254780459

254780459

hypothetical protein CLIBASIA_01720

GeneID in NCBI database:8209446Locus tag:CLIBASIA_01720
Protein GI in NCBI database:254780459Protein Accession:YP_003064872.1
Gene range:+(377508, 377897)Protein Length:129aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------13
MAKPELGTKRTCPDTGKRFYDLNKQVIVSPYTQNSWPLAYFEAPTSPEKEKEICSLEEETEVKPFVKHTSEEEEESPISKEEDDTSLDMEYVQEMDLDDDDDFLEQNDTDTDTDVVDMDISIPDDADEN
cccHHHccccccHHHccEEEccccccEEccccccEEEcHHHHccccccccHHHHHHHHHHHccHHHHHcccHHHHHHccHHHHccccccccHHHccccccccHHHccccccccHHHHHHHccccccccc
cccHHcccEEccccccccEEccccccEEccccccEEccHHccccccccccHHHHHHHHHHHcccccccccHHHHHccccccccccccccccccccccccccccEEcccccccccEEEcccccccccccc
makpelgtkrtcpdtgkrfydlnkqvivspytqnswplayfeaptspekekeicsleeetevkpfvkhtseeeeespiskeeddtsldMEYVQemdldddddfleqndtdtdtdvvdmdisipddaden
makpelgtkrtcpdtgkrfydLNKQVIVSPYTQNSWPLAYFEAPTSPEKEKEICSleeetevkpfvkhtseeeeespiskeeddtslDMEYVQEMDLDDDDDFLEqndtdtdtdvvdMDISIPDDADEN
MAKPELGTKRTCPDTGKRFYDLNKQVIVSPYTQNSWPLAYFEAPTSPekekeicsleeeteVKPFVKHTseeeeespiskeeDDTSLDMEYVqemdldddddfleqndtdtdtdvvdmdISIPDDADEN
****ELGTKRTCPDTGKRFYDLNKQVIVSPYTQNSW*******************************HTSEEEEESPISKEEDDTSLDMEYVQEMDLDDDDDFLEQNDTDTDTDVVD************
*********RTCPDTGKRFYDLNKQVIVSPYTQNSWPLAYFEA**********CSLEEETEVK**********************SLDMEYVQEMDLDDDDDFLEQNDTDTDTDVVDMDISIPDDADEN
*****LGTKRTCPDTGKRFYDLNKQVIVSPYTQNSWPLAYFEA****************************************************DL*DDDDFLEQNDTDTDTDVVDMDISIPD*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAKPELGTKRTCPDTGKRFYDLNKQVIVSPYTQNSWPLAYFEAPTSPEKEKEICSLEEETEVKPFVKHTSEEEEESPISKEEDDTSLDMEYVQEMDLDDDDDFLEQNDTDTDTDVVDMDISIPDDADEN
MAKPELGTKRTCPDTGKRFYDLNKQVIVSPYTQNSWPLAYFEAPTSPEKEKEICSLEEETEVKPFVKHTSEEEEESPISKEEDDTSLDMEYVQEMDLDDDDDFLEQNDTDTDTDVVDMDISIPDDADEN
MAKPELGTKRTCPDTGKRFYDLNKQVIVSPYTQNSWPLAYFEAPTSPEKEKEICSLEEETEVKPFVKHTSEEEEESPISKEEDDTSLDMEYVQEMDLDDDDDFLEQNDTDTDTDVVDMDISIPDDADEN

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target129 hypothetical protein CLIBASIA_01720 [Candidatus Liberib
315122093118 hypothetical protein CKC_01715 [Candidatus Liberibacter 1 1e-34
222147162128 hypothetical protein Avi_0191 [Agrobacterium vitis S4] 1 4e-13
163757682137 hypothetical protein HPDFL43_19767 [Hoeflea phototrophi 1 9e-13
110635936124 hypothetical protein Meso_3610 [Mesorhizobium sp. BNC1] 1 1e-12
15890872129 hypothetical protein Atu8037 [Agrobacterium tumefaciens 1 7e-12
332716824129 hypothetical protein AGROH133_12930 [Agrobacterium sp. 1 2e-11
222084308128 hypothetical protein Arad_0145 [Agrobacterium radiobact 1 3e-11
83945695151 hypothetical protein OA2633_10904 [Oceanicaulis alexand 1 3e-11
227824084129 hypothetical protein NGR_c35820 [Sinorhizobium fredii N 1 4e-11
114704388133 hypothetical protein FP2506_05626 [Fulvimarina pelagi H 1 4e-11
>gi|315122093|ref|YP_004062582.1| hypothetical protein CKC_01715 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 118 Back     alignment and organism information
 Score =  149 bits (376), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 83/119 (69%), Positives = 95/119 (79%), Gaps = 4/119 (3%)

Query: 1   MAKPELGTKRTCPDTGKRFYDLNKQVIVSPYTQNSWPLAYFEAPTSPEKEKEICSLEEET 60
           MAKPELGTKRTCPDTGKRFYDLNK+ IVSPYTQNSWPL+YFE   +PE+  EI  LEEE 
Sbjct: 1   MAKPELGTKRTCPDTGKRFYDLNKKTIVSPYTQNSWPLSYFETAPTPEEADEISVLEEEK 60

Query: 61  EVKPFVKHTSEEEEESPISKEEDDTSLDMEYVQEM---DLDDDDDFLEQNDTDTDTDVV 116
           EVK F KH + E EE+ I+ +EDD+SLDM+YVQE+   D D  DDFLEQ D DTD+DVV
Sbjct: 61  EVKVFTKHPAIEGEEN-ITSKEDDSSLDMKYVQEIDLDDDDVHDDFLEQADDDTDSDVV 118


