their corresponding carbonyl compounds and nitrites Back     alignment and domain information
>TIGR00007 TIGR00007 phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase; InterPro: IPR006063 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase (5 Back     alignment and domain information
>cd04731 HisF The cyclase subunit of imidazoleglycerol phosphate synthase (HisF) Back     alignment and domain information
>PRK13587 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>COG0106 HisA Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase [Amino acid transport and metabolism] Back     alignment and domain information
>cd04735 OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 4 Back     alignment and domain information
>PRK01659 consensus Back     alignment and domain information
>PRK13523 NADPH dehydrogenase NamA; Provisional Back     alignment and domain information
>PRK04302 triosephosphate isomerase; Provisional Back     alignment and domain information
>PRK02083 imidazole glycerol phosphate synthase subunit HisF; Provisional Back     alignment and domain information
>PRK06852 aldolase; Validated Back     alignment and domain information
>cd02931 ER_like_FMN Enoate reductase (ER)-like FMN-binding domain Back     alignment and domain information
>cd02803 OYE_like_FMN_family Old yellow enzyme (OYE)-like FMN binding domain Back     alignment and domain information
>PRK12330 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>cd02930 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-binding domain Back     alignment and domain information
>PRK00748 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Validated Back     alignment and domain information
>PRK02615 thiamine-phosphate pyrophosphorylase; Provisional Back     alignment and domain information
>pfam01884 PcrB PcrB family Back     alignment and domain information
>PRK04169 geranylgeranylglyceryl phosphate synthase-like protein; Reviewed Back     alignment and domain information
>cd02812 PcrB_like PcrB_like proteins Back     alignment and domain information
>COG0352 ThiE Thiamine monophosphate synthase [Coenzyme metabolism] Back     alignment and domain information
>cd02809 alpha_hydroxyacid_oxid_FMN Family of homologous FMN-dependent alpha-hydroxyacid oxidizing enzymes Back     alignment and domain information
>pfam01070 FMN_dh FMN-dependent dehydrogenase Back     alignment and domain information
>cd02811 IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl diphosphate isomerase type 2 (IDI-2) FMN-binding domain Back     alignment and domain information
>cd03332 LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-binding domain Back     alignment and domain information
>cd04737 LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding domain Back     alignment and domain information
>PRK11197 lldD L-lactate dehydrogenase; Provisional Back     alignment and domain information
>cd00564 TMP_TenI Thiamine monophosphate synthase (TMP synthase)/TenI Back     alignment and domain information
>cd04736 MDH_FMN Mandelate dehydrogenase (MDH)-like FMN-binding domain Back     alignment and domain information
>cd02922 FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding domain Back     alignment and domain information
>KOG0538 consensus Back     alignment and domain information
>pfam00218 IGPS Indole-3-glycerol phosphate synthase Back     alignment and domain information
