254780458

254780458

3-phosphoshikimate 1-carboxyvinyltransferase

GeneID in NCBI database:8209445Locus tag:CLIBASIA_01715
Protein GI in NCBI database:254780458Protein Accession:YP_003064871.1
Gene range:-(375960, 377309)Protein Length:449aa
Gene description:3-phosphoshikimate 1-carboxyvinyltransferase
COG prediction:[E] 5-enolpyruvylshikimate-3-phosphate synthase
KEGG prediction:aroA; 3-phosphoshikimate 1-carboxyvinyltransferase (EC:2.5.1.19); K00800 3-phosphoshikimate 1-carboxyvinyltransferase [EC:2.5.1.19]
SEED prediction:5-Enolpyruvylshikimate-3-phosphate synthase (EC 2.5.1.19)
Pathway involved in KEGG:Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:las00400]
Subsystem involved in SEED:Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate)
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED4 TM-Helix
HMMTOP2 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------45
MSFVCKKSTIQSSYSCGLQGTICIPGDRSLSHFSIILGGIAAGETQIRGVLESDDVLNTMRMMHYLGARFTKKDREWIVQGVGNGCLLSPEYPLDFKGFDMGYGLMMGVVGVYDFQTFFKGRAEILQPTIESLLAPLYQMGVQVKLPEDKRLPLVLHGPRTPNPIVYKSPMDSVQSKSVVLLAGLNTPGITEVIEPVKTQDHMEIILKEFGVDLLIKSDTIEDYSVRIEGRKRISGCNLKIPGDSSIAFFPLAAALLIPGSDIKLLNVLTNPLRVGIIDILREMGADITLSNSRIESGENIADIRVRFSKIKGITISDNRLRSIVDEYPILLVISAFAEGETIIKGLAEVMTSKQFSGIIECFNINNIQYEREGDYLMIKGVPGGKGLGCSTGHMVQSKFGYRVAMSFLVMGLASEYSVVVDDYTMISTIFPDFINLMKTLGARIEWVD
cccccccEEEEEEccccEEEEEEccccHHHHHHHHHHHHHccccEEEEccccHHHHHHHHHHHHHcccEEEEEccEEEEEEcccccccccccHHHHHHHHHHHHHHHHHHHcccccEEEEcccccccccHHHHHHHHHHcccEEEEccccEEEEEEEcccccccEEEEcccccHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHcccEEEEEcccccccEEEEccccccccEEEEEcccHHHHHHHHHHHHHccccEEEEccccccccHHHHHHHHHHcccEEEEEccEEEccccccEEEEEcccccccccccccccccHHHHHHHHHHHHHccccEEEEcccEEEEccHHHHHHHHHHHcccEEEEEccEEEEEccccccccccccccEEcccccHHHHHHHHHHHHHccccEEEEccEEcccccccHHHHHHHcccEEEEcc
cccccccccccccccccccEEEEccccccccHHHHHHHHHHccccEEccccccHHHHHHHHHHHHcccEEEccccEEEEEEcccccccccccccccccccHHHHHHHHHHHcccccEEEEccccHccccHHHHHHHHHHcccEEEEcccccccEEEEcccccccEEEccccHHHHHHHHHHHHcccccccEEEEccccccHHHHHHHHHcccEEEEcccccccEEEEEEcccEccccEEEEcccHHHHHHHHHHHHHccccEEEEEEcccccccHHHHHHHHHcccEEEEccccccccccEEEEEEEEcccEEEEccHcHHHHHHHHHHHHHHHHHHHcccEEEEccHEccccHHHHHHHHHHHHcccEEEEccccEEEEccccccccccccccEEcccccHHHHHHHHHHHHHHcccEEEccHHHHHHccHHHHHHHHHccccEEEcc
msfvckkstiqssyscglqgticipgdrslshFSIILGGIAAGETQIRGVLESDDVLNTMRMMHYLGARFTKKDREWIVQGvgngcllspeypldfkgfdmgYGLMMGVVGVYDFQTFFKGRAEILQPTIESLLAPLyqmgvqvklpedkrlplvlhgprtpnpivykspmdsvqsKSVVLLAglntpgiteviepvktqdHMEIILKEFGVDlliksdtiedysVRIEGrkrisgcnlkipgdssiafFPLAAAllipgsdikllnvltnplrVGIIDILREMgaditlsnsriesgenIADIRVRFSKikgitisdnrlrsivdeYPILLVISAFAEGETIIKGLAEVMTSKQFSGIIECFNinniqyeregdylmikgvpggkglgcstghmvqskfgYRVAMSFLVMGLASEYSVVVDDYTMISTIFPDFINLMKTLGARIEWVD
MSFVCKKSTIQSSYSCGLQGTICIPGDRSLSHFSIILGGiaagetqirGVLESDDVLNTMRMMHYLGarftkkdrEWIVQGVgngcllspeyPLDFKGFDMGYGLMMGVVGVYDFQTFFKGRAEILQPTIESLLAPLYQMGVQVKLPEDKRLPLVLHGPRTPNPIVYKSPMDSVQSKSVVLLAGLNTPGITEviepvktqdhMEIILKEfgvdlliksdTIEDYSVRIEGRKRISGCNLKIPGDSSIAFFPLAAALLIPGSDIKLLNVLTNPLRVGIIDILREMGADItlsnsriesgeniadIRVRfskikgitisdnrlrsiVDEYPILLVISAFAEGETIIKGLAEVMTSKQFSGIIECFNINNIQYEREGDYLMIKGVPGGKGLGCSTGHMVQSKFGYRVAMSFLVMGLASEYSVVVDDYTMISTIFPDFINLMKTLGARIEWVD
MSFVCKKSTIQSSYSCGLQGTICIPGDRSLSHFSIILGGIAAGETQIRGVLESDDVLNTMRMMHYLGARFTKKDREWIVQGVGNGCLLSPEYPLDFKGFDmgyglmmgvvgvyDFQTFFKGRAEILQPTIESLLAPLYQMGVQVKLPEDKRLPLVLHGPRTPNPIVYKSPMDSVQSKSVVLLAGLNTPGITEVIEPVKTQDHMEIILKEFGVDLLIKSDTIEDYSVRIEGRKRISGCNLKIPGDssiaffplaaallipGSDIKLLNVLTNPLRVGIIDILREMGADITLSNSRIESGENIADIRVRFSKIKGITISDNRLRSIVDEYPILLVISAFAEGETIIKGLAEVMTSKQFSGIIECFNINNIQYEREGDYLMIKGVPGGKGLGCSTGHMVQSKFGYRVAMSFLVMGLASEYSVVVDDYTMISTIFPDFINLMKTLGARIEWVD
********************TICIPGDRSLSHFSIILGGIAAGETQIRGVLESDDVLNTMRMMHYLGARFTKKDREWIVQGVGNGCLLSPEYPLDFKGFDMGYGLMMGVVGVYDFQTFFKGRAEILQPTIESLLAPLYQMGVQVKLPEDKRLPLVLHGPRTPNPIVYKSPMDSVQSKSVVLLAGLNTPGITEVIEPVKTQDHMEIILKEFGVDLLIKSDTIEDYSVRIEGRKRISGCNLKIPGDSSIAFFPLAAALLIPGSDIKLLNVLTNPLRVGIIDILREMGADITLSNSRIESGENIADIRVRFSKIKGITISDNRLRSIVDEYPILLVISAFAEGETIIKGLAEVMTSKQFSGIIECFNINNIQYEREGDYLMIKGVPGGKGLGCSTGHMVQSKFGYRVAMSFLVMGLASEYSVVVDDYTMISTIFPDFINLMKTLGARIE***
*************YSCGLQGTICIPGDRSLSHFSIILGGIAAGETQIRGVLESDDVLNTMRMMHYLGARFTKKDREWIVQGVGNGCLLSPEYPLDFKGFDMGYGLMMGVVGVYDFQTFFKGRAEILQPTIESLLAPLYQMGVQVKLPEDKRLPLVLHGPRTPNPIVYKSPMDSVQSKSVVLLAGLNTPGITEVIEPVKTQDHMEIILKEFGVDLLIKSDTIEDYSVRIEGRKRISGCNLKIPGDSSIAFFPLAAALLIPGSDIKLLNVLTNPLRVGIIDILREMGADITLSNSRIESGENIADIRVRFSKIKGITISDNRLRSIVDEYPILLVISAFAEGETIIKGLAEVMTSKQFSGIIECFNINNIQYEREGDYLMIKGVPGGKGLGCSTGHMVQSKFGYRVAMSFLVMGLASEYSVVVDDYTMISTIFPDFINLMKTLGARIEWVD
**************SCGLQGTICIPGDRSLSHFSIILGGIAAGETQIRGVLESDDVLNTMRMMHYLGARFTKKDREWIVQGVGNGCLLSPEYPLDFKGFDMGYGLMMGVVGVYDFQTFFKGRAEILQPTIESLLAPLYQMGVQVKLPEDKRLPLVLHGPRTPNPIVYKSPMDSVQSKSVVLLAGLNTPGITEVIEPVKTQDHMEIILKEFGVDLLIKSDTIEDYSVRIEGRKRISGCNLKIPGDSSIAFFPLAAALLIPGSDIKLLNVLTNPLRVGIIDILREMGADITLSNSRIESGENIADIRVRFSKIKGITISDNRLRSIVDEYPILLVISAFAEGETIIKGLAEVMTSKQFSGIIECFNINNIQYEREGDYLMIKGVPGGKGLGCSTGHMVQSKFGYRVAMSFLVMGLASEYSVVVDDYTMISTIFPDFINLMKTLGARIE***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSFVCKKSTIQSSYSCGLQGTICIPGDRSLSHFSIILGGIAAGETQIRGVLESDDVLNTMRMMHYLGARFTKKDREWIVQGVGNGCLLSPEYPLDFKGFDMGYGLMMGVVGVYDFQTFFKGRAEILQPTIESLLAPLYQMGVQVKLPEDKRLPLVLHGPRTPNPIVYKSPMDSVQSKSVVLLAGLNTPGITEVIEPVKTQDHMEIILKEFGVDLLIKSDTIEDYSVRIEGRKRISGCNLKIPGDSSIAFFPLAAALLIPGSDIKLLNVLTNPLRVGIIDILREMGADITLSNSRIESGENIADIRVRFSKIKGITISDNRLRSIVDEYPILLVISAFAEGETIIKGLAEVMTSKQFSGIIECFNINNIQYEREGDYLMIKGVPGGKGLGCSTGHMVQSKFGYRVAMSFLVMGLASEYSVVVDDYTMISTIFPDFINLMKTLGARIEWVD
MSFVCKKSTIQSSYSCGLQGTICIPGDRSLSHFSIILGGIAAGETQIRGVLESDDVLNTMRMMHYLGARFTKKDREWIVQGVGNGCLLSPEYPLDFKGFDMGYGLMMGVVGVYDFQTFFKGRAEILQPTIESLLAPLYQMGVQVKLPEDKRLPLVLHGPRTPNPIVYKSPMDSVQSKSVVLLAGLNTPGITEVIEPVKTQDHMEIILKEFGVDLLIKSDTIEDYSVRIEGRKRISGCNLKIPGDSSIAFFPLAAALLIPGSDIKLLNVLTNPLRVGIIDILREMGADITLSNSRIESGENIADIRVRFSKIKGITISDNRLRSIVDEYPILLVISAFAEGETIIKGLAEVMTSKQFSGIIECFNINNIQYEREGDYLMIKGVPGGKGLGCSTGHMVQSKFGYRVAMSFLVMGLASEYSVVVDDYTMISTIFPDFINLMKTLGARIEWVD
MSFVCKKSTIQSSYSCGLQGTICIPGDRSLSHFSIILGGIAAGETQIRGVLESDDVLNTMRMMHYLGARFTKKDREWIVQGVGNGCLLSPEYPLDFKGFDMGYGLMMGVVGVYDFQTFFKGRAEILQPTIESLLAPLYQMGVQVKLPEDKRLPLVLHGPRTPNPIVYKSPMDSVQSKSVVLLAGLNTPGITEVIEPVKTQDHMEIILKEFGVDLLIKSDTIEDYSVRIEGRKRISGCNLKIPGDSSIAFFPLAAALLIPGSDIKLLNVLTNPLRVGIIDILREMGADITLSNSRIESGENIADIRVRFSKIKGITISDNRLRSIVDEYPILLVISAFAEGETIIKGLAEVMTSKQFSGIIECFNINNIQYEREGDYLMIKGVPGGKGLGCSTGHMVQSKFGYRVAMSFLVMGLASEYSVVVDDYTMISTIFPDFINLMKTLGARIEWVD