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222147162|ref|YP_002548119.1| hypothetical protein Avi_0191 [Agrobacterium vitis S4] Length = 128 Back     alignment and organism information
>gi|163757682|ref|ZP_02164771.1| hypothetical protein HPDFL43_19767 [Hoeflea phototrophica DFL-43] Length = 137 Back     alignment and organism information
>gi|110635936|ref|YP_676144.1| hypothetical protein Meso_3610 [Mesorhizobium sp. BNC1] Length = 124 Back     alignment and organism information
>gi|15890872|ref|NP_356544.1| hypothetical protein Atu8037 [Agrobacterium tumefaciens str. C58] Length = 129 Back     alignment and organism information
>gi|332716824|ref|YP_004444290.1| hypothetical protein AGROH133_12930 [Agrobacterium sp. H13-3] Length = 129 Back     alignment and organism information
>gi|222084308|ref|YP_002542837.1| hypothetical protein Arad_0145 [Agrobacterium radiobacter K84] Length = 128 Back     alignment and organism information
>gi|83945695|ref|ZP_00958040.1| hypothetical protein OA2633_10904 [Oceanicaulis alexandrii HTCC2633] Length = 151 Back     alignment and organism information
>gi|227824084|ref|YP_002828057.1| hypothetical protein NGR_c35820 [Sinorhizobium fredii NGR234] Length = 129 Back     alignment and organism information
>gi|114704388|ref|ZP_01437296.1| hypothetical protein FP2506_05626 [Fulvimarina pelagi HTCC2506] Length = 133 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target129 hypothetical protein CLIBASIA_01720 [Candidatus Liberib
pfam09538104 pfam09538, FYDLN_acid, Protein of unknown function (FYD 3e-11
TIGR02300129 TIGR02300, FYDLN_acid, conserved hypothetical protein T 4e-08
COG4530129 COG4530, COG4530, Uncharacterized protein conserved in 4e-08
>gnl|CDD|150271 pfam09538, FYDLN_acid, Protein of unknown function (FYDLN_acid) Back     alignment and domain information
>gnl|CDD|131353 TIGR02300, FYDLN_acid, conserved hypothetical protein TIGR02300 Back     alignment and domain information
>gnl|CDD|34179 COG4530, COG4530, Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 129 hypothetical protein CLIBASIA_01720 [Candidatus Liberib
pfam09538104 FYDLN_acid Protein of unknown function (FYDLN_acid). Me 99.95
TIGR02300157 FYDLN_acid conserved hypothetical protein TIGR02300; In 99.94
smart00531147 TFIIE Transcription initiation factor IIE. 95.47
PRK10220111 hypothetical protein; Provisional 95.36
pfam0827140 TF_Zn_Ribbon TFIIB zinc-binding. The transcription fact 95.26
PRK05654 288 acetyl-CoA carboxylase subunit beta; Validated 95.01
pfam09986214 DUF2225 Uncharacterized protein conserved in bacteria ( 94.92
PRK00420107 hypothetical protein; Validated 94.46
COG0846250 SIR2 NAD-dependent protein deacetylases, SIR2 family [T 94.24
PRK02625 627 DNA-directed RNA polymerase subunit gamma; Provisional 94.05
COG1326201 Uncharacterized archaeal Zn-finger protein [General fun 93.98
pfam0728269 Transposase_35 Putative transposase DNA-binding domain. 93.02
COG1645131 Uncharacterized Zn-finger containing protein [General f 93.01
CHL00018 668 rpoC1 RNA polymerase beta' subunit 92.92
PRK00564117 hypA hydrogenase nickel incorporation protein; Provisio 92.89
COG199649 RPC10 DNA-directed RNA polymerase, subunit RPC10 (conta 92.79
PRK06450 336 threonine synthase; Validated 92.77
COG0675364 Transposase and inactivated derivatives [DNA replicatio 92.51
CHL00174 305 accD acetyl-CoA carboxylase beta subunit; Reviewed 92.39
PRK07591 422 threonine synthase; Validated 92.38
PRK08579623 anaerobic ribonucleoside triphosphate reductase; Provis 92.37
PRK03824135 hypA hydrogenase nickel incorporation protein; Provisio 92.3
pfam0827430 PhnA_Zn_Ribbon PhnA Zinc-Ribbon. 92.3