>PRK06512 thiamine-phosphate pyrophosphorylase; Provisional Back     alignment and domain information
>TIGR01768 GGGP-family geranylgeranylglyceryl phosphate synthase family protein; InterPro: IPR008205 This family contains prokaryotic proteins that are related to pcrB Back     alignment and domain information
>PRK05437 isopentenyl pyrophosphate isomerase; Provisional Back     alignment and domain information
>PRK02615 thiamine-phosphate pyrophosphorylase; Provisional Back     alignment and domain information
>COG1646 Predicted phosphate-binding enzymes, TIM-barrel fold [General function prediction only] Back     alignment and domain information
>cd01573 modD_like ModD; Quinolinate phosphoribosyl transferase (QAPRTase or QPRTase) present in some modABC operons in bacteria, which are involved in molybdate transport Back     alignment and domain information
>cd01572 QPRTase Quinolinate phosphoribosyl transferase (QAPRTase or QPRTase), also called nicotinate-nucleotide pyrophosphorylase, is involved in the de novo synthesis of NAD in both prokaryotes and eukaryotes Back     alignment and domain information
>pfam02679 ComA (2R)-phospho-3-sulfolactate synthase (ComA) Back     alignment and domain information
>PRK09310 aroDE bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase protein; Reviewed Back     alignment and domain information
>pfam01487 DHquinase_I Type I 3-dehydroquinase Back     alignment and domain information
>PRK13585 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>KOG3157 consensus Back     alignment and domain information
>pfam00977 His_biosynth Histidine biosynthesis protein Back     alignment and domain information
>cd02809 alpha_hydroxyacid_oxid_FMN Family of homologous FMN-dependent alpha-hydroxyacid oxidizing enzymes Back     alignment and domain information
>TIGR03470 HpnH hopanoid biosynthesis associated radical SAM protein HpnH Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein; InterPro: IPR004780 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes , Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target238 orotidine 5'-phosphate decarboxylase [Candidatus Liberi
3ldv_A255 1.77 Angstrom Resolution Crystal Structure Of Oroti 2e-47
1eix_A245 Structure Of Orotidine 5'-Monophosphate Decarboxyla 5e-45
1jjk_A245 Selenomethionine Substitution Of Orotidine-5'-Monop 7e-42
2yyt_A246 Crystal Structure Of Uncharacterized Conserved Prot 3e-38
1dbt_A239 Crystal Structure Of Orotidine 5'-Monophosphate Dec 4e-36
2cz5_A208 Crystal Structure Of Orotidine 5'-Phosphate Decarbo 3e-25
3nqg_A228 Crystal Structure Of The Mutant V155d Of Orotidine 8e-23
3nqd_A228 Crystal Structure Of The Mutant I96t Of Orotidine 5 2e-22
3nqc_A228 Crystal Structure Of The Mutant I96s Of Orotidine 5 2e-22
3llf_A228 Crystal Structure Of The Mutant S127p Of Orotidine 2e-22
3nqm_A228 Crystal Structure Of The Mutant V155s Of Orotidine 2e-22
3g18_A228 Crystal Structure Of Orotidine 5'-Monophosphate Dec 3e-22
1klz_A247 Crystal Structure Of Orotidine Monophosphate Decarb 3e-22
3nqa_A228 Crystal Structure Of The Mutant F100a Of Orotidine 3e-22
3nqf_A228 Crystal Structure Of The Mutant L123s Of Orotidine 3e-22
3nqe_A228 Crystal Structure Of The Mutant L123n Of Orotidine 3e-22
1km1_A247 Orotidine Monophosphate Decarboxylase Mutant S127a 4e-22
3nq7_A228 Crystal Structure Of The Mutant F71a Of Orotidine 5 4e-22