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target449 3-phosphoshikimate 1-carboxyvinyltransferase [Candidatu
315122094491 3-phosphoshikimate 1-carboxyvinyltransferase [Candidatu 1 1e-164
15964006455 3-phosphoshikimate 1-carboxyvinyltransferase [Sinorhizo 1 1e-127
307319305455 3-phosphoshikimate 1-carboxyvinyltransferase [Sinorhizo 1 1e-127
241207045452 3-phosphoshikimate 1-carboxyvinyltransferase [Rhizobium 1 1e-125
116249874452 3-phosphoshikimate 1-carboxyvinyltransferase [Rhizobium 1 1e-125
227824085448 3-phosphoshikimate 1-carboxyvinyltransferase [Sinorhizo 1 1e-123
150398642456 3-phosphoshikimate 1-carboxyvinyltransferase [Sinorhizo 1 1e-122
8469107455 RecName: Full=3-phosphoshikimate 1-carboxyvinyltransfer 1 1e-122
114794061455 Chain A, Cp4 Epsp Synthase Ala100gly Liganded With S3p 1 1e-122
18266432455 CP4EPSPS [Glycine max] Length = 455 1 1e-121
>gi|315122094|ref|YP_004062583.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 491 Back     alignment and organism information
 Score =  581 bits (1498), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 288/449 (64%), Positives = 363/449 (80%), Gaps = 4/449 (0%)

Query: 1   MSFVCKKSTIQSSYSCGLQGTICIPGDRSLSHFSIILGGIAAGETQIRGVLESDDVLNTM 60
           + F+ KK   +SS S GL GTIC+PGDRS+SHFSIILGG+A+GET+I G+LESDDVL T+
Sbjct: 47  LPFLYKKRPARSSCSSGLTGTICVPGDRSISHFSIILGGLASGETRISGLLESDDVLKTI 106

Query: 61  RMMHYLGARFTKKDREWIVQGVGNGCLLSPEYPLDFKGFDMGYGLMMGVVGVYDFQTFFK 120
           + M+ LGA FTKK+ EWI++GVGNGCLL+PE PLDF+  ++G  L MG+VGVYDFQTFFK
Sbjct: 107 KSMNCLGAHFTKKNGEWIIKGVGNGCLLAPESPLDFENSEIGCELTMGLVGVYDFQTFFK 166

Query: 121 GRAEILQPTIESLLAPLYQMGVQVKLPEDKRLPLVLHGPRTPNPIVYKSPMDSVQSKSVV 180
           G  ++ +  +E +L PL QMG QV   +   L   LHGP+TPNPIVYKS M S + KSVV
Sbjct: 167 G-GDLSKKAVERVLTPLIQMGTQVVPAKKNCLEFSLHGPKTPNPIVYKSSMVSARMKSVV 225

Query: 181 LLAGLNTPGITEVIEPVKTQDHMEIILKEFGVDLLIKSDTIEDYSVRIEGRKRISGCNLK 240
           LLAGLN+ G+T+VIE +KTQ+HMEI+LKEFGVDLL+KSD I  YSV+IEGRK++SGC+L 
Sbjct: 226 LLAGLNSLGVTKVIESMKTQNHMEIMLKEFGVDLLVKSDKIRGYSVQIEGRKKLSGCSLT 285

Query: 241 IPGDSSIAFFPLAAALLIPGSDIKLLNVLTNPLRVGIIDILREMGADITLSNSRIESGEN 300
           IPGD S A FPLAAALLIPGS++++LNVL NP R+G+I+IL++MGADI   N RIESGEN
Sbjct: 286 IPGDPSFAIFPLAAALLIPGSNVQILNVLINPSRIGLINILQDMGADIVFVNHRIESGEN 345

Query: 301 IADIRVRFSKIKGITISDNRLRSIVDEYPILLVISAFAEGETIIKGLAEVMTSKQFSGII 360
           IADI+VRFS +KGITIS++R+  ++DEY IL +ISAFAEG T+IKG+ ++   +Q S I+
Sbjct: 346 IADIQVRFSNLKGITISEDRMPYMIDEYSILAIISAFAEGRTVIKGMGKL---EQLSTIL 402

Query: 361 ECFNINNIQYEREGDYLMIKGVPGGKGLGCSTGHMVQSKFGYRVAMSFLVMGLASEYSVV 420
           E  +INN+Q E+  + L++ GVPGGKGLG  +G MVQ KF +R+AMSFLVMGLASEYSV+
Sbjct: 403 EGLSINNVQCEQGENDLVVMGVPGGKGLGSRSGRMVQPKFDHRIAMSFLVMGLASEYSVI 462

Query: 421 VDDYTMISTIFPDFINLMKTLGARIEWVD 449
           VDD +M STIF DFINLM+ LGARIE +D
Sbjct: 463 VDDCSMASTIFQDFINLMQGLGARIERMD 491