COG1066 456 Sms Predicted ATP-dependent serine protease [Posttransl 92.18
TIGR01405 1264 polC_Gram_pos DNA polymerase III, alpha subunit, Gram-p 92.15
TIGR00515 292 accD acetyl-CoA carboxylase, carboxyl transferase, beta 91.93
COG2816279 NPY1 NTP pyrophosphohydrolases containing a Zn-finger, 91.72
TIGR00354 1173 polC DNA polymerase II, large subunit DP2; InterPro: IP 91.63
pfam1027640 zf-CHCC Zinc-finger domain. This is a short zinc-finger 91.61
COG439162 Uncharacterized protein conserved in bacteria [Function 91.57
KOG2807378 consensus 91.51
COG1579239 Zn-ribbon protein, possibly nucleic acid-binding [Gener 91.33
pfam0972342 CxxC_CxxC_SSSS Zinc ribbon domain. This entry represent 91.2
smart0065944 RPOLCX RNA polymerase subunit CX. present in RNA polyme 91.19
PRK12496166 hypothetical protein; Provisional 91.18
PRK03681114 hypA hydrogenase nickel incorporation protein; Validate 91.1
COG288861 Predicted Zn-ribbon RNA-binding protein with a function 91.0
pfam03833 852 PolC_DP2 DNA polymerase II large subunit DP2. 90.98
COG2816279 NPY1 NTP pyrophosphohydrolases containing a Zn-finger, 90.67
COG4640 465 Predicted membrane protein [Function unknown] 90.34
PRK06260 400 threonine synthase; Validated 90.34
TIGR0209840 MJ0042_CXXC MJ0042 family finger-like domain; InterPro: 90.13
PRK05978149 hypothetical protein; Provisional 90.09
PRK02995 1291 DNA-directed RNA polymerase subunit beta'; Provisional 90.08
COG288861 Predicted Zn-ribbon RNA-binding protein with a function 90.02
COG4530129 Uncharacterized protein conserved in bacteria [Function 99.93
pfam09538104 FYDLN_acid Protein of unknown function (FYDLN_acid). Me 90.81
PRK09001869 DNA topoisomerase I; Validated 90.08
>pfam09538 FYDLN_acid Protein of unknown function (FYDLN_acid) Back     alignment and domain information
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300; InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues Back     alignment and domain information
>smart00531 TFIIE Transcription initiation factor IIE Back     alignment and domain information
>PRK10220 hypothetical protein; Provisional Back     alignment and domain information
>pfam08271 TF_Zn_Ribbon TFIIB zinc-binding Back     alignment and domain information
>PRK05654 acetyl-CoA carboxylase subunit beta; Validated Back     alignment and domain information
>pfam09986 DUF2225 Uncharacterized protein conserved in bacteria (DUF2225) Back     alignment and domain information
>PRK00420 hypothetical protein; Validated Back     alignment and domain information
>COG0846 SIR2 NAD-dependent protein deacetylases, SIR2 family [Transcription] Back     alignment and domain information
>PRK02625 DNA-directed RNA polymerase subunit gamma; Provisional Back     alignment and domain information
>COG1326 Uncharacterized archaeal Zn-finger protein [General function prediction only] Back     alignment and domain information
>pfam07282 Transposase_35 Putative transposase DNA-binding domain Back     alignment and domain information
>COG1645 Uncharacterized Zn-finger containing protein [General function prediction only] Back     alignment and domain information
>CHL00018 rpoC1 RNA polymerase beta' subunit Back     alignment and domain information
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional Back     alignment and domain information
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription] Back     alignment and domain information
>PRK06450 threonine synthase; Validated Back     alignment and domain information
>COG0675 Transposase and inactivated derivatives [DNA replication, recombination, and repair] Back     alignment and domain information
