254780452

254780452

hypothetical protein CLIBASIA_01685

GeneID in NCBI database:8209438Locus tag:CLIBASIA_01685
Protein GI in NCBI database:254780452Protein Accession:YP_003064865.1
Gene range:-(368330, 369109)Protein Length:259aa
Gene description:hypothetical protein
COG prediction:[R] Integral membrane protein, interacts with FtsH
KEGG prediction:hypothetical protein; K06890
SEED prediction:FIG005935: membrane protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM7 TM-Helix
TOPPRED7 TM-Helix
HMMTOP8 TM-Helix
MEMSAT6 TM-Helix
MEMSAT_SVM7 TM-Helix
PHOBIUS8 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------26
MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD
ccHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHccccEEEccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccc
cccHHHHHcHcccHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHccccHHHHHHHHccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc
msdirnyqrvvnsgsgfgstiDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILattvdpdaasiIINRGVMLTGFgalmytsplRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAASfgslslygyttkrdlgpigsfMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD
msdirnyqrvvnsgsgfgstiDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD
MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD
***********************GLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGS***
MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD
*SDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR*
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxx
ooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHooooooHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooo
oooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD
MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD
MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target259 hypothetical protein CLIBASIA_01685 [Candidatus Liberib
315122100259 hypothetical protein CKC_01750 [Candidatus Liberibacter 1 7e-99
15889937260 hypothetical protein Atu2682 [Agrobacterium tumefaciens 1 7e-78
222150083256 hypothetical protein Avi_4182 [Agrobacterium vitis S4] 1 2e-76
86359520242 hypothetical protein RHE_CH03940 [Rhizobium etli CFN 42 1 3e-73
190893788242 hypothetical protein [Rhizobium etli CIAT 652] Length = 1 4e-72
260467318257 protein of unknown function UPF0005 [Mesorhizobium oppo 1 6e-72
222087505247 hypothetical protein Arad_4388 [Agrobacterium radiobact 1 6e-71
325294052245 hypothetical protein AGROH133_08964 [Agrobacterium sp. 1 6e-71
209551305242 hypothetical protein Rleg2_3734 [Rhizobium leguminosaru 1 8e-71
110635681248 hypothetical protein Meso_3353 [Mesorhizobium sp. BNC1] 1 7e-70
>gi|315122100|ref|YP_004062589.1| hypothetical protein CKC_01750 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 259 Back     alignment and organism information
 Score =  364 bits (934), Expect = 7e-99,   Method: Compositional matrix adjust.
 Identities = 181/259 (69%), Positives = 219/259 (84%)

Query: 1   MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60
           MSDIR+YQRV NS  GF STIDQGLRAYMI+VYNLMALGL VTGI+SFL++  ATT+DP 
Sbjct: 1   MSDIRDYQRVQNSRGGFDSTIDQGLRAYMIKVYNLMALGLVVTGIVSFLISGFATTLDPY 60

Query: 61  AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA 120
           AAS ++  GVMLT FG L+Y SPL W+ +FAPLGV IF++VR++SLS  AA++ F +Y+A
Sbjct: 61  AASYVLKSGVMLTSFGTLLYASPLSWVVMFAPLGVCIFMSVRINSLSINAARITFFVYAA 120

Query: 121 LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL 180
           LIGL++SS F++YT+KSIVQTFFITAASF SLSLYGYTTK+DLGPIGSFM+MG  GLFLL
Sbjct: 121 LIGLAISSIFIMYTNKSIVQTFFITAASFVSLSLYGYTTKKDLGPIGSFMLMGVCGLFLL 180

Query: 181 SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLY 240
            L N+FM SS +D+ ++AMG+VIFSALTAYDTQ IKE Y+D Y + Y ERQSV+GAL LY
Sbjct: 181 MLANIFMGSSVVDMAIAAMGVVIFSALTAYDTQVIKEQYADNYGMEYIERQSVLGALRLY 240