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|15964006|ref|NP_384359.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Sinorhizobium meliloti 1021] Length = 455 Back     alignment and organism information
>gi|307319305|ref|ZP_07598734.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Sinorhizobium meliloti AK83] Length = 455 Back     alignment and organism information
>gi|241207045|ref|YP_002978141.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 452 Back     alignment and organism information
>gi|116249874|ref|YP_765712.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Rhizobium leguminosarum bv. viciae 3841] Length = 452 Back     alignment and organism information
>gi|227824085|ref|YP_002828058.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Sinorhizobium fredii NGR234] Length = 448 Back     alignment and organism information
>gi|150398642|ref|YP_001329109.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Sinorhizobium medicae WSM419] Length = 456 Back     alignment and organism information
>gi|8469107|sp|Q9R4E4|AROA_AGRSC RecName: Full=3-phosphoshikimate 1-carboxyvinyltransferase; AltName: Full=5-enolpyruvylshikimate-3-phosphate synthase; Short=EPSP synthase; Short=EPSPS Length = 455 Back     alignment and organism information
>gi|114794061|pdb|2GGD|A Chain A, Cp4 Epsp Synthase Ala100gly Liganded With S3p And Glyphosate Length = 455 Back     alignment and organism information
>gi|18266432|gb|AAL67577.1|AF464188_1 CP4EPSPS [Glycine max] Length = 455 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target449 3-phosphoshikimate 1-carboxyvinyltransferase [Candidatu
PRK02427435 PRK02427, PRK02427, 3-phosphoshikimate 1-carboxyvinyltr 5e-94
PRK14806735 PRK14806, PRK14806, bifunctional cyclohexadienyl dehydr 6e-75
cd01556409 cd01556, EPSP_synthase, EPSP synthase domain 7e-72
TIGR01356409 TIGR01356, aroA, 3-phosphoshikimate 1-carboxyvinyltrans 4e-69
pfam00275415 pfam00275, EPSP_synthase, EPSP synthase (3-phosphoshiki 1e-51
cd01554408 cd01554, EPT-like, Enol pyruvate transferases family in 5e-47
PRK11861673 PRK11861, PRK11861, bifunctional prephenate dehydrogena 6e-12
PLN02338443 PLN02338, PLN02338, 3-phosphoshikimate 1-carboxyvinyltr 7e-11
COG0766421 COG0766, MurA, UDP-N-acetylglucosamine enolpyruvyl tran 4e-07
KOG0692595 KOG0692, KOG0692, KOG0692, Pentafunctional AROM protein 2e-04
COG0128428 COG0128, AroA, 5-enolpyruvylshikimate-3-phosphate synth 2e-77
PRK11860 661 PRK11860, PRK11860, bifunctional 3-phosphoshikimate 1-c 2e-10
cd01555400 cd01555, UdpNAET, UDP-N-acetylglucosamine enolpyruvyl t 9e-07
PRK09369417 PRK09369, PRK09369, UDP-N-acetylglucosamine 1-carboxyvi 1e-04
TIGR01072416 TIGR01072, murA, UDP-N-acetylglucosamine 1-carboxyvinyl 2e-04
PRK11860 661 PRK11860, PRK11860, bifunctional 3-phosphoshikimate 1-c 0.001
cd01555400 cd01555, UdpNAET, UDP-N-acetylglucosamine enolpyruvyl t 0.004
>gnl|CDD|179423 PRK02427, PRK02427, 3-phosphoshikimate 1-carboxyvinyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|184828 PRK14806, PRK14806, bifunctional cyclohexadienyl dehydrogenase/ 3-phosphoshikimate 1-carboxyvinyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|30129 cd01556, EPSP_synthase, EPSP synthase domain Back     alignment and domain information
>gnl|CDD|162316 TIGR01356, aroA, 3-phosphoshikimate 1-carboxyvinyltransferase Back     alignment and domain information
>gnl|CDD|144020 pfam00275, EPSP_synthase, EPSP synthase (3-phosphoshikimate 1-carboxyvinyltransferase) Back     alignment and domain information
>gnl|CDD|30127 cd01554, EPT-like, Enol pyruvate transferases family includes EPSP synthases and UDP-N-acetylglucosamine enolpyruvyl transferase Back     alignment and domain information
>gnl|CDD|183343 PRK11861, PRK11861, bifunctional prephenate dehydrogenase/3-phosphoshikimate 1-carboxyvinyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|177972 PLN02338, PLN02338, 3-phosphoshikimate 1-carboxyvinyltransferase Back     alignment and domain information
>gnl|CDD|31109 COG0766, MurA, UDP-N-acetylglucosamine enolpyruvyl transferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|35911 KOG0692, KOG0692, KOG0692, Pentafunctional AROM protein [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|30477 COG0128, AroA, 5-enolpyruvylshikimate-3-phosphate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|183342 PRK11860, PRK11860, bifunctional 3-phosphoshikimate 1-carboxyvinyltransferase/cytidine monophosphate kinase; Provisional Back     alignment and domain information
>gnl|CDD|30128 cd01555, UdpNAET, UDP-N-acetylglucosamine enolpyruvyl transferase catalyzes enolpyruvyl transfer as part of the first step in the biosynthesis of peptidoglycan, a component of the bacterial cell wall Back     alignment and domain information
>gnl|CDD|181804 PRK09369, PRK09369, UDP-N-acetylglucosamine 1-carboxyvinyltransferase; Validated Back     alignment and domain information
>gnl|CDD|162190 TIGR01072, murA, UDP-N-acetylglucosamine 1-carboxyvinyltransferase Back     alignment and domain information
>gnl|CDD|183342 PRK11860, PRK11860, bifunctional 3-phosphoshikimate 1-carboxyvinyltransferase/cytidine monophosphate kinase; Provisional Back     alignment and domain information
>gnl|CDD|30128 cd01555, UdpNAET, UDP-N-acetylglucosamine enolpyruvyl transferase catalyzes enolpyruvyl transfer as part of the first step in the biosynthesis of peptidoglycan, a component of the bacterial cell wall Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 449 3-phosphoshikimate 1-carboxyvinyltransferase [Candidatu
TIGR01356444 aroA 3-phosphoshikimate 1-carboxyvinyltransferase; Inte 100.0
COG0128428 AroA 5-enolpyruvylshikimate-3-phosphate synthase [Amino 100.0
PRK02427424 3-phosphoshikimate 1-carboxyvinyltransferase; Provision 100.0
PRK11860 662 bifunctional 3-phosphoshikimate 1-carboxyvinyltransfera 100.0
PRK11861673 bifunctional prephenate dehydrogenase/3-phosphoshikimat 100.0
cd01554408 EPT-like Enol pyruvate transferases family includes EPS 100.0
cd01556409 EPSP_synthase EPSP synthase domain. 3-phosphoshikimate 100.0
pfam00275415 EPSP_synthase EPSP synthase (3-phosphoshikimate 1-carbo 100.0
PRK09369417 UDP-N-acetylglucosamine 1-carboxyvinyltransferase; Vali 100.0
cd01555400 UdpNAET UDP-N-acetylglucosamine enolpyruvyl transferase 100.0
PRK12830417 UDP-N-acetylglucosamine 1-carboxyvinyltransferase; Revi 100.0
TIGR01072443 murA UDP-N-acetylglucosamine 1-carboxyvinyltransferase; 100.0
COG0766421 MurA UDP-N-acetylglucosamine enolpyruvyl transferase [C 100.0
KOG0692595 consensus 100.0
TIGR01072443 murA UDP-N-acetylglucosamine 1-carboxyvinyltransferase; 99.92
COG0766421 MurA UDP-N-acetylglucosamine enolpyruvyl transferase [C 99.83
PRK12830417 UDP-N-acetylglucosamine 1-carboxyvinyltransferase; Revi 99.79
PRK11860 662 bifunctional 3-phosphoshikimate 1-carboxyvinyltransfera 99.66
PRK09369417 UDP-N-acetylglucosamine 1-carboxyvinyltransferase; Vali 99.85
cd01555400 UdpNAET UDP-N-acetylglucosamine enolpyruvyl transferase 99.78
PRK02427424 3-phosphoshikimate 1-carboxyvinyltransferase; Provision 99.71
TIGR01356444 aroA 3-phosphoshikimate 1-carboxyvinyltransferase; Inte 99.7
cd01556409 EPSP_synthase EPSP synthase domain. 3-phosphoshikimate 99.7
cd01554408 EPT-like Enol pyruvate transferases family includes EPS 99.7
pfam00275415 EPSP_synthase EPSP synthase (3-phosphoshikimate 1-carbo 99.66
COG0128428 AroA 5-enolpyruvylshikimate-3-phosphate synthase [Amino 99.64
PRK11861673 bifunctional prephenate dehydrogenase/3-phosphoshikimat 99.43
KOG0692 595 consensus 97.19
cd01553211 EPT_RTPC-like This domain family includes the Enolpyruv 98.44
cd01553211 EPT_RTPC-like This domain family includes the Enolpyruv 96.31
COG0430341 RCL1 RNA 3'-terminal phosphate cyclase [RNA processing 95.67
TIGR03400360 18S_RNA_Rcl1p 18S rRNA biogenesis protein RCL1. Members 94.6
PRK04204339 RNA 3'-terminal-phosphate cyclase; Provisional 93.28
pfam01137330 RTC RNA 3'-terminal phosphate cyclase. RNA cyclases are 93.19
TIGR03399326 RNA_3prim_cycl RNA 3'-phosphate cyclase. Members of thi 92.06
cd00874326 RNA_Cyclase_Class_II RNA 3' phosphate cyclase domain (c 92.03
cd00875341 RNA_Cyclase_Class_I RNA 3' phosphate cyclase domain (cl 91.64
LOAD_rna_Cyc329 consensus 91.15
>TIGR01356 aroA 3-phosphoshikimate 1-carboxyvinyltransferase; InterPro: IPR006264 These sequences represent 5-enolpyruvyl shikimate-3-phosphate synthase (EPSP_synthase) (3-phosphoshikimate-1-carboxyvinyltransferase,aroA), which catalyzes the sixth of seven steps in the shikimate pathway of the biosynthesis of chorimate Back     alignment and domain information
>COG0128 AroA 5-enolpyruvylshikimate-3-phosphate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK02427 3-phosphoshikimate 1-carboxyvinyltransferase; Provisional Back     alignment and domain information
>PRK11860 bifunctional 3-phosphoshikimate 1-carboxyvinyltransferase/cytidine monophosphate kinase; Provisional Back     alignment and domain information
>PRK11861 bifunctional prephenate dehydrogenase/3-phosphoshikimate 1-carboxyvinyltransferase; Provisional Back     alignment and domain information
>cd01554 EPT-like Enol pyruvate transferases family includes EPSP synthases and UDP-N-acetylglucosamine enolpyruvyl transferase Back     alignment and domain information
>cd01556 EPSP_synthase EPSP synthase domain Back     alignment and domain information
>pfam00275 EPSP_synthase EPSP synthase (3-phosphoshikimate 1-carboxyvinyltransferase) Back     alignment and domain information
>PRK09369 UDP-N-acetylglucosamine 1-carboxyvinyltransferase; Validated Back     alignment and domain information
>cd01555 UdpNAET UDP-N-acetylglucosamine enolpyruvyl transferase catalyzes enolpyruvyl transfer as part of the first step in the biosynthesis of peptidoglycan, a component of the bacterial cell wall Back     alignment and domain information
>PRK12830 UDP-N-acetylglucosamine 1-carboxyvinyltransferase; Reviewed Back     alignment and domain information
>TIGR01072 murA UDP-N-acetylglucosamine 1-carboxyvinyltransferase; InterPro: IPR005750 The bacterial enzyme UDP-N-acetylglucosamine (UDP-GlcNAc) enolpyruvyltransferase (MurA) catalyzes the transfer of enolpyruvate from phosphoenolpyruvate to uridine diphospho-N-acetylglucosamine, which is the first committed step of bacterial cell wall biosynthesis Back     alignment and domain information
>COG0766 MurA UDP-N-acetylglucosamine enolpyruvyl transferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG0692 consensus Back     alignment and domain information
>TIGR01072 murA UDP-N-acetylglucosamine 1-carboxyvinyltransferase; InterPro: IPR005750 The bacterial enzyme UDP-N-acetylglucosamine (UDP-GlcNAc) enolpyruvyltransferase (MurA) catalyzes the transfer of enolpyruvate from phosphoenolpyruvate to uridine diphospho-N-acetylglucosamine, which is the first committed step of bacterial cell wall biosynthesis Back     alignment and domain information
>COG0766 MurA UDP-N-acetylglucosamine enolpyruvyl transferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK12830 UDP-N-acetylglucosamine 1-carboxyvinyltransferase; Reviewed Back     alignment and domain information
>PRK11860 bifunctional 3-phosphoshikimate 1-carboxyvinyltransferase/cytidine monophosphate kinase; Provisional Back     alignment and domain information
>PRK09369 UDP-N-acetylglucosamine 1-carboxyvinyltransferase; Validated Back     alignment and domain information
>cd01555 UdpNAET UDP-N-acetylglucosamine enolpyruvyl transferase catalyzes enolpyruvyl transfer as part of the first step in the biosynthesis of peptidoglycan, a component of the bacterial cell wall Back     alignment and domain information
>PRK02427 3-phosphoshikimate 1-carboxyvinyltransferase; Provisional Back     alignment and domain information
>TIGR01356 aroA 3-phosphoshikimate 1-carboxyvinyltransferase; InterPro: IPR006264 These sequences represent 5-enolpyruvyl shikimate-3-phosphate synthase (EPSP_synthase) (3-phosphoshikimate-1-carboxyvinyltransferase,aroA), which catalyzes the sixth of seven steps in the shikimate pathway of the biosynthesis of chorimate Back     alignment and domain information
>cd01556 EPSP_synthase EPSP synthase domain Back     alignment and domain information
>cd01554 EPT-like Enol pyruvate transferases family includes EPSP synthases and UDP-N-acetylglucosamine enolpyruvyl transferase Back     alignment and domain information
>pfam00275 EPSP_synthase EPSP synthase (3-phosphoshikimate 1-carboxyvinyltransferase) Back     alignment and domain information
>COG0128 AroA 5-enolpyruvylshikimate-3-phosphate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11861 bifunctional prephenate dehydrogenase/3-phosphoshikimate 1-carboxyvinyltransferase; Provisional Back     alignment and domain information
>KOG0692 consensus Back     alignment and domain information
>cd01553 EPT_RTPC-like This domain family includes the Enolpyruvate transferase (EPT) family and the RNA 3' phosphate cyclase family (RTPC) Back     alignment and domain information
>cd01553 EPT_RTPC-like This domain family includes the Enolpyruvate transferase (EPT) family and the RNA 3' phosphate cyclase family (RTPC) Back     alignment and domain information
>COG0430 RCL1 RNA 3'-terminal phosphate cyclase [RNA processing and modification] Back     alignment and domain information
>TIGR03400 18S_RNA_Rcl1p 18S rRNA biogenesis protein RCL1 Back     alignment and domain information
>PRK04204 RNA 3'-terminal-phosphate cyclase; Provisional Back     alignment and domain information
>pfam01137 RTC RNA 3'-terminal phosphate cyclase Back     alignment and domain information
>TIGR03399 RNA_3prim_cycl RNA 3'-phosphate cyclase Back     alignment and domain information
>cd00874 RNA_Cyclase_Class_II RNA 3' phosphate cyclase domain (class II) Back     alignment and domain information
>cd00875 RNA_Cyclase_Class_I RNA 3' phosphate cyclase domain (class I) This subfamily of cyclase-like proteins are encoded in eukaryotic genomes Back     alignment and domain information
>LOAD_rna_Cyc consensus Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target449 3-phosphoshikimate 1-carboxyvinyltransferase [Candidatu
2gg4_A455 Cp4 Epsp Synthase (Unliganded) Length = 455 2e-72
2ggd_A455 Cp4 Epsp Synthase Ala100gly Liganded With S3p And G 2e-72
2pqb_A445 Cp4 Epsps Liganded With (R)-Difluoromethyl Tetrahed 9e-71
2pqd_A445 A100g Cp4 Epsps Liganded With (R)-Difluoromethyl Te 1e-70
1rf4_A427 Structural Studies Of Streptococcus Pneumoniae Epsp 2e-57
1mi4_A427 Glyphosate Insensitive G96a Mutant Epsp Synthase Li 2e-49
1g6s_A427 Structure Of Epsp Synthase Liganded With Shikimate- 2e-49
2qfs_A427 E.Coli Epsp Synthase Pro101ser Liganded With S3p Le 3e-49
2qfq_A427 E. Coli Epsp Synthase Pro101leu Liganded With S3p L 3e-49
3fjx_A427 E. Coli Epsp Synthase (T97i) Liganded With S3p Leng 4e-49
3fk0_A427 E. Coli Epsp Synthase (Tips Mutation) Liganded With 6e-49
1q36_A427 Epsp Synthase (Asp313ala) Liganded With Tetrahedral 6e-49
1eps_A427 Structure And Topological Symmetry Of The Glyphosph 4e-48
3nvs_A450 1.02 Angstrom Resolution Crystal Structure Of 3-Pho 1e-47
1ejc_A419 Crystal Structure Of Unliganded Mura (Type2) Length 3e-42
1q3g_A419 Mura (Asp305ala) Liganded With Tetrahedral Reaction 3e-42
1naw_A419 Enolpyruvyl Transferase Length = 419 5e-42
3kqa_A419 Mura Dead-End Complex With Terreic Acid Length = 41 5e-42
1ryw_A419 C115s Mura Liganded With Reaction Products Length = 5e-42
3kqj_A419 Mura Binary Complex With Udp-N-Acetylglucosamine Le 9e-42
3iss_A418 Crystal Structure Of Enolpyruvyl-Udp-Glcnac Synthas 9e-42
2z2c_A423 Mura Inhibited By Unag-Cnicin Adduct Length = 423 9e-42
1uae_A419 Structure Of Udp-N-Acetylglucosamine Enolpyruvyl Tr 1e-41
3kr6_A419 Mura Dead-End Complex With Fosfomycin Length = 419 1e-41
1dlg_A419 Crystal Structure Of The C115s Enterobacter Cloacae 2e-41
1a2n_A419 Structure Of The C115a Mutant Of Mura Complexed Wit 2e-41
2rl1_A424 Crystal Structure Of Udp-N-Acetylglucosamine Enolpy 5e-39
2yvw_A425 Crystal Structure Of Udp-N-Acetylglucosamine 1- Car 9e-30
2bjb_A462 Mycobacterium Tuberculosis Epsp Synthase In Unligan 5e-28
2o0b_A450 Mycobacterium Tuberculosis Epsp Synthase In Complex 5e-28
3r38_A454 2.23 Angstrom Resolution Crystal Structure Of Udp-N 2e-21
1p88_A216 Substrate-Induced Structural Changes To The Isolate 2e-11
gi|114794058|pdb|2GG4|A Chain A, Cp4 Epsp Synthase (Unliganded) Length = 455 Back     alignment and structure
 Score =  278 bits (710), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 224/451 (49%), Positives = 305/451 (67%), Gaps = 2/451 (0%)