>CHL00174 accD acetyl-CoA carboxylase beta subunit; Reviewed Back     alignment and domain information
>PRK07591 threonine synthase; Validated Back     alignment and domain information
>PRK08579 anaerobic ribonucleoside triphosphate reductase; Provisional Back     alignment and domain information
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional Back     alignment and domain information
>pfam08274 PhnA_Zn_Ribbon PhnA Zinc-Ribbon Back     alignment and domain information
>COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01405 polC_Gram_pos DNA polymerase III, alpha subunit, Gram-positive type; InterPro: IPR006308 These are the polypeptide chains of DNA polymerase III Back     alignment and domain information
>TIGR00515 accD acetyl-CoA carboxylase, carboxyl transferase, beta subunit; InterPro: IPR000438 Fatty acid synthesis involves a set of reactions, commencing with carboxylation of acetyl-CoA to malonyl-CoA Back     alignment and domain information
>COG2816 NPY1 NTP pyrophosphohydrolases containing a Zn-finger, probably nucleic-acid-binding [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00354 polC DNA polymerase II, large subunit DP2; InterPro: IPR004475 This family represents the large subunit, DP2, of a two subunit novel archaebacterial replicative DNA polymerase first characterised for Pyrococcus furiosus Back     alignment and domain information
>pfam10276 zf-CHCC Zinc-finger domain Back     alignment and domain information
>COG4391 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2807 consensus Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>pfam09723 CxxC_CxxC_SSSS Zinc ribbon domain Back     alignment and domain information
>smart00659 RPOLCX RNA polymerase subunit CX Back     alignment and domain information
>PRK12496 hypothetical protein; Provisional Back     alignment and domain information
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated Back     alignment and domain information
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>pfam03833 PolC_DP2 DNA polymerase II large subunit DP2 Back     alignment and domain information
>COG2816 NPY1 NTP pyrophosphohydrolases containing a Zn-finger, probably nucleic-acid-binding [DNA replication, recombination, and repair] Back     alignment and domain information
>COG4640 Predicted membrane protein [Function unknown] Back     alignment and domain information
>PRK06260 threonine synthase; Validated Back     alignment and domain information
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain; InterPro: IPR011723 Zinc finger (Znf) domains are relatively small protein motifs that bind one or more zinc atoms, and which usually contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PRK05978 hypothetical protein; Provisional Back     alignment and domain information
>PRK02995 DNA-directed RNA polymerase subunit beta'; Provisional Back     alignment and domain information
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG4530 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>pfam09538 FYDLN_acid Protein of unknown function (FYDLN_acid) Back     alignment and domain information
>PRK09001 DNA topoisomerase I; Validated Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target129 hypothetical protein CLIBASIA_01720 [Candidatus Liberib
2akl_A138 PHNA-like protein PA0128; two domains, Zn binding prote 95.46
2jz8_A87 Uncharacterized protein BH09830; zinc binding, structur 95.4
1pft_A50 TFIIB, PFTFIIBN; N-terminal domain, transcription initi 95.0
2f9y_B 304 Acetyl-coenzyme A carboxylase carboxyl transferase subu 94.06
2a6h_D 1524 DNA-directed RNA polymerase beta' chain; RNA polymerase 93.92