Query: 241 MDFIQIFVHLLRFLGSRRD 259
           MDF+ IF+ LLR LG+RRD
Sbjct: 241 MDFVNIFISLLRLLGNRRD 259


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|15889937|ref|NP_355618.1| hypothetical protein Atu2682 [Agrobacterium tumefaciens str. C58] Length = 260 Back     alignment and organism information
>gi|222150083|ref|YP_002551040.1| hypothetical protein Avi_4182 [Agrobacterium vitis S4] Length = 256 Back     alignment and organism information
>gi|86359520|ref|YP_471412.1| hypothetical protein RHE_CH03940 [Rhizobium etli CFN 42] Length = 242 Back     alignment and organism information
>gi|190893788|ref|YP_001980330.1| hypothetical protein [Rhizobium etli CIAT 652] Length = 242 Back     alignment and organism information
>gi|260467318|ref|ZP_05813492.1| protein of unknown function UPF0005 [Mesorhizobium opportunistum WSM2075] Length = 257 Back     alignment and organism information
>gi|222087505|ref|YP_002546042.1| hypothetical protein Arad_4388 [Agrobacterium radiobacter K84] Length = 247 Back     alignment and organism information
>gi|325294052|ref|YP_004279916.1| hypothetical protein AGROH133_08964 [Agrobacterium sp. H13-3] Length = 245 Back     alignment and organism information
>gi|209551305|ref|YP_002283222.1| hypothetical protein Rleg2_3734 [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 242 Back     alignment and organism information
>gi|110635681|ref|YP_675889.1| hypothetical protein Meso_3353 [Mesorhizobium sp. BNC1] Length = 248 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target259 hypothetical protein CLIBASIA_01685 [Candidatus Liberib
COG0670233 COG0670, COG0670, Integral membrane protein, interacts 2e-25
pfam01027203 pfam01027, UPF0005, Uncharacterized protein family UPF0 4e-20
cd06181212 cd06181, BI-1-like, BAX inhibitor (BI)-1 like protein f 4e-38
KOG2322237 KOG2322, KOG2322, KOG2322, N-methyl-D-aspartate recepto 9e-06
KOG1629235 KOG1629, KOG1629, KOG1629, Bax-mediated apoptosis inhib 3e-04
>gnl|CDD|31014 COG0670, COG0670, Integral membrane protein, interacts with FtsH [General function prediction only] Back     alignment and domain information
>gnl|CDD|144568 pfam01027, UPF0005, Uncharacterized protein family UPF0005 Back     alignment and domain information
>gnl|CDD|100120 cd06181, BI-1-like, BAX inhibitor (BI)-1 like protein family Back     alignment and domain information
>gnl|CDD|37533 KOG2322, KOG2322, KOG2322, N-methyl-D-aspartate receptor glutamate-binding subunit [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|36842 KOG1629, KOG1629, KOG1629, Bax-mediated apoptosis inhibitor TEGT/BI-1 [Defense mechanisms] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 259 hypothetical protein CLIBASIA_01685 [Candidatus Liberib
COG0670233 Integral membrane protein, interacts with FtsH [General 100.0
cd06181212 BI-1-like BAX inhibitor (BI)-1 like protein family. Mam 100.0
PRK10447219 hypothetical protein; Provisional 100.0
KOG2322237 consensus 100.0
KOG1629235 consensus 99.95
KOG1630336 consensus 99.93
pfam01027203 UPF0005 Uncharacterized protein family UPF0005. The Pfa 100.0
pfam06539228 consensus 98.87
COG4760276 Predicted membrane protein [Function unknown] 97.85
>COG0670 Integral membrane protein, interacts with FtsH [General function prediction only] Back     alignment and domain information
>cd06181 BI-1-like BAX inhibitor (BI)-1 like protein family Back     alignment and domain information
>PRK10447 hypothetical protein; Provisional Back     alignment and domain information
>KOG2322 consensus Back     alignment and domain information
>KOG1629 consensus Back     alignment and domain information
>KOG1630 consensus Back     alignment and domain information
>pfam01027 UPF0005 Uncharacterized protein family UPF0005 Back     alignment and domain information
>pfam06539 consensus Back     alignment and domain information
>COG4760 Predicted membrane protein [Function unknown] Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00