1x1z_A252 Orotidine 5'-Monophosphate Decarboxylase (Odcase) C 4e-22
1kly_A247 Orotidine Monophosphate Decarboxylase D70g Mutant C 5e-22
3lld_A228 Crystal Structure Of The Mutant S127g Of Orotidine 5e-22
3nq6_A228 Crystal Structure Of The Mutant P180a Of Orotidine 5e-22
2zz3_A252 Covalent Complex Of Orotidine Monophosphate Decarbo 5e-22
3lv6_A228 Crystal Structure Of The Mutant I218f Of Orotidine 5e-22
3g1s_A228 Crystal Structure Of The Mutant D70g Of Orotidine 5 6e-22
1km2_A247 Crystal Structure Of Orotidine Monophosphate Mutant 6e-22
3g1y_A228 Crystal Structure Of The Mutant D70n Of Orotidine 5 6e-22
1km0_A247 Crystal Structure Of Orotidine Monophosphate Decarb 7e-22
3lhw_A228 Crystal Structure Of The Mutant V182a Of Orotidine 7e-22
1km4_A247 Crystal Structure Of Odcase Mutant K72a Complexed W 8e-22
2zz2_A252 Orotidine Monophosphate Decarboxylase K72a Mutant F 1e-21
1km6_A247 Crystal Structure Of Odcase Mutant D70ak72a Complex 1e-21
3lhy_A228 Crystal Structure Of The Mutant I199a Of Orotidine 1e-21
3lhu_A228 Crystal Structure Of The Mutant I199f Of Orotidine 1e-21
2zz5_A252 Orotidine Monophosphate Deacarboxylase D70aK72A DOU 1e-21
1lor_A228 Crystal Structure Of Orotidine 5'-Monophosphate Com 1e-21
1loq_A228 Crystal Structure Of Orotidine Monophosphate Decarb 2e-21
1lol_A229 Crystal Structure Of Orotidine Monophosphate Decarb 2e-21
3li1_A228 Crystal Structure Of The Mutant I218a Of Orotidine 2e-21
1dv7_A227 Crystal Structure Of Orotidine Monophosphate Decarb 2e-21
3lv5_A228 Crystal Structure Of The Mutant I199e Of Orotidine 2e-21
1dvj_A246 Crystal Structure Of Orotidine Monophosphate Decarb 2e-21
1km5_A247 Crystal Structure Of Odcase Mutant D75n Complexed W 3e-21
3lts_A228 Crystal Structure Of The Mutant V182a,I199a Of Orot 3e-21
3lhz_A228 Crystal Structure Of The Mutant V201a Of Orotidine 3e-21
2zz4_A252 Covalent Complex Of Orotidine Monophosphate Decarbo 4e-21
3lty_A228 Crystal Structure Of The Mutant V182a,I218a Of Orot 4e-21
3bvj_A312 Crystal Structure Of Human Orotidine 5'-Monophospha 5e-21
3bk0_A279 Crystal Structure Of Human Orotidine 5'-Monophospha 5e-21
2qcc_A260 Crystal Structure Of The Orotidine-5'-Monophosphate 5e-21
2jgy_A279 The Crystal Structure Of Human Orotidine-5'-Decarbo 5e-21
2eaw_A291 Human Ump Synthase (C-Terminal Domain- Orotidine 5' 5e-21
3lht_A228 Crystal Structure Of The Mutant V201f Of Orotidine 5e-21
2p1f_A291 Human Ump Synthase (C-Terminal Domain-Orotidine 5'- 6e-21
2qcd_A260 Crystal Structure Of The Orotidine-5'-Monophosphate 6e-21
3g3m_A279 Crystal Structure Of Human Orotidine 5'-Monophospha 6e-21
3m1z_A228 Crystal Structure Of The Mutant V182a.V201a Of Orot 7e-21
1km3_A247 Crystal Structure Of Odcase Mutant K42a Complexed W 1e-20
2qcf_A260 Crystal Structure Of The Orotidine-5'-Monophosphate 1e-20
3li0_A228 Crystal Structure Of The Mutant R203a Of Orotidine 1e-20
3ewx_A260 K314a Mutant Of Human Orotidyl-5'-Monophosphate Dec 2e-20
3lhv_A228 Crystal Structure Of The Mutant V182a.I199a.V201a O 3e-20
1los_A224 Crystal Structure Of Orotidine Monophosphate Decarb 2e-18
3gdk_A267 Crystal Structure Of The Orotidine 5'-Monophosphate 1e-13
1dqw_A267 Crystal Structure Of Orotidine 5'-Phosphate Decarbo 1e-13
3gdr_A267 Crystal Structure Of The D91n Mutant Of The Orotidi 3e-13
3gdm_A267 Crystal Structure Of The K93r Mutant Of The Orotidi 9e-13
1vqt_A213 Crystal Structure Of Orotidine 5'-Phosphate Decarbo 7e-12