1dvp_A220 HRS, hepatocyte growth factor-regulated tyrosine kinase 93.76
1lko_A191 Rubrerythrin all-iron(II) form; reduced form, DIIRON, f 93.74
2jvm_A80 Uncharacterized protein; alpha+beta, structural genomic 93.47
3k7a_M 345 Transcription initiation factor IIB; RNA polymerase II, 93.31
1dl6_A58 Transcription factor II B (TFIIB); zinc ribbon, gene re 93.25
2apo_B60 Ribosome biogenesis protein NOP10; protein-protein comp 93.18
2kdx_A119 HYPA, hydrogenase/urease nickel incorporation protein H 93.14
3k1f_M197 Transcription initiation factor IIB; RNA polymerase II, 92.87
2f9i_B 285 Acetyl-coenzyme A carboxylase carboxyl transferase subu 92.58
2jrr_A67 Uncharacterized protein; solution structure, SIR90, str 92.37
2gmg_A105 Hypothetical protein PF0610; winged-helix like protein 91.97
1vd4_A62 Transcription initiation factor IIE, alpha subunit; zin 91.44
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP-reco 91.38
2ct7_A86 Ring finger protein 31; IBR, structural genomics, NPPSF 91.35
3a43_A139 HYPD, hydrogenase nickel incorporation protein HYPA; [N 91.22
3cng_A189 Nudix hydrolase; structural genomics, APC7497, PSI-2, p 91.07
1vk6_A269 NADH pyrophosphatase; 1790429, structural genomics, JCS 90.98
3flo_B206 DNA polymerase alpha catalytic subunit A; protein-prote 90.92
2aus_D60 NOP10, ribosome biogenesis protein NOP10; isomerase, st 90.89
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precursor; str 90.85
3na7_A256 HP0958; flagellar biogenesis, flagellum export, C4 Zn-r 90.36
2jr6_A68 UPF0434 protein NMA0874; solution, structural genomics, 90.01
>2akl_A PHNA-like protein PA0128; two domains, Zn binding protein, beta-strand protein, structural genomics, PSI; NMR {Pseudomonas aeruginosa PAO1} SCOP: b.34.11.2 g.41.3.5 Back     alignment and structure
Probab=95.46  E-value=0.0074  Score=37.08  Aligned_cols=32  Identities=16%  Similarity=0.407  Sum_probs=26.3

Q ss_pred             CCCCCCCCCEEEECCCCCCCCCCCCCEECHHH
Q ss_conf             31178888744214888722778987153233
Q gi|254780459|r    9 KRTCPDTGKRFYDLNKQVIVSPYTQNSWPLAY   40 (129)
Q Consensus         9 KR~C~~Cg~KFYDlnk~PiiCP~CG~e~~~~~   40 (129)
                      =--||.|+.-|-=-...-.+||.||.||.+..
T Consensus        27 lP~CP~C~seytY~dg~~~vCPeC~hEW~~~~   58 (138)
T 2akl_A           27 LPPCPQCNSEYTYEDGALLVCPECAHEWSPNE   58 (138)
T ss_dssp             SCCCTTTCCCCCEECSSSEEETTTTEEECTTT
T ss_pred             CCCCCCCCCCCEECCCCEEECCCCCCCCCCCC
T ss_conf             98898889902373799888987637378453



>2jz8_A Uncharacterized protein BH09830; zinc binding, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Bartonella henselae str} Back     alignment and structure
>1pft_A TFIIB, PFTFIIBN; N-terminal domain, transcription initiation factor; NMR {Pyrococcus furiosus} SCOP: g.41.3.1 Back     alignment and structure
>2f9y_B Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta; zinc ribbon, crotonase superfamily, spiral domain, ligase; 3.20A {Escherichia coli} SCOP: c.14.1.4 Back     alignment and structure
>2a6h_D DNA-directed RNA polymerase beta' chain; RNA polymerase holoenzyme, streptolydigin, antibiotic, transcription regulation; HET: STD; 2.40A {Thermus thermophilus} SCOP: e.29.1.2 PDB: 1smy_D* 1zyr_D* 1iw7_D* 2a69_D* 2a6e_D 2a68_D* 2be5_D* 2cw0_D 2o5i_D 2o5j_D* 2ppb_D* 3dxj_D* 3eql_D* 1ynj_D* 1l9z_D 1l9u_D* 1ynn_D* 2auj_D Back     alignment and structure
>1dvp_A HRS, hepatocyte growth factor-regulated tyrosine kinase substrate; VHS, FYVE, zinc finger, superhelix, transferase; HET: CIT; 2.00A {Drosophila melanogaster} SCOP: a.118.9.2 g.50.1.1 Back     alignment and structure