Query: 1   MSFVCKKSTIQSSYSCGLQGTICIPGDRSLSHFSIILGGIAAGETQIRGVLESDDVLNTM 60
           MS         +  S GL GT+ IPGD+S+SH S + GG+A+GET+I G+LE +DV+NT 
Sbjct: 1   MSHGASSRPATARKSSGLSGTVRIPGDKSISHRSFMFGGLASGETRITGLLEGEDVINTG 60

Query: 61  RMMHYLGARFTKKDREWIVQGVGNGCLLSPEYPLDFKGFDMGYGLMMGVVGVYDFQTFFK 120
           + M  +GAR  K+   WI+ GVGNG LL+PE PLDF     G  L MG+VGVYDF + F 
Sbjct: 61  KAMQAMGARIRKEGDTWIIDGVGNGGLLAPEAPLDFGNAATGCRLTMGLVGVYDFDSTFI 120

Query: 121 GRAEILQPTIESLLAPLYQMGVQVKLPEDKRLPLVLHGPRTPNPIVYKSPMDSVQSKSVV 180
           G A + +  +  +L PL +MGVQVK  +  RLP+ L GP+TP PI Y+ PM S Q KS V
Sbjct: 121 GDASLTKRPMGRVLNPLREMGVQVKSEDGDRLPVTLRGPKTPTPITYRVPMASAQVKSAV 180

Query: 181 LLAGLNTPGITEVIEPVKTQDHMEIILKEFGVDLLIKSDTIEDYSVRIEGRKRISGCNLK 240
           LLAGLNTPGIT VIEP+ T+DH E +L+ FG +L +++D     ++R+EGR +++G  + 
Sbjct: 181 LLAGLNTPGITTVIEPIMTRDHTEKMLQGFGANLTVETDADGVRTIRLEGRGKLTGQVID 240

Query: 241 IPGDSSIAFFPLAAALLIPGSDIKLLNVLTNPLRVGIIDILREMGADITLSNSRIESGEN 300
           +PGD S   FPL AALL+PGSD+ +LNVL NP R G+I  L+EMGADI + N R+  GE+
Sbjct: 241 VPGDPSSTAFPLVAALLVPGSDVTILNVLMNPTRTGLILTLQEMGADIEVINPRLAGGED 300

Query: 301 IADIRVRFSKIKGITISDNRLRSIVDEYPILLVISAFAEGETIIKGLA--EVMTSKQFSG 358
           +AD+RVR S +KG+T+ ++R  S++DEYPIL V +AFAEG T++ GL    V  S + S 
Sbjct: 301 VADLRVRSSTLKGVTVPEDRAPSMIDEYPILAVAAAFAEGATVMNGLEELRVKESDRLSA 360

Query: 359 IIECFNINNIQYEREGDYLMIKGVPGGKGLGCSTGHMVQSKFGYRVAMSFLVMGLASEYS 418
           +     +N +  +     L+++G P GKGLG ++G  V +   +R+AMSFLVMGL SE  
Sbjct: 361 VANGLKLNGVDCDEGETSLVVRGRPDGKGLGNASGAAVATHLDHRIAMSFLVMGLVSENP 420

Query: 419 VVVDDYTMISTIFPDFINLMKTLGARIEWVD 449
           V VDD TMI+T FP+F++LM  LGA+IE  D
Sbjct: 421 VTVDDATMIATSFPEFMDLMAGLGAKIELSD 451


>gi|114794061|pdb|2GGD|A Chain A, Cp4 Epsp Synthase Ala100gly Liganded With S3p And Glyphosate Length = 455 Back     alignment and structure
>gi|169791693|pdb|2PQB|A Chain A, Cp4 Epsps Liganded With (R)-Difluoromethyl Tetrahedral Intermediate Analog Length = 445 Back     alignment and structure
>gi|169791695|pdb|2PQD|A Chain A, A100g Cp4 Epsps Liganded With (R)-Difluoromethyl Tetrahedral Reaction Intermediate Analog Length = 445 Back     alignment and structure
>gi|46015460|pdb|1RF4|A Chain A, Structural Studies Of Streptococcus Pneumoniae Epsp Synthase, Tetrahedral Intermediate Bound State Length = 427 Back     alignment and structure
>gi|27573942|pdb|1MI4|A Chain A, Glyphosate Insensitive G96a Mutant Epsp Synthase Liganded With Shikimate-3-Phosphate Length = 427 Back     alignment and structure
gi|13096161|pdb|1G6S|A Chain A, Structure Of Epsp Synthase Liganded With Shikimate-3- Phosphate And Glyphosate Length = 427 Back     alignment and structure
>gi|158430187|pdb|2QFS|A Chain A, E.Coli Epsp Synthase Pro101ser Liganded With S3p Length = 427 Back     alignment and structure
>gi|158430186|pdb|2QFQ|A Chain A, E. Coli Epsp Synthase Pro101leu Liganded With S3p Length = 427 Back     alignment and structure
>gi|223674057|pdb|3FJX|A Chain A, E. Coli Epsp Synthase (T97i) Liganded With S3p Length = 427 Back     alignment and structure
>gi|223674059|pdb|3FK0|A Chain A, E. Coli Epsp Synthase (Tips Mutation) Liganded With S3p Length = 427 Back     alignment and structure
>gi|40889351|pdb|1Q36|A Chain A, Epsp Synthase (Asp313ala) Liganded With Tetrahedral Reaction Intermediate Length = 427 Back     alignment and structure
>gi|157830987|pdb|1EPS|A Chain A, Structure And Topological Symmetry Of The Glyphosphate 5- Enol-Pyruvylshikimate-3-Phosphate Synthase: A Distinctive Protein Fold Length = 427 Back     alignment and structure
>gi|301016109|pdb|3NVS|A Chain A, 1.02 Angstrom Resolution Crystal Structure Of 3-Phosphoshikimate 1- Carboxyvinyltransferase From Vibrio Cholerae In Complex With Shikimate-3-Phosphate (Partially Photolyzed) And Glyphosate Length = 450 Back     alignment and structure
>gi|282403785|pdb|1EJC|A Chain A, Crystal Structure Of Unliganded Mura (Type2) Length = 419 Back     alignment and structure
>gi|282403791|pdb|1Q3G|A Chain A, Mura (Asp305ala) Liganded With Tetrahedral Reaction Intermediate Length = 419 Back     alignment and structure
gi|2392464|pdb|1NAW|A Chain A, Enolpyruvyl Transferase Length = 419 Back     alignment and structure
>gi|295321799|pdb|3KQA|A Chain A, Mura Dead-End Complex With Terreic Acid Length = 419 Back     alignment and structure
>gi|282403807|pdb|1RYW|A Chain A, C115s Mura Liganded With Reaction Products Length = 419 Back     alignment and structure
>gi|295321803|pdb|3KQJ|A Chain A, Mura Binary Complex With Udp-N-Acetylglucosamine Length = 419 Back     alignment and structure
>gi|282403825|pdb|3ISS|A Chain A, Crystal Structure Of Enolpyruvyl-Udp-Glcnac Synthase (Mura) :udp-N-Acetylmuramic Acid:phosphite From Escherichia Coli Length = 418 Back     alignment and structure
>gi|282403821|pdb|2Z2C|A Chain A, Mura Inhibited By Unag-Cnicin Adduct Length = 423 Back     alignment and structure
gi|157834054|pdb|1UAE|A Chain A, Structure Of Udp-N-Acetylglucosamine Enolpyruvyl Transferase Length = 419 Back     alignment and structure
>gi|295321804|pdb|3KR6|A Chain A, Mura Dead-End Complex With Fosfomycin Length = 419 Back     alignment and structure
>gi|325534097|pdb|1DLG|A Chain A, Crystal Structure Of The C115s Enterobacter Cloacae Mura In The Un- Liganded State Length = 419 Back     alignment and structure
>gi|157829656|pdb|1A2N|A Chain A, Structure Of The C115a Mutant Of Mura Complexed With The Fluorinated Analog Of The Reaction Tetrahedral Intermediate Length = 419 Back     alignment and structure
gi|170785034|pdb|2RL1|A Chain A, Crystal Structure Of Udp-N-Acetylglucosamine Enolpyruvyl Transferase From Haemophilus Influenzae In Complex With Udp-N-Acetylglucosamine Length = 424 Back     alignment and structure
gi|158431289|pdb|2YVW|A Chain A, Crystal Structure Of Udp-N-Acetylglucosamine 1- Carboxyvinyltransferase From Aquifex Aeolicus Vf5 Length = 425 Back     alignment and structure
>gi|93278857|pdb|2BJB|A Chain A, Mycobacterium Tuberculosis Epsp Synthase In Unliganded State Length = 462 Back     alignment and structure
gi|178847075|pdb|2O0B|A Chain A, Mycobacterium Tuberculosis Epsp Synthase In Complex With S3p (Partially Photolyzed) Length = 450 Back     alignment and structure
>gi|326634644|pdb|3R38|A Chain A, 2.23 Angstrom Resolution Crystal Structure Of Udp-N-Acetylglucosamine 1-Carboxyvinyltransferase (Mura) From Listeria Monocytogenes Egd-E Length = 454 Back     alignment and structure
>gi|56553616|pdb|1P88|A Chain A, Substrate-Induced Structural Changes To The Isolated N- Terminal Domain Of 5-Enolpyruvylshikimate-3-Phosphate Synthase Length = 216 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target449 3-phosphoshikimate 1-carboxyvinyltransferase [Candidatu
2pqc_A445 3-phosphoshikimate 1-carboxyvinyltransferase; inside-OU 2e-81
1ejd_A419 MURA, EPT, UDP-N-acetylglucosamine enolpyruvyltransfera 2e-58
3nvs_A450 3-phosphoshikimate 1-carboxyvinyltransferase; structura 8e-58
1rf6_A427 5-enolpyruvylshikimate-3-phosphate synthase; shikimate 4e-54
1g6s_A427 EPSP synthase; two-domain structure, inside-OUT alpha-b 6e-46
2o0b_A450 3-phosphoshikimate 1-carboxyvinyltransferase; shikimate 1e-32
2yvw_A425 UDP-N-acetylglucosamine 1- carboxyvinyltransferase; pep 5e-29
>2pqc_A 3-phosphoshikimate 1-carboxyvinyltransferase; inside-OUT alpha/beta barrel; HET: RC1; 1.60A {Agrobacterium SP} PDB: 2pqb_A* 2gg6_A* 2gg4_A* 2gga_A* 2ggd_A* 2pqd_A* Length = 445 Back     alignment and structure
 Score =  297 bits (762), Expect = 2e-81
 Identities = 222/434 (51%), Positives = 302/434 (69%), Gaps = 2/434 (0%)

Query: 15  SCGLQGTICIPGDRSLSHFSIILGGIAAGETQIRGVLESDDVLNTMRMMHYLGARFTKKD 74
           S GL GT+ IPGD+S+SH S + GG+A+GET+I G+LE +DV+NT + M  +GAR  K+ 
Sbjct: 10  SSGLSGTVRIPGDKSISHRSFMFGGLASGETRITGLLEGEDVINTGKAMQAMGARIRKEG 69

Query: 75  REWIVQGVGNGCLLSPEYPLDFKGFDMGYGLMMGVVGVYDFQTFFKGRAEILQPTIESLL 134
             WI+ GVGNG LL+PE PLDF     G  L MG+VGVYDF + F G A + +  +  +L
Sbjct: 70  DTWIIDGVGNGGLLAPEAPLDFGNAATGCRLTMGLVGVYDFDSTFIGDASLTKRPMGRVL 129

Query: 135 APLYQMGVQVKLPEDKRLPLVLHGPRTPNPIVYKSPMDSVQSKSVVLLAGLNTPGITEVI 194
            PL +MGVQVK  +  RLP+ L GP+TP PI Y+ PM S Q KS VLLAGLNTPGIT VI
Sbjct: 130 NPLREMGVQVKSEDGDRLPVTLRGPKTPTPITYRVPMASAQVKSAVLLAGLNTPGITTVI 189

Query: 195 EPVKTQDHMEIILKEFGVDLLIKSDTIEDYSVRIEGRKRISGCNLKIPGDSSIAFFPLAA 254
           EP+ T+DH E +L+ FG +L +++D     ++R+EGR +++G  + +PGD S   FPL A
Sbjct: 190 EPIMTRDHTEKMLQGFGANLTVETDADGVRTIRLEGRGKLTGQVIDVPGDPSSTAFPLVA 249

Query: 255 ALLIPGSDIKLLNVLTNPLRVGIIDILREMGADITLSNSRIESGENIADIRVRFSKIKGI 314
           ALL+PGSD+ +LNVL NP R G+I  L+EMGADI + N R+  GE++AD+RVR S +KG+
Sbjct: 250 ALLVPGSDVTILNVLMNPTRTGLILTLQEMGADIEVINPRLAGGEDVADLRVRSSTLKGV 309

Query: 315 TISDNRLRSIVDEYPILLVISAFAEGETIIKGLAE--VMTSKQFSGIIECFNINNIQYER 372
           T+ ++R  S++DEYPIL V +AFAEG T++ GL E  V  S + S +     +N +  + 
Sbjct: 310 TVPEDRAPSMIDEYPILAVAAAFAEGATVMNGLEELRVKESDRLSAVANGLKLNGVDCDE 369

Query: 373 EGDYLMIKGVPGGKGLGCSTGHMVQSKFGYRVAMSFLVMGLASEYSVVVDDYTMISTIFP 432
               L+++G P GKGLG ++G  V +   +R+AMSFLVMGL SE  V VDD TMI+T FP
Sbjct: 370 GETSLVVRGRPDGKGLGNASGAAVATHLDHRIAMSFLVMGLVSENPVTVDDATMIATSFP 429

Query: 433 DFINLMKTLGARIE 446
           +F++LM  LGA+IE
Sbjct: 430 EFMDLMAGLGAKIE 443


>1ejd_A MURA, EPT, UDP-N-acetylglucosamine enolpyruvyltransferase; inside-OUT alpha/beta barrel; 1.55A {Enterobacter cloacae} SCOP: d.68.2.2 PDB: 1ejc_A 1eyn_A* 1ybg_A* 1naw_A 1q3g_A* 1dlg_A 1ryw_A* 2z2c_A* 1uae_A* 3iss_A* 1a2n_A* 2rl1_A* 2rl2_A* Length = 419 Back     alignment and structure
>3nvs_A 3-phosphoshikimate 1-carboxyvinyltransferase; structural genomics, center for structural genomics of infec diseases, csgid; HET: S3P SKM GPJ EPE; 1.02A {Vibrio cholerae} PDB: 1g6s_A* 1g6t_A* 1x8r_A* 1x8t_A* 2aa9_A* 2aay_A* 2pq9_A* 1eps_A 1mi4_A* 3fjz_A* 3fjx_A* 2qfs_A* 2qft_A* 2qfq_A* 2qfu_A* 3fk0_A* 3fk1_A* 1q36_A* 1p88_A 1p89_A Length = 450 Back     alignment and structure
>1rf6_A 5-enolpyruvylshikimate-3-phosphate synthase; shikimate pathway, EPSP synthase, glyphosate, PEP, transferase; HET: GPJ S3P; 1.90A {Streptococcus pneumoniae} SCOP: d.68.2.2 PDB: 1rf5_A 1rf4_A* Length = 427 Back     alignment and structure
>1g6s_A EPSP synthase; two-domain structure, inside-OUT alpha-beta barrel, transferase; HET: S3P GPJ; 1.50A {Escherichia coli} SCOP: d.68.2.2 PDB: 1g6t_A* 1x8r_A* 1x8t_A* 2aa9_A* 2aay_A* 2pq9_A* 1mi4_A* 3fjz_A* 3fjx_A* 2qfs_A* 2qft_A* 1q36_A* 2qfq_A* 2qfu_A* 3fk0_A* 3fk1_A* 1eps_A 1p88_A 1p89_A Length = 427 Back     alignment and structure
>2o0b_A 3-phosphoshikimate 1-carboxyvinyltransferase; shikimate pathway, EPSP synthase, structural genomics; HET: S3P; 1.15A {Mycobacterium tuberculosis} PDB: 2o0d_A* 2o0e_A* 2o0x_A* 2o0z_A* 2o15_A 2bjb_A Length = 450 Back     alignment and structure
>2yvw_A UDP-N-acetylglucosamine 1- carboxyvinyltransferase; peptidoglycan, structural genomics, NPPSFA; HET: EPU; 1.81A {Aquifex aeolicus VF5} Length = 425 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target449 3-phosphoshikimate 1-carboxyvinyltransferase [Candidatu
2pqc_A445 3-phosphoshikimate 1-carboxyvinyltransferase; inside-OU 100.0
1rf6_A427 5-enolpyruvylshikimate-3-phosphate synthase; shikimate 100.0
3nvs_A450 3-phosphoshikimate 1-carboxyvinyltransferase; structura 100.0
1ejd_A419 MURA, EPT, UDP-N-acetylglucosamine enolpyruvyltransfera 100.0
2o0b_A450 3-phosphoshikimate 1-carboxyvinyltransferase; shikimate 100.0
2yvw_A425 UDP-N-acetylglucosamine 1- carboxyvinyltransferase; pep 100.0
2o0b_A450 3-phosphoshikimate 1-carboxyvinyltransferase; shikimate 99.72
3nvs_A450 3-phosphoshikimate 1-carboxyvinyltransferase; structura 99.64
1ejd_A419 MURA, EPT, UDP-N-acetylglucosamine enolpyruvyltransfera 99.66
2pqc_A445 3-phosphoshikimate 1-carboxyvinyltransferase; inside-OU 99.59
1rf6_A427 5-enolpyruvylshikimate-3-phosphate synthase; shikimate 99.59
2yvw_A425 UDP-N-acetylglucosamine 1- carboxyvinyltransferase; pep 99.47
>2pqc_A 3-phosphoshikimate 1-carboxyvinyltransferase; inside-OUT alpha/beta barrel; HET: RC1; 1.60A {Agrobacterium SP} PDB: 2pqb_A* 2gg6_A* 2gg4_A* 2gga_A* 2ggd_A* 2pqd_A* Back     alignment and structure
Probab=100.00  E-value=0  Score=752.41  Aligned_cols=440  Identities=50%  Similarity=0.866  Sum_probs=421.7

Q ss_pred             EEEEEECCCCEEEEEECCCCHHHHHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHCCCEEEEECCEEEEEECCCCCC
Q ss_conf             15897068853699981842228999999997449849997798028999999999984979999899899981268875
Q gi|254780458|r    8 STIQSSYSCGLQGTICIPGDRSLSHFSIILGGIAAGETQIRGVLESDDVLNTMRMMHYLGARFTKKDREWIVQGVGNGCL   87 (449)
Q Consensus         8 ~~~~~~~~~~L~G~i~vp~SKs~s~RaLl~AaLa~g~s~i~n~~~s~Dv~~~l~al~~LG~~i~~~~~~~~i~g~g~~~~   87 (449)
                      -++++|++++|+|+|++|||||++||+|++|||++|+|+|+|+++++||..|+++|++||++|++++++++|+|.+.+.+
T Consensus         3 ~~~~~~~~~~L~G~v~~pgSKs~~~R~L~~aal~~g~s~i~n~~~~~Dv~~m~~~L~~lG~~i~~~~~~~~I~g~~~~~~   82 (445)
T 2pqc_A            3 RPATARKSSGLSGTVRIPGDKSISHRSFMFGGLASGETRITGLLEGEDVINTGKAMQAMGARIRKEGDTWIIDGVGNGGL   82 (445)
T ss_dssp             CCEEEECCSCCEEEEECCBCHHHHHHHHHHHHHSEEEEEEESCCCSHHHHHHHHHHHHTTCEEEEETTEEEEEEECTTCC
T ss_pred             CCEECCCCCCEEEEEECCCCHHHHHHHHHHHHHCCCCEEECCCCCCHHHHHHHHHHHHCCCEEEEECCEEEEEECCCCCC
T ss_conf             98772799970699976881899999999999759999992698239999999999977998999799999993688876


Q ss_pred             CCCCCEEEECCCCCCCCEEEEECCCCCCEEEECCCCCCCCCCCCCEEEEEEECCCCEEECCCCCCCCEEECCCCCCCEEE
Q ss_conf             68531055033333220013431455310331233333446542101012312741010134322201202221111134
Q gi|254780458|r   88 LSPEYPLDFKGFDMGYGLMMGVVGVYDFQTFFKGRAEILQPTIESLLAPLYQMGVQVKLPEDKRLPLVLHGPRTPNPIVY  167 (449)
Q Consensus        88 ~~~~~~i~~~~sgt~~r~l~~~l~~~~~~~~i~G~~~l~~Rpi~~li~~L~~lGa~i~~~~~~~~Pi~I~g~~~~~~~~~  167 (449)
                      ..|+..+|+++||+++||++++++..++.+.++|+++|++|||++|+++|++||+++++.+++++|+.|+|+...+++.+
T Consensus        83 ~~~~~~i~~g~sgt~~r~l~~l~~~~~~~~~~~G~~~l~~RPi~~l~~~L~~lGa~i~~~~~~~lPi~i~g~~~~~~~~i  162 (445)
T 2pqc_A           83 LAPEAPLDFGNAATGCRLTMGLVGVYDFDSTFIGDASLTKRPMGRVLNPLREMGVQVKSEDGDRLPVTLRGPKTPTPITY  162 (445)
T ss_dssp             CCCSSCEECTTCHHHHHHHHHHHHTSSSEEEEECCTTGGGSCCHHHHHHHHHTTCEEEEETTTEEEEEEECCSSCCCCEE
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCHHHHHHHHHHCCCEEEECCCCCCCEEEECCCCCCCEEE
T ss_conf             68626778765567888765554057843997586341641389999999854745760579846779986688866799


Q ss_pred             EECCCCCCCCCEEHHHHHCCCCCCCCCCCCCCCCHHHHHHHHCCCEEEEECCCCCEEEEEECCCCCCCCCCCCCCCCHHH
Q ss_conf             30234443320000000000112223465454424444665449734441133310026752865102332002321122
Q gi|254780458|r  168 KSPMDSVQSKSVVLLAGLNTPGITEVIEPVKTQDHMEIILKEFGVDLLIKSDTIEDYSVRIEGRKRISGCNLKIPGDSSI  247 (449)
Q Consensus       168 ~~~~~S~q~~s~lLlA~~~~~g~t~i~~~~~s~~~i~~~L~~fG~~i~~~~~~~~~~~i~i~g~~~l~~~~~~Ip~D~ss  247 (449)
                      ..+.+|||+++++|||++.+++.++++++..+++|++.+|+.||.++.++.+..+.++|+|+|+++|.+.+|.||+|||+
T Consensus       163 ~~~~~S~~~~s~lllaa~~~~g~~~i~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~i~i~g~~~~~~~~~~v~~D~s~  242 (445)
T 2pqc_A          163 RVPMASAQVKSAVLLAGLNTPGITTVIEPIMTRDHTEKMLQGFGANLTVETDADGVRTIRLEGRGKLTGQVIDVPGDPSS  242 (445)
T ss_dssp             ECSSSCHHHHHHHHHHHHTSSSEEEEEESSCCCCHHHHHHHHTTCCEEEEECTTSCEEEEEETTCCCBCCEEECCBCHHH
T ss_pred             ECCCCCHHHHHHHHHCCCCCCCCEEEECCCCCCCHHHHHHHHHCCCCCCCCCCCCCEEEEECCCCCCCCCEEECCCCHHH
T ss_conf             81565499999999523148995899588777779999999852665421158881699987655568847883898789


Q ss_pred             HHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHCCCCCCCCCCCCEEEEECCCCCEEEEEECCCCCCCCCCCCCCCHHH
Q ss_conf             10000011225565322233323222222210000013432344422787034320256420233323464435430111
Q gi|254780458|r  248 AFFPLAAALLIPGSDIKLLNVLTNPLRVGIIDILREMGADITLSNSRIESGENIADIRVRFSKIKGITISDNRLRSIVDE  327 (449)
Q Consensus       248 Aa~~la~a~l~~g~~i~i~n~~~~~~q~~~ldiL~~mG~~i~~~~~~~~~~~~~~~i~~~~~~l~g~~i~~~~~~~~~D~  327 (449)
                      |+||+++|++++|+++++.|+..++.|.+++++|++||+++++.++++..++...++.++...|++++++..++|+++|+
T Consensus       243 aa~~~~aaa~~~g~~i~i~n~~~~~~~~~~l~iL~~mG~~i~~~~~~~~~~~~~~~i~~~~~~l~~~~~~~~~~p~~~D~  322 (445)
T 2pqc_A          243 TAFPLVAALLVPGSDVTILNVLMNPTRTGLILTLQEMGADIEVINPRLAGGEDVADLRVRSSTLKGVTVPEDRAPSMIDE  322 (445)
T ss_dssp             HHHHHHHHHHSTTCEEEEEEEECCGGGCHHHHHHHHHTCEEEEEEEEEETTEEEEEEEEECCCCBCCEECGGGGGGTGGG
T ss_pred             HHHHHHHHHHCCCCEEEECCCCCCCCHHHHHHHHHHCCCEEEEECCEEECCCCEEEEEEEECCCCCCCCCCCCCCCHHHH
T ss_conf             99999999976998599818886620789999999859979960454764860267887631456631574559975889


Q ss_pred             CCCCCCCCCCCCCCCCCCCCHHH--HHHHHHHHHHHHHHHCCCEEEEECCEEEEECCCCCCCCCCCCCCEEECCCCHHHH
Q ss_conf             01112322223474100272001--2456899999999746978999889599976788766665687266048845899
Q gi|254780458|r  328 YPILLVISAFAEGETIIKGLAEV--MTSKQFSGIIECFNINNIQYEREGDYLMIKGVPGGKGLGCSTGHMVQSKFGYRVA  405 (449)
Q Consensus       328 ~p~Lavla~~a~G~t~i~gi~~l--kesdRi~~~~~~L~~~G~~~~~~~d~l~I~G~~~~~~~~~~~~~~v~s~~DHRia  405 (449)
                      +|+|+++|++|+|+|+|+|++|+  |||||++++.++|+|||+++++++|+++|+|.+.+++....+++.++||+|||+|
T Consensus       323 ~p~la~~a~~a~g~s~i~gi~~lr~kEsdRi~~~~~eL~k~G~~i~~~~d~l~I~g~~~~~~~~~~~g~~i~t~~DHRia  402 (445)
T 2pqc_A          323 YPILAVAAAFAEGATVMNGLEELRVKESDRLSAVANGLKLNGVDCDEGETSLVVRGRPDGKGLGNASGAAVATHLDHRIA  402 (445)
T ss_dssp             HHHHHHHHTTSBSEEEECCCGGGGGSSSCHHHHHHHHHHHTTCEEEECSSCEEEECCTTCTTCSCTTCCEECCTTCHHHH
T ss_pred             HHHHHHHHHHCCCCEEEECHHHHHCCHHHHHHHHHHHHHHCCCEEEEECCEEEEECCCCCCCCCCCCCCEEECCCCHHHH
T ss_conf             99999999847997699122673010017899999999977987998388699968866656667767678589978999


Q ss_pred             HHHHHHHHHCCCCEEEECCCEECCCCCCHHHHHHHCCCEEEE
Q ss_conf             999999973599589944543027786988899865978988
Q gi|254780458|r  406 MSFLVMGLASEYSVVVDDYTMISTIFPDFINLMKTLGARIEW  447 (449)
Q Consensus       406 Ma~~i~gl~~~~~~~I~~~~~v~ksyP~F~~~l~~LGa~ie~  447 (449)
                      |++++|||+++++++|+|++||+||||+||++|++|||+||.
T Consensus       403 ma~~iaal~~~g~~~I~~~~~v~ksyP~f~~~l~~LGa~ie~  444 (445)
T 2pqc_A          403 MSFLVMGLVSENPVTVDDATMIATSFPEFMDLMAGLGAKIEL  444 (445)
T ss_dssp             HHHHHHHTTSSSCEEESCCTTGGGTCTTHHHHHHHHTCEEEE
T ss_pred             HHHHHHHHHCCCCEEEECCEEEECCCHHHHHHHHHCCCEEEE
T ss_conf             999999986899899956807967046099999957988995



>1rf6_A 5-enolpyruvylshikimate-3-phosphate synthase; shikimate pathway, EPSP synthase, glyphosate, PEP, transferase; HET: GPJ S3P; 1.90A {Streptococcus pneumoniae} SCOP: d.68.2.2 PDB: 1rf5_A 1rf4_A* Back     alignment and structure
>3nvs_A 3-phosphoshikimate 1-carboxyvinyltransferase; structural genomics, center for structural genomics of infec diseases, csgid; HET: S3P SKM GPJ EPE; 1.02A {Vibrio cholerae} PDB: 1g6s_A* 1g6t_A* 1x8r_A* 1x8t_A* 2aa9_A* 2aay_A* 2pq9_A* 1eps_A 1mi4_A* 3fjz_A* 3fjx_A* 2qfs_A* 2qft_A* 2qfq_A* 2qfu_A* 3fk0_A* 3fk1_A* 1q36_A* 1p88_A 1p89_A Back     alignment and structure
>1ejd_A MURA, EPT, UDP-N-acetylglucosamine enolpyruvyltransferase; inside-OUT alpha/beta barrel; 1.55A {Enterobacter cloacae} SCOP: d.68.2.2 PDB: 1ejc_A 1eyn_A* 1ybg_A* 1naw_A 1q3g_A* 1dlg_A 1ryw_A* 3lth_A* 3kqa_A* 3kqj_A* 2z2c_A* 1uae_A* 3iss_A* 3kr6_A* 1a2n_A* 2rl1_A* 2rl2_A* Back     alignment and structure
>2o0b_A 3-phosphoshikimate 1-carboxyvinyltransferase; shikimate pathway, EPSP synthase, structural genomics; HET: S3P; 1.15A {Mycobacterium tuberculosis} PDB: 2o0d_A* 2o0e_A* 2o0x_A* 2o0z_A* 2o15_A 2bjb_A Back     alignment and structure
>2yvw_A UDP-N-acetylglucosamine 1- carboxyvinyltransferase; peptidoglycan, structural genomics, NPPSFA; HET: EPU; 1.81A {Aquifex aeolicus VF5} Back     alignment and structure
>2o0b_A 3-phosphoshikimate 1-carboxyvinyltransferase; shikimate pathway, EPSP synthase, structural genomics; HET: S3P; 1.15A {Mycobacterium tuberculosis} PDB: 2o0d_A* 2o0e_A* 2o0x_A* 2o0z_A* 2o15_A 2bjb_A Back     alignment and structure
>3nvs_A 3-phosphoshikimate 1-carboxyvinyltransferase; structural genomics, center for structural genomics of infec diseases, csgid; HET: S3P SKM GPJ EPE; 1.02A {Vibrio cholerae} PDB: 1g6s_A* 1g6t_A* 1x8r_A* 1x8t_A* 2aa9_A* 2aay_A* 2pq9_A* 1eps_A 1mi4_A* 3fjz_A* 3fjx_A* 2qfs_A* 2qft_A* 2qfq_A* 2qfu_A* 3fk0_A* 3fk1_A* 1q36_A* 1p88_A 1p89_A Back     alignment and structure
>1ejd_A MURA, EPT, UDP-N-acetylglucosamine enolpyruvyltransferase; inside-OUT alpha/beta barrel; 1.55A {Enterobacter cloacae} SCOP: d.68.2.2 PDB: 1ejc_A 1eyn_A* 1ybg_A* 1naw_A 1q3g_A* 1dlg_A 1ryw_A* 3lth_A* 3kqa_A* 3kqj_A* 2z2c_A* 1uae_A* 3iss_A* 3kr6_A* 1a2n_A* 2rl1_A* 2rl2_A* Back     alignment and structure
>2pqc_A 3-phosphoshikimate 1-carboxyvinyltransferase; inside-OUT alpha/beta barrel; HET: RC1; 1.60A {Agrobacterium SP} PDB: 2pqb_A* 2gg6_A* 2gg4_A* 2gga_A* 2ggd_A* 2pqd_A* Back     alignment and structure
>1rf6_A 5-enolpyruvylshikimate-3-phosphate synthase; shikimate pathway, EPSP synthase, glyphosate, PEP, transferase; HET: GPJ S3P; 1.90A {Streptococcus pneumoniae} SCOP: d.68.2.2 PDB: 1rf5_A 1rf4_A* Back     alignment and structure
>2yvw_A UDP-N-acetylglucosamine 1- carboxyvinyltransferase; peptidoglycan, structural genomics, NPPSFA; HET: EPU; 1.81A {Aquifex aeolicus VF5} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 449 3-phosphoshikimate 1-carboxyvinyltransferase [Candidatu
d1rf6a_427 d.68.2.2 (A:) 5-enol-pyruvyl shikimate-3-phosphate (EPS 1e-55
d1g6sa_427 d.68.2.2 (A:) 5-enol-pyruvyl shikimate-3-phosphate (EPS 2e-37
d1ejda_419 d.68.2.2 (A:) UDP-N-acetylglucosamine enolpyruvyl trans 1e-35
d1p88a_216 d.68.2.2 (A:) 5-enol-pyruvyl shikimate-3-phosphate (EPS 4e-18
>d1rf6a_ d.68.2.2 (A:) 5-enol-pyruvyl shikimate-3-phosphate (EPSP) synthase {Streptococcus pneumoniae [TaxId: 1313]} Length = 427 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: IF3-like
superfamily: EPT/RTPC-like
family: Enolpyruvate transferase, EPT
domain: 5-enol-pyruvyl shikimate-3-phosphate (EPSP) synthase
species: Streptococcus pneumoniae [TaxId: 1313]
 Score =  211 bits (537), Expect = 1e-55
 Identities = 132/428 (30%), Positives = 214/428 (50%), Gaps = 17/428 (3%)

Query: 18  LQGTICIPGDRSLSHFSIILGGIAAGETQIRGVLESDDVLNTMRMMHYLGARFTKKDREW 77
           L G I +PGD+S+SH SII G +A GET++  +L  +DVL+TM++   LG     KD   
Sbjct: 10  LHGIIRVPGDKSISHRSIIFGSLAEGETKVYDILRGEDVLSTMQVFRDLGVEIEDKDGVI 69

Query: 78  IVQGVGNGCLLSPEYPLDFKGFDMGYGLMMGVVGVYDFQTFFKGRAEILQPTIESLLAPL 137
            VQGVG   L +P+  L+         L+ GV+   DF+    G   + +  ++ +  PL
Sbjct: 70  TVQGVGMAGLKAPQNALNMGNSGTSIRLISGVLAGADFEVEMFGDDSLSKRPMDRVTLPL 129

Query: 138 YQMGVQVK-LPEDKRLPLVLHGPRTPNPIVYKSPMDSVQSKSVVLLAGLNTPGITEVIEP 196
            +MGV +    E    PL L G +   PI Y+ P+ S Q KS ++ A L   G + +IE 
Sbjct: 130 KKMGVSISGQTERDLPPLRLKGTKNLRPIHYELPIASAQVKSALMFAALQAKGESVIIEK 189

Query: 197 VKTQDHMEIILKEFGVDLLIKSDTIEDYSVRIEGRKRISGCNLKIPGDSSIAFFPLAAAL 256
             T++H E +L++FG  L +    I      ++G ++++G  + +PGD S A F L A L
Sbjct: 190 EYTRNHTEDMLQQFGGHLSVDGKKIT-----VQGPQKLTGQKVVVPGDISSAAFWLVAGL 244

Query: 257 LIPGSDIKLLNVLTNPLRVGIIDILREMGADITLSNSRIESGENIADIRVRFSKIKGITI 316
           + P S + L NV  N  R GIID++R MG  +    + I+     A + V  S +KG  I
Sbjct: 245 IAPNSRLVLQNVGINETRTGIIDVIRAMGGKLE--ITEIDPVAKSATLIVESSDLKGTEI 302

Query: 317 SDNRLRSIVDEYPILLVISAFAEGETIIKGLAE--VMTSKQFSGIIECFNINNIQYEREG 374
               +  ++DE PI+ +++  A+G T+IK   E  V  + +   + +  N          
Sbjct: 303 CGALIPRLIDELPIIALLATQAQGVTVIKDAEELKVKETDRIQVVADALNSMGADITPTA 362

Query: 375 DYLMIKGVPGGKGLGCSTGHMVQSKFGYRVAMSFLVMGL-ASEYSVVVDDYTMISTIFPD 433
           D ++IKG           G  V +   +R+ M   +  L  ++  V +D    I+T +P 
Sbjct: 363 DGMIIKGKSALH------GARVNTFGDHRIGMMTAIAALLVADGEVELDRAEAINTSYPS 416

Query: 434 FINLMKTL 441
           F + +++L
Sbjct: 417 FFDDLESL 424


>d1g6sa_ d.68.2.2 (A:) 5-enol-pyruvyl shikimate-3-phosphate (EPSP) synthase {Escherichia coli [TaxId: 562]} Length = 427 Back     information, alignment and structure
>d1ejda_ d.68.2.2 (A:) UDP-N-acetylglucosamine enolpyruvyl transferase (EPT, MurA, MurZ) {Enterobacter cloacae [TaxId: 550]} Length = 419 Back     information, alignment and structure
>d1p88a_ d.68.2.2 (A:) 5-enol-pyruvyl shikimate-3-phosphate (EPSP) synthase {Escherichia coli [TaxId: 562]} Length = 216 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target449 3-phosphoshikimate 1-carboxyvinyltransferase [Candidatu
d1rf6a_427 5-enol-pyruvyl shikimate-3-phosphate (EPSP) synthase {S 100.0
d1g6sa_427 5-enol-pyruvyl shikimate-3-phosphate (EPSP) synthase {E 100.0
d1ejda_419 UDP-N-acetylglucosamine enolpyruvyl transferase (EPT, M 100.0
d1p88a_216 5-enol-pyruvyl shikimate-3-phosphate (EPSP) synthase {E 100.0
d1ejda_419 UDP-N-acetylglucosamine enolpyruvyl transferase (EPT, M 99.63
d1g6sa_427 5-enol-pyruvyl shikimate-3-phosphate (EPSP) synthase {E 99.56
d1rf6a_427 5-enol-pyruvyl shikimate-3-phosphate (EPSP) synthase {S 99.6
d1p88a_216 5-enol-pyruvyl shikimate-3-phosphate (EPSP) synthase {E 99.16
d1qmha2239 RNA 3'-terminal phosphate cyclase, RPTC {Escherichia co 93.86
>d1rf6a_ d.68.2.2 (A:) 5-enol-pyruvyl shikimate-3-phosphate (EPSP) synthase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: IF3-like
superfamily: EPT/RTPC-like
family: Enolpyruvate transferase, EPT
domain: 5-enol-pyruvyl shikimate-3-phosphate (EPSP) synthase
species: Streptococcus pneumoniae [TaxId: 1313]
Probab=100.00  E-value=0  Score=693.70  Aligned_cols=416  Identities=31%  Similarity=0.492  Sum_probs=381.1

Q ss_pred             ECCCCEEEEEECCCCHHHHHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHCCCEEEEECCEEEEEECCCCCCCCCCC
Q ss_conf             06885369998184222899999999744984999779802899999999998497999989989998126887568531
Q gi|254780458|r   13 SYSCGLQGTICIPGDRSLSHFSIILGGIAAGETQIRGVLESDDVLNTMRMMHYLGARFTKKDREWIVQGVGNGCLLSPEY   92 (449)
Q Consensus        13 ~~~~~L~G~i~vp~SKs~s~RaLl~AaLa~g~s~i~n~~~s~Dv~~~l~al~~LG~~i~~~~~~~~i~g~g~~~~~~~~~   92 (449)
                      .++++|+|+|++|||||+|||+|++|+|++|+|+|+|+++|+||..|+++|++||++|++++++++|+|.|.+.+..|+.
T Consensus         5 ~~~~~l~G~i~~pgSKS~s~R~L~laaLa~g~s~i~n~~~s~Dv~~~~~~L~~lG~~i~~~~~~~~I~g~g~~~~~~~~~   84 (427)
T d1rf6a_           5 TNIRHLHGIIRVPGDKSISHRSIIFGSLAEGETKVYDILRGEDVLSTMQVFRDLGVEIEDKDGVITVQGVGMAGLKAPQN   84 (427)
T ss_dssp             CCCCCEEEEECCCBCHHHHHHHHHHHHHSBSEEEEESCCCSHHHHHHHHHHHHTTCEEEEETTEEEEECCCSSCCCCCSS
T ss_pred             CCCCCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHCCCEEEECCCEEEEEECCCCCCCCCHH
T ss_conf             68877179998378689999999999976998999379904999999999997889899759999999168877678615


Q ss_pred             EEEECCCCCCCCEEEEECCCCCCEEEECCCCCCCCCCCCCEEEEEEECCCCEEECC-CCCCCCEEECCCCCCCEEEEECC
Q ss_conf             05503333322001343145531033123333344654210101231274101013-43222012022211111343023
Q gi|254780458|r   93 PLDFKGFDMGYGLMMGVVGVYDFQTFFKGRAEILQPTIESLLAPLYQMGVQVKLPE-DKRLPLVLHGPRTPNPIVYKSPM  171 (449)
Q Consensus        93 ~i~~~~sgt~~r~l~~~l~~~~~~~~i~G~~~l~~Rpi~~li~~L~~lGa~i~~~~-~~~~Pi~I~g~~~~~~~~~~~~~  171 (449)
                      .+++++||+++||++++++..++.+.++|+++|++|||++|+++|++|||++++.+ ++.+|+.++|+...+++.+..+.
T Consensus        85 ~i~~~~sgt~~r~l~~l~a~~~~~v~~~G~~~l~~RPi~~l~~~L~~lGa~i~~~~~~~~~p~~i~g~~~~~~~~i~~~~  164 (427)
T d1rf6a_          85 ALNMGNSGTSIRLISGVLAGADFEVEMFGDDSLSKRPMDRVTLPLKKMGVSISGQTERDLPPLRLKGTKNLRPIHYELPI  164 (427)
T ss_dssp             CEECTTCHHHHHHHHHHGGGCSSEEEEECCTTGGGSCCHHHHHHHHHTTCEEEEETTTTEEEEEEECCTTCCCCEEECSS
T ss_pred             HHHHCCCCEEECCCCCCCCCCCCEEECCCCCCCCCCCCCCCCHHHHHCCCEEEECCCCCCEEEECCCCCCCCCEEEECCC
T ss_conf             56531443000012222245431120479813036555420006876394798303556202302477887445995357


Q ss_pred             CCCCCCCEEHHHHHCCCCCCCCCCCCCCCCHHHHHHHHCCCEEEEECCCCCEEEEEECCCCCCCCCCCCCCCCHHHHHHC
Q ss_conf             44433200000000001122234654544244446654497344411333100267528651023320023211221000
Q gi|254780458|r  172 DSVQSKSVVLLAGLNTPGITEVIEPVKTQDHMEIILKEFGVDLLIKSDTIEDYSVRIEGRKRISGCNLKIPGDSSIAFFP  251 (449)
Q Consensus       172 ~S~q~~s~lLlA~~~~~g~t~i~~~~~s~~~i~~~L~~fG~~i~~~~~~~~~~~i~i~g~~~l~~~~~~Ip~D~ssAa~~  251 (449)
                      +|||+++++|||++..+|.+++.+.....++++.+|++||+++.+..     ..+.|+|+++|.|.+|.||+|||+|+||
T Consensus       165 ~S~q~ts~lllaa~~~~g~~~i~~~~~~~~~t~~~L~~~G~~i~~~~-----~~i~i~~~~~l~~~~~~V~~D~s~A~~~  239 (427)
T d1rf6a_         165 ASAQVKSALMFAALQAKGESVIIEKEYTRNHTEDMLQQFGGHLSVDG-----KKITVQGPQKLTGQKVVVPGDISSAAFW  239 (427)
T ss_dssp             CCHHHHHHHHHHHTTSSEEEEEECSSCCCCHHHHHHHHTTCCCEEET-----TEEEEEECCCCBCCEEECCBCHHHHHHH
T ss_pred             CCHHHHHHHHHHHHCCCCCEEEECCCCCHHHHHHHHHHCCCCCCCCC-----EEEEECCCCEECCCEEECCCCHHHHHHH
T ss_conf             76756443554222058943553243107789999997399752231-----2899886311167469858976789999


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCHHCCCCCCCCCCCCEEEEECCCCCEEEEEECCCCCCCCCCCCCCCHHHCCCC
Q ss_conf             00112255653222333232222222100000134323444227870343202564202333234644354301110111
Q gi|254780458|r  252 LAAALLIPGSDIKLLNVLTNPLRVGIIDILREMGADITLSNSRIESGENIADIRVRFSKIKGITISDNRLRSIVDEYPIL  331 (449)
Q Consensus       252 la~a~l~~g~~i~i~n~~~~~~q~~~ldiL~~mG~~i~~~~~~~~~~~~~~~i~~~~~~l~g~~i~~~~~~~~~D~~p~L  331 (449)
                      +++|++++|++|+++|++.++.|.+++++|++||+++++.+.+..  .......+....|++++++..++|++||++|++
T Consensus       240 l~aaal~~g~~i~i~~~~~~~~~~~~~~~l~~~g~~i~~~~~~~~--~~~~~~~~~~~~l~~~~~~~~~~p~~~d~~p~l  317 (427)
T d1rf6a_         240 LVAGLIAPNSRLVLQNVGINETRTGIIDVIRAMGGKLEITEIDPV--AKSATLIVESSDLKGTEICGALIPRLIDELPII  317 (427)
T ss_dssp             HHHHHHSTTEEEEEEEEECCTTTCHHHHHHHHTTCEEEEEEEETT--TTEEEEEEECCCCBCCEECTTSGGGTGGGHHHH
T ss_pred             HHHHHHCCCCEEEECCCCCCCCHHHHHHHHHCCCCEEEECCCCCC--CCCCCEEEECCCCCCCCCCCCCCCCCHHHHHHH
T ss_conf             999996799879987789760016788764114530341133232--223402331266442223445588723455577


Q ss_pred             CCCCCCCCCCCCCCCCHHH--HHHHHHHHHHHHHHHCCCEEEEECCEEEEECCCCCCCCCCCCCCEEECCCCHHHHHHHH
Q ss_conf             2322223474100272001--24568999999997469789998895999767887666656872660488458999999
Q gi|254780458|r  332 LVISAFAEGETIIKGLAEV--MTSKQFSGIIECFNINNIQYEREGDYLMIKGVPGGKGLGCSTGHMVQSKFGYRVAMSFL  409 (449)
Q Consensus       332 avla~~a~G~t~i~gi~~l--kesdRi~~~~~~L~~~G~~~~~~~d~l~I~G~~~~~~~~~~~~~~v~s~~DHRiaMa~~  409 (449)
                      +++|++|+|+|+|+|++|+  |||||+.++.++|+|||+++++++|+++|+|++.      .+++.|+||+|||+|||++
T Consensus       318 a~la~~a~G~s~i~g~~~lr~kEsdRi~~~~~eL~klG~~~~~~~d~l~I~G~~~------l~g~~v~s~~DHRiama~~  391 (427)
T d1rf6a_         318 ALLATQAQGVTVIKDAEELKVKETDRIQVVADALNSMGADITPTADGMIIKGKSA------LHGARVNTFGDHRIGMMTA  391 (427)
T ss_dssp             HHHHHTSBEEEEECSCGGGGGSSSCTTHHHHHHHHTTTCCEEEETTEEEEEECCC------CCCEEEECTTCHHHHHHHH
T ss_pred             HHHHHCCCCCEECCCHHHHHHHHHHHHHHHHHHHHHCCCEEEEECCEEEEECCCC------CCCCEEECCCCHHHHHHHH
T ss_conf             7765315784000207888889989999999999977997999899999979998------8478778988199999999


Q ss_pred             HHHHH-CCCCEEEECCCEECCCCCCHHHHHHHC
Q ss_conf             99973-599589944543027786988899865
Q gi|254780458|r  410 VMGLA-SEYSVVVDDYTMISTIFPDFINLMKTL  441 (449)
Q Consensus       410 i~gl~-~~~~~~I~~~~~v~ksyP~F~~~l~~L  441 (449)
                      ++|+. ++++++|+|++||+||||+||++|++|
T Consensus       392 i~al~~~~g~~~I~~~~~v~ksyP~F~~~l~~L  424 (427)
T d1rf6a_         392 IAALLVADGEVELDRAEAINTSYPSFFDDLESL  424 (427)
T ss_dssp             HHHHTCSSSCEEEETGGGGGGTCTTHHHHHHHH
T ss_pred             HHHHHCCCCCEEECCCCEEECCCHHHHHHHHHH
T ss_conf             999965899699827837978765099999997



>d1g6sa_ d.68.2.2 (A:) 5-enol-pyruvyl shikimate-3-phosphate (EPSP) synthase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ejda_ d.68.2.2 (A:) UDP-N-acetylglucosamine enolpyruvyl transferase (EPT, MurA, MurZ) {Enterobacter cloacae [TaxId: 550]} Back     information, alignment and structure
>d1p88a_ d.68.2.2 (A:) 5-enol-pyruvyl shikimate-3-phosphate (EPSP) synthase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ejda_ d.68.2.2 (A:) UDP-N-acetylglucosamine enolpyruvyl transferase (EPT, MurA, MurZ) {Enterobacter cloacae [TaxId: 550]} Back     information, alignment and structure
>d1g6sa_ d.68.2.2 (A:) 5-enol-pyruvyl shikimate-3-phosphate (EPSP) synthase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rf6a_ d.68.2.2 (A:) 5-enol-pyruvyl shikimate-3-phosphate (EPSP) synthase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1p88a_ d.68.2.2 (A:) 5-enol-pyruvyl shikimate-3-phosphate (EPSP) synthase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 449 3-phosphoshikimate 1-carboxyvinyltransferase [Cand
2pqc_A_11-20_241-30575 (A:11-20,A:241-305) 3-phosphoshikimate 1-carboxyvi 1e-20
1rf6_A_1-17_234-296_412-42796 (A:1-17,A:234-296,A:412-427) 5-enolpyruvylshikimat 7e-19
1g6s_A_10-20_244-302_415-42783 (A:10-20,A:244-302,A:415-427) EPSP synthase; two-d 3e-08
2o0b_A_21-240220 (A:21-240) 3-phosphoshikimate 1-carboxyvinyltransf 2e-19
1g6s_A_21-243223 (A:21-243) EPSP synthase; two-domain structure, in 5e-19
1ejd_A_21-230210 (A:21-230) MURA, EPT, UDP-N-acetylglucosamine enol 4e-15
2yvw_A_30-237208 (A:30-237) UDP-N-acetylglucosamine 1- carboxyvinyl 1e-14
2o0b_A_21-240220 (A:21-240) 3-phosphoshikimate 1-carboxyvinyltransf 7e-10
1g6s_A_21-243223 (A:21-243) EPSP synthase; two-domain structure, in 0.001
1ejd_A_21-230210 (A:21-230) MURA, EPT, UDP-N-acetylglucosamine enol 2e-05
1g6s_A_21-243223 (A:21-243) EPSP synthase; two-domain structure, in 0.002
1rf6_A_297-411115 (A:297-411) 5-enolpyruvylshikimate-3-phosphate syn 4e-11
2yvw_A_1-18_295-425149 (A:1-18,A:295-425) UDP-N-acetylglucosamine 1- carb 4e-05
2o0b_A_1-9_299-409120 (A:1-9,A:299-409) 3-phosphoshikimate 1-carboxyviny 6e-05
2pqc_A_83-228146 (A:83-228) 3-phosphoshikimate 1-carboxyvinyltransf 2e-17
1rf6_A_80-220141 (A:80-220) 5-enolpyruvylshikimate-3-phosphate synt 1e-12
1ejd_A_21-230210 (A:21-230) MURA, EPT, UDP-N-acetylglucosamine enol 0.002
1ejd_A_1-20_231-419209 (A:1-20,A:231-419) MURA, EPT, UDP-N-acetylglucosam 9e-15
2o0b_A_10-20_241-298_410-450110 (A:10-20,A:241-298,A:410-450) 3-phosphoshikimate 1 3e-14
2pqc_A_1-10_389-44567 (A:1-10,A:389-445) 3-phosphoshikimate 1-carboxyvin 3e-13
1rf6_A_18-79_221-23375 (A:18-79,A:221-233) 5-enolpyruvylshikimate-3-phosp 7e-12
2pqc_A_21-82_229-24074 (A:21-82,A:229-240) 3-phosphoshikimate 1-carboxyvi 6e-10
2pqc_A_306-38883 (A:306-388) 3-phosphoshikimate 1-carboxyvinyltrans 4e-09
1g6s_A_303-37472 (A:303-374) EPSP synthase; two-domain structure, i 2e-04
>2pqc_A (A:11-20,A:241-305) 3-phosphoshikimate 1-carboxyvinyltransferase; inside-OUT alpha/beta barrel; HET: RC1; 1.60A {Agrobacterium SP} PDB: 2pqb_A* 2gg6_A* 2gg4_A* 2gga_A* 2ggd_A* 2pqd_A*Length = 75 Back     alignment and structure
 Score = 95.6 bits (238), Expect = 1e-20
 Identities = 38/65 (58%), Positives = 48/65 (73%)

Query: 246 SIAFFPLAAALLIPGSDIKLLNVLTNPLRVGIIDILREMGADITLSNSRIESGENIADIR 305
           S   FPL AALL+PGSD+ +LNVL NP R G+I  L+EMGADI + N R+  GE++AD+R
Sbjct: 11  SSTAFPLVAALLVPGSDVTILNVLMNPTRTGLILTLQEMGADIEVINPRLAGGEDVADLR 70

Query: 306 VRFSK 310
           VR S 
Sbjct: 71  VRSST 75


>1rf6_A (A:1-17,A:234-296,A:412-427) 5-enolpyruvylshikimate-3-phosphate synthase; shikimate pathway, EPSP synthase, glyphosate, PEP, transferase; HET: GPJ S3P; 1.90A {Streptococcus pneumoniae}Length = 96 Back     alignment and structure
>1g6s_A (A:10-20,A:244-302,A:415-427) EPSP synthase; two-domain structure, inside-OUT alpha-beta barrel, transferase; HET: S3P GPJ; 1.50A {Escherichia coli}Length = 83 Back     alignment and structure
>2o0b_A (A:21-240) 3-phosphoshikimate 1-carboxyvinyltransferase; shikimate pathway, EPSP synthase, structural genomics; HET: S3P; 1.15A {Mycobacterium tuberculosis} PDB: 2o0d_A* 2o0e_A* 2o0x_A* 2o0z_A* 2o15_A 2bjb_ALength = 220 Back     alignment and structure