3f4w_A211 The 1.65a Crystal Structure Of 3-Hexulose-6-Phospha 6e-11
2ffc_A353 Crystal Structure Of Plasmodium Vivax Orotidine- Mo 4e-09
2guu_A353 Crystal Structure Of Plasmodium Vivax Orotidine 5- 5e-09
2fds_A352 Crystal Structure Of Plasmodium Berghei Orotidine 5 2e-08
3exr_A221 Crystal Structure Of Kgpdc From Streptococcus Mutan 4e-08
2aqw_A332 Structure Of Putative Orotidine-Monophosphate-Decar 4e-07
2q8z_A342 Crystal Structure Of Plasmodium Falciparum Orotidin 7e-07
1so5_A216 Crystal Structure Of E112q Mutant Of 3-Keto-L-Gulon 1e-06
2f84_A323 Crystal Structure Of An Orotidine-5'-Monophosphate 1e-06
1xby_A216 Structure Of 3-Keto-L-Gulonate 6-Phosphate Decarbox 1e-06
1kv8_A216 Crystal Structure Of 3-Keto-L-Gulonate 6-Phosphate 1e-06
1so6_A216 Crystal Structure Of E112qH136A DOUBLE MUTANT OF 3- 2e-06
1xbx_A216 Structure Of 3-Keto-L-Gulonate 6-Phosphate Decarbox 2e-06
1so3_A216 Crystal Structure Of H136a Mutant Of 3-Keto-L-Gulon 2e-06
1so4_A216 Crystal Structure Of K64a Mutant Of 3-Keto-L-Gulona 4e-06
3ajx_A207 Crystal Structure Of 3-Hexulose-6-Phosphate Synthas 6e-06
3qw3_A255 Structure Of Leishmania Donovani Omp Decarboxylase 7e-04
3qw4_B 453 Structure Of Leishmania Donovani Ump Synthase Lengt 8e-04
3ieb_A218 Crystal Structure Of 3-Keto-L-Gulonate-6-Phosphate 0.002
>gi|284794161|pdb|3LDV|A Chain A, 1.77 Angstrom Resolution Crystal Structure Of Orotidine 5'- Phosphate Decarboxylase From Vibrio Cholerae O1 Biovar Eltor Str. N16961 Length = 255 Back     alignment and structure
 Score =  193 bits (489), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 72/230 (31%), Positives = 114/230 (49%), Gaps = 5/230 (2%)

Query: 10  DEKKRLVVGLDLPTVKEAERIVSILSDTVSFYKIGYHLSFSGGLELARDLISDGKSVFLD 69
               +++V LD   + +A   V  +  +    K+G  +    G +  R+L   G SVFLD
Sbjct: 25  MNDPKVIVALDYDNLADALAFVDKIDPSTCRLKVGKEMFTLFGPDFVRELHKRGFSVFLD 84

Query: 70  MKLFDIGSSVTAAIEHIANMGVAMLTVHAYPQTMRSAV-----SVVRDTGICLLAVTVLT 124
           +K  DI ++ + A++  A +GV M+ VHA       A               L+ VTVLT
Sbjct: 85  LKFHDIPNTCSKAVKAAAELGVWMVNVHASGGERMMAASREILEPYGKERPLLIGVTVLT 144

Query: 125 SMDDFDLRESGYEKDISDMVRMRAVQARDIGMGGIVCSPQEVRMVREIVGHNMVIVTPGI 184
           SM+  DL+  G      D V   A   ++ G+ G+VCS QE  ++++ +G    +VTPGI
Sbjct: 145 SMESADLQGIGILSAPQDHVLRLATLTKNAGLDGVVCSAQEASLLKQHLGREFKLVTPGI 204

Query: 185 RMLGSATDGQKRFATPETALKYGASHIVVSRPIVRAADPVSAAQEFQRAI 234
           R  GS    Q+R  TP  A+  G+ ++V+ RPI +AA P    +E   ++
Sbjct: 205 RPAGSEQGDQRRIMTPAQAIASGSDYLVIGRPITQAAHPEVVLEEINSSL 254


gi|7546547|pdb|1EIX|A Chain A, Structure Of Orotidine 5'-Monophosphate Decarboxylase From E. Coli, Co-Crystallised With The Inhibitor Bmp Length = 245 Back     alignment and structure
>gi|15825972|pdb|1JJK|A Chain A, Selenomethionine Substitution Of Orotidine-5'-Monophosphate Decarboxylase From E. Coli Causes A Change In Crystal Contacts And Space Group Length = 245 Back     alignment and structure
>gi|160286215|pdb|2YYT|A Chain A, Crystal Structure Of Uncharacterized Conserved Protein From Geobacillus Kaustophilus Length = 246 Back     alignment and structure
gi|7245428|pdb|1DBT|A Chain A, Crystal Structure Of Orotidine 5'-Monophosphate Decarboxylase From Bacillus Subtilis Complexed With Ump Length = 239 Back     alignment and structure
gi|88192706|pdb|2CZ5|A Chain A, Crystal Structure Of Orotidine 5'-Phosphate Decarboxylase From Pyrococcus Horikoshii Ot3 Length = 208 Back     alignment and structure