>1lko_A Rubrerythrin all-iron(II) form; reduced form, DIIRON, four-helix bundle, rubredoxin-like, electron transport; 1.63A {Desulfovibrio vulgaris} SCOP: a.25.1.1 g.41.5.1 PDB: 1dvb_A 1jyb_A 1b71_A 1lkm_A 1lkp_A 1qyb_A 1s2z_A 1s30_A 1ryt_A Back     alignment and structure
>2jvm_A Uncharacterized protein; alpha+beta, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Rhodobacter sphaeroides 2} Back     alignment and structure
>3k7a_M Transcription initiation factor IIB; RNA polymerase II, TFIIB, DNA-binding, DNA- directed RNA polymerase, isopeptide bond, magnesium; 3.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1dl6_A Transcription factor II B (TFIIB); zinc ribbon, gene regulation; NMR {Homo sapiens} SCOP: g.41.3.1 PDB: 1rly_A 1ro4_A Back     alignment and structure
>2apo_B Ribosome biogenesis protein NOP10; protein-protein complex, box H/ACA, snoRNP, pseudouridine synthase, RNA modification; 1.95A {Methanocaldococcus jannaschii} SCOP: g.41.16.1 PDB: 2aqc_A Back     alignment and structure
>2kdx_A HYPA, hydrogenase/urease nickel incorporation protein HYPA; metallochaperone, metal-binding, metal- binding protein; NMR {Helicobacter pylori} Back     alignment and structure
>3k1f_M Transcription initiation factor IIB; RNA polymerase II, TFIIB, transcription factor, DNA-binding, DNA-directed RNA polymerase; 4.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2f9i_B Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta; zinc ribbon, crotonase superfamily, spiral domain; 1.98A {Staphylococcus aureus} Back     alignment and structure
>2jrr_A Uncharacterized protein; solution structure, SIR90, structural genomics, PSI-2, protein structure initiative; NMR {Silicibacter pomeroyi} Back     alignment and structure
>2gmg_A Hypothetical protein PF0610; winged-helix like protein with metal binding site, structural genomics, PSI; NMR {Pyrococcus furiosus dsm 3638} SCOP: a.4.5.82 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase- inhibitor complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2ct7_A Ring finger protein 31; IBR, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.4 Back     alignment and structure
>3a43_A HYPD, hydrogenase nickel incorporation protein HYPA; [NIFE] hydrogenase maturation, zinc-finger, nickel binding, metal-binding; HET: FME; 2.30A {Pyrococcus kodakaraensis} PDB: 3a44_A* Back     alignment and structure
>3cng_A Nudix hydrolase; structural genomics, APC7497, PSI-2, protein structure initiative, midwest center for structural genomics; 2.00A {Nitrosomonas europaea atcc 19718} Back     alignment and structure
>1vk6_A NADH pyrophosphatase; 1790429, structural genomics, JCSG, PSI, protein structure initiative, joint center for structural genomics; HET: MSE; 2.20A {Escherichia coli K12} SCOP: d.113.1.4 d.113.1.4 g.41.14.1 PDB: 2gb5_A Back     alignment and structure
>3flo_B DNA polymerase alpha catalytic subunit A; protein-protein complex, phosphoesterase fold, OB fold, zinc-binding motif, DNA replication; HET: DNA; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>2aus_D NOP10, ribosome biogenesis protein NOP10; isomerase, structural protein, isomerase/structural protein complex; 2.10A {Pyrococcus abyssi} PDB: 3lwr_B 3lwo_B* 3lwq_B* 3lwp_B 3lwv_B 3hax_C* 2hvy_C* 3hay_C* 2ey4_E 3hjw_B* 2rfk_B* 3hjy_B Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precursor; structural genomics medical relevance, protein structure initiative, PSI-2; 3.00A {Homo sapiens} Back     alignment and structure
>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Back     alignment and structure
>2jr6_A UPF0434 protein NMA0874; solution, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium; NMR {Neisseria meningitidis Z2491} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target129 hypothetical protein CLIBASIA_01720 [Candidatus Liberib
d2akla238 Hypothetical protein PA0128, N-terminal domain {Pseudom 94.78
d1smyd_ 1504 RNA-polymerase beta-prime {Thermus thermophilus [TaxId: 94.0
d2f9yb1 263 Acetyl-coenzyme A carboxylase carboxyl transferase subu 93.94
d1nnqa237 Rubrerythrin, C-terminal domain {Archaeon Pyrococcus fu 93.63
d1pfta_50 Transcription initiation factor TFIIB, N-terminal domai 91.67
d1yuza236 Nigerythrin, C-terminal domain {Desulfovibrio vulgaris 91.63
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human (Hom 91.53
d2gmga1105 Hypothetical protein PF0610 {Pyrococcus furiosus [TaxId 91.16
d1akya238 Microbial and mitochondrial ADK, insert "zinc finger" d 90.95
>d2akla2 g.41.3.5 (A:3-40) Hypothetical protein PA0128, N-terminal domain {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
class: Small proteins
fold: Rubredoxin-like
superfamily: Zinc beta-ribbon
family: PhnA zinc-binding domain
domain: Hypothetical protein PA0128, N-terminal domain
species: Pseudomonas aeruginosa [TaxId: 287]
Probab=94.78  E-value=0.0056  Score=36.33  Aligned_cols=31  Identities=16%  Similarity=0.443  Sum_probs=26.8

Q ss_pred             CCCCCCCCEEEECCCCCCCCCCCCCEECHHH
Q ss_conf             1178888744214888722778987153233
Q gi|254780459|r   10 RTCPDTGKRFYDLNKQVIVSPYTQNSWPLAY   40 (129)
Q Consensus        10 R~C~~Cg~KFYDlnk~PiiCP~CG~e~~~~~   40 (129)
                      --||.|+.-|-=-...-.|||.||.||.+..
T Consensus         4 P~CP~C~seytYedg~l~vCPeC~hEW~~~~   34 (38)
T d2akla2           4 PPCPQCNSEYTYEDGALLVCPECAHEWSPNE   34 (38)
T ss_dssp             CCCTTTCCCCCEECSSSEEETTTTEEECTTT
T ss_pred             CCCCCCCCCCEECCCCEEECCCCCCCCCCCC
T ss_conf             8688789803573799978975557478543



>d1smyd_ e.29.1.2 (D:) RNA-polymerase beta-prime {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2f9yb1 c.14.1.4 (B:23-285) Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta, AccD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nnqa2 g.41.5.1 (A:135-171) Rubrerythrin, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1pfta_ g.41.3.1 (A:) Transcription initiation factor TFIIB, N-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1yuza2 g.41.5.1 (A:167-202) Nigerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gmga1 a.4.5.82 (A:1-105) Hypothetical protein PF0610 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1akya2 g.41.2.1 (A:131-168) Microbial and mitochondrial ADK, insert "zinc finger" domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target129 hypothetical protein CLIBASIA_01720 [Candidatus Liberib
2akl_A_1-6262 PHNA-like protein PA0128; two domains, Zn binding 94.85
1pft_A_50 TFIIB, PFTFIIBN; N-terminal domain, transcription 94.29
3k1f_M_1-5757 Transcription initiation factor IIB; RNA polymeras 93.97
1dl6_A_58 Transcription factor II B (TFIIB); zinc ribbon; NM 93.76
3dl0_A_118-16245 Adenylate kinase; phosphotransferase, zinc coordin 92.66
2gmg_A_105 Hypothetical protein PF0610; winged-helix like pro 92.07
3fb4_A_116-16247 Adenylate kinase; psychrophIle, phosphotransferase 91.86
1nnq_A_67-171105 Rubrerythrin; structural genomics, PSI, protein st 91.73
2waq_P_48 DNA-directed RNA polymerase RPO12 subunit; multi-s 91.67
2f9i_B_1-6161 Acetyl-coenzyme A carboxylase carboxyl transferase 91.58
1aky_A_123-18462 Adenylate kinase; ATP:AMP phosphotransferase, myok 91.41
2jz8_A_87 Uncharacterized protein BH09830; zinc binding, str 91.29
1ak2_A_132-17948 Adenylate kinase isoenzyme-2; nucleoside monophosp 91.06
1j8f_A_1-21_154-20472 SIRT2, sirtuin 2, isoform 1, silencing; gene regul 90.64
2rgx_A_113-17058 Adenylate kinase; transferase(phosphotransferase), 90.54
1vd4_A_62 Transcription initiation factor IIE, alpha subunit 90.44
2ct7_A_86 Ring finger protein 31; IBR, structural genomics, 90.15
>2akl_A (A:1-62) PHNA-like protein PA0128; two domains, Zn binding protein, beta-strand protein, structural genomics, PSI; NMR {Pseudomonas aeruginosa PAO1} Back     alignment and structure
Probab=94.85  E-value=0.013  Score=36.42  Aligned_cols=31  Identities=16%  Similarity=0.428  Sum_probs=27.4

Q ss_pred             CCCCCCCEEEECCCCCCCCCCCCCEECHHHH
Q ss_conf             1788887442148887227789871532331
Q gi|254780459|r   11 TCPDTGKRFYDLNKQVIVSPYTQNSWPLAYF   41 (129)
Q Consensus        11 ~C~~Cg~KFYDlnk~PiiCP~CG~e~~~~~~   41 (129)
                      .||.|+.-|-=--..-.|||.||.||.+...
T Consensus        29 ~CPkC~SeYTYeDg~l~VCPECghEW~~~~~   59 (62)
T 2akl_A           29 PCPQCNSEYTYEDGALLVCPECAHEWSPNEA   59 (62)
T ss_dssp             CCTTTCCCCCEECSSSEEETTTTEEECTTTT
T ss_pred             CCCCCCCCCEECCCCEEECCCCCCCCCCCCC
T ss_conf             8988899132837998899876374785535



>1pft_A (A:) TFIIB, PFTFIIBN; N-terminal domain, transcription initiation factor; NMR {Pyrococcus furiosus} Back     alignment and structure
>3k1f_M (M:1-57) Transcription initiation factor IIB; RNA polymerase II, TFIIB, transcription factor, DNA-binding, DNA-directed RNA polymerase; 4.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1dl6_A (A:) Transcription factor II B (TFIIB); zinc ribbon; NMR {Homo sapiens} Back     alignment and structure
>3dl0_A (A:118-162) Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, cytoplasm, metal-binding, nucleotide biosynthesis, nucleotide-binding; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>2gmg_A (A:) Hypothetical protein PF0610; winged-helix like protein with metal binding site, structural genomics, PSI; NMR {Pyrococcus furiosus dsm 3638} Back     alignment and structure
>3fb4_A (A:116-162) Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>1nnq_A (A:67-171) Rubrerythrin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.35A {Pyrococcus furiosus} Back     alignment and structure
>2waq_P (P:) DNA-directed RNA polymerase RPO12 subunit; multi-subunit, transcription; 3.35A {Sulfolobus shibatae} PDB: 2pmz_P 2wb1_P 3hkz_P Back     alignment and structure
>2f9i_B (B:1-61) Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta; zinc ribbon, crotonase superfamily, spiral domain; 1.98A {Staphylococcus aureus} Back     alignment and structure
>1aky_A (A:123-184) Adenylate kinase; ATP:AMP phosphotransferase, myokinase; HET: AP5; 1.63A {Saccharomyces cerevisiae} Back     alignment and structure
>2jz8_A (A:) Uncharacterized protein BH09830; zinc binding, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Bartonella henselae str} Back     alignment and structure
>1ak2_A (A:132-179) Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} Back     alignment and structure
>1j8f_A (A:1-21,A:154-204) SIRT2, sirtuin 2, isoform 1, silencing; gene regulation, transferase; 1.70A {Homo sapiens} Back     alignment and structure
>2rgx_A (A:113-170) Adenylate kinase; transferase(phosphotransferase), ATP-binding, cytoplasm, nucleotide-binding; HET: AP5; 1.90A {Aquifex aeolicus} PDB: 2rh5_A Back     alignment and structure
>1vd4_A (A:) Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} Back     alignment and structure
>2ct7_A (A:) Ring finger protein 31; IBR, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure