254780466

254780466

putative modification methylase

GeneID in NCBI database:8209454Locus tag:CLIBASIA_01755
Protein GI in NCBI database:254780466Protein Accession:YP_003064879.1
Gene range:+(386844, 387971)Protein Length:375aa
Gene description:putative modification methylase
COG prediction:[L] DNA modification methylase
KEGG prediction:putative modification methylase; K13581 modification methylase [EC:2.1.1.72]
SEED prediction:DNA modification methyltransferase (EC 2.1.1.-)
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-----
MSQKNSLAINENQNSIFEWKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADGTLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKELYNC
cccccccccccccccccccccEEEEccHHHHHHHcccccEEEEEEccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccEEEEEcccccHHHHHHHHHHcccEEEEEEEEEccccccccccccccccEEEEEEEEEccccccccccccccccccccccccccEEEccccccccccccccccccccccHHHHHHHHHHHHcccccEEEEccccccHHHHHHHHcccEEEEEEccHHHHHHHHHHHHHHccccHHHHHccccccccccccHHHHHHHHccccHHHHHHcccccEEEEccccEEEcccccHHHHHHHHHHccccccccccEEEEEccccEEEHHHHHHHHHHHHccc
ccccccccccHHcccHHHHHcccccccHHHHHHHcccccEEEEEEccccccccccccccccccEEccccccccccccHHHHHHHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHcccEEEEEEEEEccccccccccccccccccEEEEEEccccccccEEcHHHHHccccccccccccccccccccEEccccccccccccccHHHHHHHHHHHccccccEEEcccccccHHHHHHHHccccEEEEEccHHHHHHHHHHHHHHccccHHHHHHcccccccccccHHHHHHccccccccEEEcccccEEEEEEEccEEEcccccccEHHHcHHHcccccccccEEEEEEccccEEcHHHHHHHHHHHHHcc
msqknslainenqNSIFEWKDKiikgnsisvleklpaksvdlifadppynlqlngqlyrpdhslvdavtdswdkfssfeaYDAFTRAWLLACRRvlkpngtlwviGSYHNIFRIGTMLQNLNFWILNDIVwrksnpmpnfrgrrfqNAHEtliwaspspkakgytfnYDALKAANEdvqmrsdwlipicsgserlrnkdgeklhptqkpEALLSRILvsstkpgdiildpffgsgtsgAVAKKLRRSFIGIEMKQDYIDIATKRIasvqplgnieltvltgkrtepRVAFNLLVErgliqpgqiltnaqgnisatvcadgtlisgtelgsihrvgakvsgsetcngwnFWYFEKLGELHSINTLRILVRKELYNC
MSQKNSLAINENQNSIFEWKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRFQNAHETliwaspspkaKGYTFNYDALKAANEDVQMRSDWLIPICSGSerlrnkdgeklhptqkpeaLLSRILVSSTKPGDIILDpffgsgtsgaVAKKLRRSFIGIEMKQDYIDIATKriasvqplgnieltvltgkrtePRVAFNLLVERGLIQPGQILTNAQGNISATVCADGTLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGElhsintlrilvrkelync
MSQKNSLAINENQNSIFEWKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADGTLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKELYNC
*****************EWKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKA****VQMRSDWLIPICSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQPL******************FNLLVERGLIQPGQILTNAQGNISATVCADGTLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRK**Y**
*********NENQNSIFEWKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADGTLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKELYNC
******LAINENQNSIFEWKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADGTLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKELYNC
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSQKNSLAINENQNSIFEWKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADGTLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKELYNC
MSQKNSLAINENQNSIFEWKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADGTLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKELYNC
MSQKNSLAINENQNSIFEWKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADGTLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKELYNC

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target375 putative modification methylase [Candidatus Liberibacte
315122079380 putative modification methylase [Candidatus Liberibacte 1 0.0
325292178380 adenine DNA methyltransferase [Agrobacterium sp. H13-3] 1 1e-161
116250848380 modification methylase [Rhizobium leguminosarum bv. vic 1 1e-159
241203450379 DNA methylase N-4/N-6 domain protein [Rhizobium legumin 1 1e-159
159184467381 cell cycle regulated site-specific DNA-methyltransferas 1 1e-159
14091014381 cell cycle-regulated methyltransferase CcrM [Agrobacter 1 1e-159
86356641380 site-specific DNA-methyltransferase (adenine-specific) 1 1e-158
218510491380 site-specific DNA-methyltransferase (adenine-specific) 1 1e-158
190890705380 site-specific DNA-methyltransferase (adenine-specific) 1 1e-158
209548255380 DNA methylase N-4/N-6 [Rhizobium leguminosarum bv. trif 1 1e-158
>gi|315122079|ref|YP_004062568.1| putative modification methylase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 380 Back     alignment and organism information
 Score =  683 bits (1763), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/373 (86%), Positives = 351/373 (94%)

Query: 1   MSQKNSLAINENQNSIFEWKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRP 60
           M++K+ L I++N+NSI  WKDKIIKGNSISVLEKLPAKSVDL+FADPPYNLQLNG+L+RP
Sbjct: 1   MNKKSRLVIDQNKNSILSWKDKIIKGNSISVLEKLPAKSVDLVFADPPYNLQLNGKLHRP 60

Query: 61  DHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQN 120
           D+SLV+AVTDSWDKFSSFEAYDAFTRAWLLAC+RVLKP+GTLWVIGSYHNIFRIG MLQN
Sbjct: 61  DNSLVNAVTDSWDKFSSFEAYDAFTRAWLLACQRVLKPSGTLWVIGSYHNIFRIGAMLQN 120

Query: 121 LNFWILNDIVWRKSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQM 180
           LNFWILNDIVWRKSNPMPNFRGRRFQNAHETLIWASPSPK+KGYTFNYDALKAANEDVQM
Sbjct: 121 LNFWILNDIVWRKSNPMPNFRGRRFQNAHETLIWASPSPKSKGYTFNYDALKAANEDVQM 180

Query: 181 RSDWLIPICSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAV 240
           RSDWL PICSG+ERLRNKDGEKLH TQKPE+LLSRIL SSTKPGD +LDPFFGSGT+GAV
Sbjct: 181 RSDWLFPICSGAERLRNKDGEKLHATQKPESLLSRILTSSTKPGDFVLDPFFGSGTTGAV 240

Query: 241 AKKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQ 300
           AKKL RSF+GIEM+QDYIDIATKRI SV+PLGNIELTVLTGK+ EPRVAFNLLVERG+IQ
Sbjct: 241 AKKLGRSFLGIEMEQDYIDIATKRIESVKPLGNIELTVLTGKKAEPRVAFNLLVERGIIQ 300

Query: 301 PGQILTNAQGNISATVCADGTLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHS 360
            GQ+LTNAQ NISA V  DGTL+SG E GSIHRVGAKVSG ETCNGWNFWYFEK G+LHS
Sbjct: 301 AGQVLTNAQRNISAIVRVDGTLVSGVESGSIHRVGAKVSGLETCNGWNFWYFEKYGKLHS 360

Query: 361 INTLRILVRKELY 373
           I+TLR LVRKELY
Sbjct: 361 IDTLRSLVRKELY 373


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|325292178|ref|YP_004278042.1| adenine DNA methyltransferase [Agrobacterium sp. H13-3] Length = 380 Back     alignment and organism information
>gi|116250848|ref|YP_766686.1| modification methylase [Rhizobium leguminosarum bv. viciae 3841] Length = 380 Back     alignment and organism information
>gi|241203450|ref|YP_002974546.1| DNA methylase N-4/N-6 domain protein [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 379 Back     alignment and organism information
>gi|159184467|ref|NP_353817.2| cell cycle regulated site-specific DNA-methyltransferase protein [Agrobacterium tumefaciens str. C58] Length = 381 Back     alignment and organism information
>gi|14091014|gb|AAK53552.1|AF327563_1 cell cycle-regulated methyltransferase CcrM [Agrobacterium tumefaciens] Length = 381 Back     alignment and organism information
>gi|86356641|ref|YP_468533.1| site-specific DNA-methyltransferase (adenine-specific) protein [Rhizobium etli CFN 42] Length = 380 Back     alignment and organism information
>gi|218510491|ref|ZP_03508369.1| site-specific DNA-methyltransferase (adenine-specific) protein [Rhizobium etli Brasil 5] Length = 380 Back     alignment and organism information
>gi|190890705|ref|YP_001977247.1| site-specific DNA-methyltransferase (adenine-specific) protein [Rhizobium etli CIAT 652] Length = 380 Back     alignment and organism information
>gi|209548255|ref|YP_002280172.1| DNA methylase N-4/N-6 [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 380 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target375 putative modification methylase [Candidatus Liberibacte
COG0863302 COG0863, COG0863, DNA modification methylase [DNA repli 9e-57
PRK13699227 PRK13699, PRK13699, putative methylase; Provisional 1e-19
PRK11524284 PRK11524, PRK11524, putative methyltransferase; Provisi 3e-40
pfam01555221 pfam01555, N6_N4_Mtase, DNA methylase 2e-62
COG2189590 COG2189, COG2189, Adenine specific DNA methylase Mod [D 6e-08
COG2521287 COG2521, COG2521, Predicted archaeal methyltransferase 6e-04
COG4123248 COG4123, COG4123, Predicted O-methyltransferase [Genera 0.003
>gnl|CDD|31203 COG0863, COG0863, DNA modification methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|184255 PRK13699, PRK13699, putative methylase; Provisional Back     alignment and domain information
>gnl|CDD|183177 PRK11524, PRK11524, putative methyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|144957 pfam01555, N6_N4_Mtase, DNA methylase Back     alignment and domain information
>gnl|CDD|32372 COG2189, COG2189, Adenine specific DNA methylase Mod [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|32591 COG2521, COG2521, Predicted archaeal methyltransferase [General function prediction only] Back     alignment and domain information
>gnl|CDD|33880 COG4123, COG4123, Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 375 putative modification methylase [Candidatus Liberibacte
PRK11524284 putative methyltransferase; Provisional 100.0
PRK13699227 putative methylase; Provisional 100.0
COG0863302 DNA modification methylase [DNA replication, recombinat 100.0
pfam01555221 N6_N4_Mtase DNA methylase. Members of this family are D 100.0
COG2189590 Adenine specific DNA methylase Mod [DNA replication, re 99.7
PRK01544503 bifunctional N5-glutamine S-adenosyl-L-methionine-depen 97.73
pfam01170171 UPF0020 Putative RNA methylase family UPF0020. This dom 98.79
COG1041347 Predicted DNA modification methylase [DNA replication, 98.73
COG2521287 Predicted archaeal methyltransferase [General function 98.29
COG0116381 Predicted N6-adenine-specific DNA methylase [DNA replic 98.24
PRK11783 716 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional 98.03
PRK11783716 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional 97.82
pfam02475199 Met_10 Met-10+ like-protein. The methionine-10 mutant a 97.8
KOG2671421 consensus 97.75
TIGR03533284 L3_gln_methyl protein-(glutamine-N5) methyltransferase, 97.6
PRK09328277 N5-glutamine S-adenosyl-L-methionine-dependent methyltr 97.59
pfam05958353 tRNA_U5-meth_tr tRNA (Uracil-5-)-methyltransferase. Thi 97.58
PRK05031363 tRNA (uracil-5-)-methyltransferase; Validated 97.52
PRK09329285 N5-glutamine S-adenosyl-L-methionine-dependent methyltr 97.52
COG1092393 Predicted SAM-dependent methyltransferases [General fun 97.52
COG2520341 Predicted methyltransferase [General function predictio 97.51
pfam03602181 Cons_hypoth95 Conserved hypothetical protein 95. 97.42
PRK13168440 rumA 23S rRNA 5-methyluridine methyltransferase; Review 97.4
COG0742187 N6-adenine-specific methylase [DNA replication, recombi 97.3
PRK03522375 rumB 23S rRNA methyluridine methyltransferase; Reviewed 97.26
pfam06325294 PrmA Ribosomal protein L11 methyltransferase (PrmA). Th 97.19
PRK00517298 prmA ribosomal protein L11 methyltransferase; Reviewed 97.17
pfam02384 312 N6_Mtase N-6 DNA Methylase. Restriction-modification (R 96.95
COG2264300 PrmA Ribosomal protein L11 methylase [Translation, ribo 96.77
PRK11805307 N5-glutamine S-adenosyl-L-methionine-dependent methyltr 96.76
COG2890280 HemK Methylase of polypeptide chain release factors [Tr 96.69
TIGR00095210 TIGR00095 putative methyltransferase; InterPro: IPR0043 96.68
TIGR01177358 TIGR01177 conserved hypothetical protein TIGR01177; Int 96.54
KOG2187534 consensus 96.45
PRK07580230 Mg-protoporphyrin IX methyl transferase; Validated 96.32
PRK00216239 ubiE ubiquinone/menaquinone biosynthesis methyltransfer 96.12
cd02440107 AdoMet_MTases S-adenosylmethionine-dependent methyltran 96.02
TIGR00479434 rumA 23S rRNA (uracil-5-)-methyltransferase RumA; Inter 95.98
pfam02086254 MethyltransfD12 D12 class N6 adenine-specific DNA methy 95.98
PRK11873258 arsM arsenite S-adenosylmethyltransferase; Reviewed 95.94
pfam01209233 Ubie_methyltran ubiE/COQ5 methyltransferase family. 95.65
PRK09489342 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provi 95.5
pfam05175170 MTS Methyltransferase small domain. This domain is foun 95.46
COG2226238 UbiE Methylase involved in ubiquinone/menaquinone biosy 95.23
COG2263198 Predicted RNA methylase [Translation, ribosomal structu 95.18
KOG1541270 consensus 94.9
pfam09445165 Methyltransf_15 RNA cap guanine-N2 methyltransferase. R 94.64
PRK07402196 precorrin-6B methylase; Provisional 94.5
PRK00377198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provi 94.45
COG2242187 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] 94.39
pfam02390199 Methyltransf_4 Putative methyltransferase. This is a fa 93.83
pfam08123205 DOT1 Histone methylation protein DOT1. The DOT1 domain 93.74
PRK08317241 hypothetical protein; Provisional 93.73
PRK00312213 pcm protein-L-isoaspartate O-methyltransferase; Reviewe 93.57
PRK13942214 protein-L-isoaspartate O-methyltransferase; Provisional 93.04
COG2813300 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosom 92.87
KOG2904328 consensus 92.67
PRK08287186 cobalt-precorrin-6Y C(15)-methyltransferase; Validated 92.65
pfam02353273 CMAS Cyclopropane-fatty-acyl-phospholipid synthase. Thi 92.51
PRK13944205 protein-L-isoaspartate O-methyltransferase; Provisional 92.5
KOG0820 315 consensus 92.38
PRK10901428 16S rRNA methyltransferase B; Provisional 92.14
KOG2078495 consensus 91.79
COG4123248 Predicted O-methyltransferase [General function predict 91.72
TIGR01934242 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis meth 90.69
smart00650169 rADc Ribosomal RNA adenine dimethylases. 90.02
pfam05063176 MT-A70 MT-A70. MT-A70 is the S-adenosylmethionine-bindi 98.37
COG1041347 Predicted DNA modification methylase [DNA replication, 97.97
pfam05175170 MTS Methyltransferase small domain. This domain is foun 97.59
pfam09445165 Methyltransf_15 RNA cap guanine-N2 methyltransferase. R 97.43
pfam01596204 Methyltransf_3 O-methyltransferase. Members of this fam 95.81
PRK10904271 DNA adenine methylase; Provisional 95.04
pfam07021193 MetW Methionine biosynthesis protein MetW. This family 94.1
pfam01861243 DUF43 Protein of unknown function DUF43. This family in 93.66
COG1743875 Adenine-specific DNA methylase containing a Zn-ribbon [ 93.65
PRK01581363 speE spermidine synthase; Validated 93.45
PRK00050309 mraW S-adenosyl-methyltransferase MraW; Provisional 93.22
COG0338274 Dam Site-specific DNA methylase [DNA replication, recom 92.54
pfam02086254 MethyltransfD12 D12 class N6 adenine-specific DNA methy 92.42
KOG2904328 consensus 92.29
pfam00398258 RrnaAD Ribosomal RNA adenine dimethylase. 91.7
COG2265432 TrmA SAM-dependent methyltransferases related to tRNA ( 97.93
PRK01544 503 bifunctional N5-glutamine S-adenosyl-L-methionine-depen 97.72
PRK10909198 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional 97.64
TIGR00406330 prmA ribosomal protein L11 methyltransferase; InterPro: 96.46
COG2230283 Cfa Cyclopropane fatty acid synthase and related methyl 95.37
TIGR03534251 RF_mod_HemK protein-(glutamine-N5) methyltransferase, r 97.86
PTZ00098263 phosphoethanolamine N-methyltransferase; Provisional 96.0
COG4122219 Predicted O-methyltransferase [General function predict 94.49
COG0286 489 HsdM Type I restriction-modification system methyltrans 92.78
COG4123248 Predicted O-methyltransferase [General function predict 97.78
KOG2098591 consensus 97.24
PRK03612516 spermidine synthase; Provisional 96.21
pfam01564240 Spermine_synth Spermine/spermidine synthase. Spermine a 95.96
pfam01170171 UPF0020 Putative RNA methylase family UPF0020. This dom 97.69
pfam02384312 N6_Mtase N-6 DNA Methylase. Restriction-modification (R 97.48
PRK10909198 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional 97.05
COG0742187 N6-adenine-specific methylase [DNA replication, recombi 96.95
pfam03602181 Cons_hypoth95 Conserved hypothetical protein 95. 96.52
TIGR01934242 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis meth 96.39
TIGR03534251 RF_mod_HemK protein-(glutamine-N5) methyltransferase, r 96.03
TIGR00571327 dam DNA adenine methylase; InterPro: IPR012326 In proka 95.87
pfam05430124 DUF752 Protein of unknown function (DUF752). This famil 95.87
PRK11873258 arsM arsenite S-adenosylmethyltransferase; Reviewed 95.64
PRK00121229 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed 95.6
TIGR00095210 TIGR00095 putative methyltransferase; InterPro: IPR0043 95.56
COG2521287 Predicted archaeal methyltransferase [General function 95.46
COG2890280 HemK Methylase of polypeptide chain release factors [Tr 95.27
COG0220227 Predicted S-adenosylmethionine-dependent methyltransfer 95.11
PRK08317241 hypothetical protein; Provisional 95.11
pfam02390199 Methyltransf_4 Putative methyltransferase. This is a fa 95.09
COG0275314 Predicted S-adenosylmethionine-dependent methyltransfer 94.39
PRK09328277 N5-glutamine S-adenosyl-L-methionine-dependent methyltr 94.39
cd02440107 AdoMet_MTases S-adenosylmethionine-dependent methyltran 94.38
COG2226238 UbiE Methylase involved in ubiquinone/menaquinone biosy 94.31
TIGR03533284 L3_gln_methyl protein-(glutamine-N5) methyltransferase, 93.72
pfam10237161 N6-adenineMlase Probable N6-adenine methyltransferase. 93.47
PRK00811283 spermidine synthase; Provisional 92.04
TIGR00537183 hemK_rel_arch methylase, putative; InterPro: IPR004557 91.4
PRK01747 660 mnmC 5-methylaminomethyl-2-thiouridine methyltransferas 90.85
PRK04457262 spermidine synthase; Provisional 90.78
COG1867380 TRM1 N2,N2-dimethylguanosine tRNA methyltransferase [Tr 90.31
KOG2671421 consensus 96.57
pfam02475199 Met_10 Met-10+ like-protein. The methionine-10 mutant a 92.3
PTZ00098263 phosphoethanolamine N-methyltransferase; Provisional 95.9
COG1743875 Adenine-specific DNA methylase containing a Zn-ribbon [ 95.54
pfam05148214 Methyltransf_8 Hypothetical methyltransferase. This fam 95.36
PRK00216239 ubiE ubiquinone/menaquinone biosynthesis methyltransfer 94.89
pfam01209233 Ubie_methyltran ubiE/COQ5 methyltransferase family. 93.89
smart00828224 PKS_MT Methyltransferase in polyketide synthase (PKS) e 92.55
pfam01795310 Methyltransf_5 MraW methylase family. Members of this f 91.61
>PRK11524 putative methyltransferase; Provisional Back     alignment and domain information
>PRK13699 putative methylase; Provisional Back     alignment and domain information
>COG0863 DNA modification methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>pfam01555 N6_N4_Mtase DNA methylase Back     alignment and domain information
>COG2189 Adenine specific DNA methylase Mod [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>pfam01170 UPF0020 Putative RNA methylase family UPF0020 Back     alignment and domain information
>COG1041 Predicted DNA modification methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG2521 Predicted archaeal methyltransferase [General function prediction only] Back     alignment and domain information
>COG0116 Predicted N6-adenine-specific DNA methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>pfam02475 Met_10 Met-10+ like-protein Back     alignment and domain information
>KOG2671 consensus Back     alignment and domain information
>TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific Back     alignment and domain information
>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>pfam05958 tRNA_U5-meth_tr tRNA (Uracil-5-)-methyltransferase Back     alignment and domain information
>PRK05031 tRNA (uracil-5-)-methyltransferase; Validated Back     alignment and domain information
>PRK09329 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>COG1092 Predicted SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information
>COG2520 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>pfam03602 Cons_hypoth95 Conserved hypothetical protein 95 Back     alignment and domain information
>PRK13168 rumA 23S rRNA 5-methyluridine methyltransferase; Reviewed Back     alignment and domain information
>COG0742 N6-adenine-specific methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed Back     alignment and domain information
>pfam06325 PrmA Ribosomal protein L11 methyltransferase (PrmA) Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>pfam02384 N6_Mtase N-6 DNA Methylase Back     alignment and domain information
>COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00095 TIGR00095 putative methyltransferase; InterPro: IPR004398 This is a family of conserved hypothetical proteins, which includes a putative methylase Back     alignment and domain information
>TIGR01177 TIGR01177 conserved hypothetical protein TIGR01177; InterPro: IPR005885 This family of largely hypothetical proteins is found exclusively in the Archaea and contain a putative RNA methylase domain Back     alignment and domain information
>KOG2187 consensus Back     alignment and domain information
>PRK07580 Mg-protoporphyrin IX methyl transferase; Validated Back     alignment and domain information
>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>TIGR00479 rumA 23S rRNA (uracil-5-)-methyltransferase RumA; InterPro: IPR001566 This protein family was first proposed to be RNA methyltransferases by homology to the TrmA family Back     alignment and domain information
>pfam02086 MethyltransfD12 D12 class N6 adenine-specific DNA methyltransferase Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>pfam01209 Ubie_methyltran ubiE/COQ5 methyltransferase family Back     alignment and domain information
>PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional Back     alignment and domain information
>pfam05175 MTS Methyltransferase small domain Back     alignment and domain information
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1541 consensus Back     alignment and domain information
>pfam09445 Methyltransf_15 RNA cap guanine-N2 methyltransferase Back     alignment and domain information
>PRK07402 precorrin-6B methylase; Provisional Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] Back     alignment and domain information
>pfam02390 Methyltransf_4 Putative methyltransferase Back     alignment and domain information
>pfam08123 DOT1 Histone methylation protein DOT1 Back     alignment and domain information
>PRK08317 hypothetical protein; Provisional Back     alignment and domain information
>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2904 consensus Back     alignment and domain information
>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated Back     alignment and domain information
>pfam02353 CMAS Cyclopropane-fatty-acyl-phospholipid synthase Back     alignment and domain information
>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>KOG0820 consensus Back     alignment and domain information
>PRK10901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>KOG2078 consensus Back     alignment and domain information
>COG4123 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities Back     alignment and domain information
>smart00650 rADc Ribosomal RNA adenine dimethylases Back     alignment and domain information
>pfam05063 MT-A70 MT-A70 Back     alignment and domain information
>COG1041 Predicted DNA modification methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>pfam05175 MTS Methyltransferase small domain Back     alignment and domain information
>pfam09445 Methyltransf_15 RNA cap guanine-N2 methyltransferase Back     alignment and domain information
>pfam01596 Methyltransf_3 O-methyltransferase Back     alignment and domain information
>PRK10904 DNA adenine methylase; Provisional Back     alignment and domain information
>pfam07021 MetW Methionine biosynthesis protein MetW Back     alignment and domain information
>pfam01861 DUF43 Protein of unknown function DUF43 Back     alignment and domain information
>COG1743 Adenine-specific DNA methylase containing a Zn-ribbon [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK01581 speE spermidine synthase; Validated Back     alignment and domain information
>PRK00050 mraW S-adenosyl-methyltransferase MraW; Provisional Back     alignment and domain information
>COG0338 Dam Site-specific DNA methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>pfam02086 MethyltransfD12 D12 class N6 adenine-specific DNA methyltransferase Back     alignment and domain information
>KOG2904 consensus Back     alignment and domain information
>pfam00398 RrnaAD Ribosomal RNA adenine dimethylase Back     alignment and domain information
>COG2265 TrmA SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional Back     alignment and domain information
>TIGR00406 prmA ribosomal protein L11 methyltransferase; InterPro: IPR004498 Ribosomal protein L11 methyltransferase (2 Back     alignment and domain information
>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR03534 RF_mod_HemK protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional Back     alignment and domain information
>COG4122 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>COG0286 HsdM Type I restriction-modification system methyltransferase subunit [Defense mechanisms] Back     alignment and domain information
>COG4123 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>KOG2098 consensus Back     alignment and domain information
>PRK03612 spermidine synthase; Provisional Back     alignment and domain information
>pfam01564 Spermine_synth Spermine/spermidine synthase Back     alignment and domain information
>pfam01170 UPF0020 Putative RNA methylase family UPF0020 Back     alignment and domain information
>pfam02384 N6_Mtase N-6 DNA Methylase Back     alignment and domain information
>PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional Back     alignment and domain information
>COG0742 N6-adenine-specific methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>pfam03602 Cons_hypoth95 Conserved hypothetical protein 95 Back     alignment and domain information
>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities Back     alignment and domain information
>TIGR03534 RF_mod_HemK protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>TIGR00571 dam DNA adenine methylase; InterPro: IPR012326 In prokaryotes, the major role of DNA methylation is to protect host DNA against degradation by restriction enzymes Back     alignment and domain information
>pfam05430 DUF752 Protein of unknown function (DUF752) Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed Back     alignment and domain information
>TIGR00095 TIGR00095 putative methyltransferase; InterPro: IPR004398 This is a family of conserved hypothetical proteins, which includes a putative methylase Back     alignment and domain information
>COG2521 Predicted archaeal methyltransferase [General function prediction only] Back     alignment and domain information
>COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0220 Predicted S-adenosylmethionine-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>PRK08317 hypothetical protein; Provisional Back     alignment and domain information
>pfam02390 Methyltransf_4 Putative methyltransferase Back     alignment and domain information
>COG0275 Predicted S-adenosylmethionine-dependent methyltransferase involved in cell envelope biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific Back     alignment and domain information
>pfam10237 N6-adenineMlase Probable N6-adenine methyltransferase Back     alignment and domain information
>PRK00811 spermidine synthase; Provisional Back     alignment and domain information
>TIGR00537 hemK_rel_arch methylase, putative; InterPro: IPR004557 These proteins exhibit homology to the Saccharomyces cerevisiae (yeast) ORF YDR140w (FYV9) Back     alignment and domain information
>PRK01747 mnmC 5-methylaminomethyl-2-thiouridine methyltransferase; Reviewed Back     alignment and domain information
>PRK04457 spermidine synthase; Provisional Back     alignment and domain information
>COG1867 TRM1 N2,N2-dimethylguanosine tRNA methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2671 consensus Back     alignment and domain information
>pfam02475 Met_10 Met-10+ like-protein Back     alignment and domain information
>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional Back     alignment and domain information
>COG1743 Adenine-specific DNA methylase containing a Zn-ribbon [DNA replication, recombination, and repair] Back     alignment and domain information
>pfam05148 Methyltransf_8 Hypothetical methyltransferase Back     alignment and domain information
>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>pfam01209 Ubie_methyltran ubiE/COQ5 methyltransferase family Back     alignment and domain information
>smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes Back     alignment and domain information
>pfam01795 Methyltransf_5 MraW methylase family Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target375 putative modification methylase [Candidatus Liberibacte
1g60_A260 Crystal Structure Of Methyltransferase Mboiia (Mora 1e-32
1eg2_A319 Crystal Structure Of Rhodobacter Spheroides (N6 Ade 6e-29
1nw8_A319 Structure Of L72p Mutant Beta Class N6-Adenine Dna 8e-29
2zif_A297 Crystal Structure Of Ttha0409, Putative Dna Modific 2e-26
2zie_A297 Crystal Structure Of Ttha0409, Putatative Dna Modif 5e-26
1boo_A323 Pvuii Dna Methyltransferase (Cytosine-N4-Specific) 1e-18
>gi|20663549|pdb|1G60|A Chain A, Crystal Structure Of Methyltransferase Mboiia (Moraxella Bovis) Length = 260 Back     alignment and structure
 Score =  145 bits (366), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 69/264 (26%), Positives = 102/264 (38%), Gaps = 37/264 (14%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           +KI + N    L+++  KSV L   DPPYNL                    WD F S   
Sbjct: 5   NKIHQMNCFDFLDQVENKSVQLAVIDPPYNLSKA----------------DWDSFDSHNE 48

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNF 140
           + AFT  W+      L  +G+L++  +  N   I   L +      N I W K + M + 
Sbjct: 49  FLAFTYRWIDKVLDKLDKDGSLYIFNTPFNCAFICQYLVSKGMIFQNWITWDKRDGMGSA 108

Query: 141 RGRRFQNAHETLIWASPSPKAKGYT---------------------FNYDALKAANEDVQ 179
           + R        L ++        Y                       N            
Sbjct: 109 KRRFSTGQETILFFSKSKNHTFNYDEVRVPYESTDRIKHASEKGILKNGKRWFPNPNGRL 168

Query: 180 MRSDWLIPICSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGA 239
               W        E++  K  +  H T KP  L+ RI+ +S+ P D++LD F GSGT+  
Sbjct: 169 CGEVWHFSSQRHKEKVNGKTVKLTHITPKPRDLIERIIRASSNPNDLVLDCFMGSGTTAI 228

Query: 240 VAKKLRRSFIGIEMKQDYIDIATK 263
           VAKKL R+FIG +M  +Y++ A  
Sbjct: 229 VAKKLGRNFIGCDMNAEYVNQANF 252


gi|11514446|pdb|1EG2|A Chain A, Crystal Structure Of Rhodobacter Spheroides (N6 Adenosine) Methyltransferase (M.Rsri) Length = 319 Back     alignment and structure
>gi|34810987|pdb|1NW8|A Chain A, Structure Of L72p Mutant Beta Class N6-Adenine Dna Methyltransferase Rsri Length = 319 Back     alignment and structure
gi|194709111|pdb|2ZIF|A Chain A, Crystal Structure Of Ttha0409, Putative Dna Modification Methylase From Thermus Thermophilus Hb8- Complexed With S- Adenosyl-L-Methionine Length = 297 Back     alignment and structure
>gi|194709109|pdb|2ZIE|A Chain A, Crystal Structure Of Ttha0409, Putatative Dna Modification Methylase From Thermus Thermophilus Hb8- Selenomethionine Derivative Length = 297 Back     alignment and structure
>gi|6729995|pdb|1BOO|A Chain A, Pvuii Dna Methyltransferase (Cytosine-N4-Specific) Length = 323 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target375 putative modification methylase [Candidatus Liberibacte
1eg2_A319 Modification methylase RSRI; rossmann fold, exocyclic a 1e-51
1g60_A260 Adenine-specific methyltransferase MBOIIA; structural g 2e-48
2zig_A297 TTHA0409, putative modification methylase; methyltransf 7e-42
1boo_A323 Protein (N-4 cytosine-specific methyltransferase PVU II 2e-41
3m33_A226 Uncharacterized protein; structural genomics, PSI-2, pr 0.003
>1eg2_A Modification methylase RSRI; rossmann fold, exocyclic amino DNA methyltransferase RSRI, DNA binding, DNA modification, DNA methylation; HET: MTA; 1.75A {Rhodobacter sphaeroides} SCOP: c.66.1.11 PDB: 1nw5_A* 1nw6_A* 1nw7_A* 1nw8_A Length = 319 Back     alignment and structure
 Score =  198 bits (505), Expect = 1e-51
 Identities = 81/321 (25%), Positives = 128/321 (39%), Gaps = 50/321 (15%)

Query: 2   SQKNSLAINENQNSIFEW-KDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRP 60
           S +   + ++  +S     +      + +  L KLP  SV LI  DPPYN+ L       
Sbjct: 20  SGQKHSSESQLGSSEIGTTRHVYDVCDCLDTLAKLPDDSVQLIICDPPYNIMLAD----- 74

Query: 61  DHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGT---- 116
                      WD       Y  + + WL    RVL P G++ + G        G+    
Sbjct: 75  -----------WDDHMD---YIGWAKRWLAEAERVLSPTGSIAIFGGLQYQGEAGSGDLI 120

Query: 117 -----MLQNLNFWILNDIVWRKSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDAL 171
                M QN    + N I+W   N M   R   F N HE + W +   K K Y F+ DA+
Sbjct: 121 SIISHMRQNSKMLLANLIIWNYPNGMSAQR--FFANRHEEIAWFA---KTKKYFFDLDAV 175

Query: 172 KAANED----VQMRSDWLIP-----------ICSGSERLRNKDGEKLHPTQKPEALLSRI 216
           +   ++      M+   L P           +   S    N      HPTQKP A++ R+
Sbjct: 176 REPYDEETKAAYMKDKRLNPESVEKGRNPTNVWRMSRLNGNSLERVGHPTQKPAAVIERL 235

Query: 217 LVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIEL 276
           + + + PG  +LD F GSG +  VA +  R+ I  +    + +   K++  +Q  G I+ 
Sbjct: 236 VRALSHPGSTVLDFFAGSGVTARVAIQEGRNSICTDAAPVFKEYYQKQLTFLQDDGLID- 294

Query: 277 TVLTGKRTEPRVAFNLLVERG 297
              + +  E    F   ++RG
Sbjct: 295 KARSYEIVEGAANFGAALQRG 315


>1g60_A Adenine-specific methyltransferase MBOIIA; structural genomics, DNA methylation, S- adenosylmethionine, PSI, protein structure initiative; HET: SAM; 1.74A {Moraxella bovis} SCOP: c.66.1.11 Length = 260 Back     alignment and structure
>2zig_A TTHA0409, putative modification methylase; methyltransferase, S- adenosylmethionine, structural genomics, NPPSFA; 2.10A {Thermus thermophilus} PDB: 2zie_A* 2zif_A Length = 297 Back     alignment and structure
>1boo_A Protein (N-4 cytosine-specific methyltransferase PVU II); type II DNA-(cytosine N4) methyltransferase, amino methylation, selenomethionine; HET: SAH; 2.80A {Proteus vulgaris} SCOP: c.66.1.11 Length = 323 Back     alignment and structure
>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} Length = 226 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target375 putative modification methylase [Candidatus Liberibacte
1g60_A260 Adenine-specific methyltransferase MBOIIA; structural g 100.0
2zig_A297 TTHA0409, putative modification methylase; methyltransf 100.0
1boo_A323 Protein (N-4 cytosine-specific methyltransferase PVU II 100.0
1eg2_A319 Modification methylase RSRI; rossmann fold, exocyclic a 100.0
3ldu_A385 Putative methylase; structural genomics, PSI-2, protein 98.42
2nxc_A254 L11 mtase, ribosomal protein L11 methyltransferase; tra 98.36
3k0b_A393 Predicted N6-adenine-specific DNA methylase; methylase, 98.35
1wy7_A207 Hypothetical protein PH1948; seven-stranded beta sheet, 98.18
3mti_A185 RRNA methylase; SAM-dependent, PSI, MCSG, structural ge 98.13
3gdh_A241 Trimethylguanosine synthase homolog; M7G, CAP, dimethyl 98.11
1ws6_A171 Methyltransferase; structural genomics, riken structura 98.08
3eey_A197 Putative rRNA methylase; rRNA methylation, S-adenosyl-m 98.05
2frn_A278 Hypothetical protein PH0793; structural genomics, PSI, 98.02
2fhp_A187 Methylase, putative; alpha-beta-alpha sandwich, structu 97.95
3a27_A272 TYW2, uncharacterized protein MJ1557; wybutosine modifi 97.87
2yx1_A336 Hypothetical protein MJ0883; methyl transferase, tRNA m 97.85
3grz_A205 L11 mtase, ribosomal protein L11 methyltransferase; met 97.84
2esr_A177 Methyltransferase; structural genomics, hypothetical pr 97.84
1ne2_A200 Hypothetical protein TA1320; structural genomics, conse 97.8
2ar0_A 541 M.ecoki, type I restriction enzyme ecoki M protein; str 97.8
1dus_A194 MJ0882; hypothetical protein, methanococcus jannaschii, 97.75
3khk_A 544 Type I restriction-modification system methylation subu 97.75
3lkd_A 542 Type I restriction-modification system methyltransferas 97.74
2b3t_A276 Protein methyltransferase HEMK; translation termination 97.7
1nkv_A256 Hypothetical protein YJHP; structural genomics, PSI, pr 97.69
2f8l_A344 Hypothetical protein LMO1582; 16411011, structural geno 97.68
2okc_A 445 Type I restriction enzyme stysji M protein; NP_813429.1 97.66
2fpo_A202 Methylase YHHF; structural genomics, putative methyltra 97.65
3bt7_A369 TRNA (uracil-5-)-methyltransferase; methyluridine, meth 97.65
2yxd_A183 Probable cobalt-precorrin-6Y C(15)- methyltransferase [ 97.62
3evz_A230 Methyltransferase; NYSGXRC, NEW YORK SGX research cente 97.61
1l3i_A192 Precorrin-6Y methyltransferase/putative decarboxylase; 97.57
2qm3_A373 Predicted methyltransferase; putative methyltransferase 97.56
2as0_A396 Hypothetical protein PH1915; RNA methyltransferase, str 97.53
1nw3_A 416 Histone methyltransferase DOT1L; HDOT1, histone lysine 97.52
3bxo_A239 N,N-dimethyltransferase; desosamine, sugar, carbohydrat 97.45
1pjz_A203 Thiopurine S-methyltransferase; polymorphism, S-adenosy 97.42
2ift_A201 Putative methylase HI0767; NESG, Y767_haein, structural 97.41
1u2z_A433 Histone-lysine N-methyltransferase, H3 lysine-79 specif 97.4
1uwv_A433 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA modifi 97.35
2jjq_A425 Uncharacterized RNA methyltransferase pyrab10780; metal 97.32
1wxx_A382 TT1595, hypothetical protein TTHA1280; thermus thermoph 97.3
3e05_A204 Precorrin-6Y C5,15-methyltransferase (decarboxylating); 97.23
2pjd_A343 Ribosomal RNA small subunit methyltransferase C; gene d 97.17
2igt_A332 SAM dependent methyltransferase; alpha-beta sandwich, b 97.17
3c0k_A396 UPF0064 protein YCCW; PUA domain, adoMet dependent meth 97.16
1xxl_A239 YCGJ protein; structural genomics, protein structure in 97.16
1wzn_A252 SAM-dependent methyltransferase; structural genomics, r 97.14
3g5t_A 299 Trans-aconitate 3-methyltransferase; structural genomic 97.09
1ri5_A298 MRNA capping enzyme; methyltransferase, M7G, messenger 97.08
3dmg_A381 Probable ribosomal RNA small subunit methyltransferase; 97.07
3kr9_A225 SAM-dependent methyltransferase; class I rossmann-like 97.06
3lcc_A235 Putative methyl chloride transferase; halide methyltran 97.05
2avn_A260 Ubiquinone/menaquinone biosynthesis methyltransfe relat 97.03
3fpf_A298 Mtnas, putative uncharacterized protein; thermonicotian 96.98
1y8c_A246 S-adenosylmethionine-dependent methyltransferase; struc 96.91
2b78_A385 Hypothetical protein SMU.776; structure genomics, methy 96.91
1ve3_A227 Hypothetical protein PH0226; dimer, riken structural ge 96.87
3dr5_A221 Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, 96.85
3cgg_A195 SAM-dependent methyltransferase; NP_600671.1, methyltra 96.81
3m33_A226 Uncharacterized protein; structural genomics, PSI-2, pr 96.8
3jwg_A219 HEN1, methyltransferase type 12; 1.90A {Clostridium the 96.76
1g8a_A227 Fibrillarin-like PRE-rRNA processing protein; rRNA bind 96.72
2p8j_A209 S-adenosylmethionine-dependent methyltransferase; NP_34 96.68
3ccf_A279 Cyclopropane-fatty-acyl-phospholipid synthase; YP_32134 96.59
3dlc_A219 Putative S-adenosyl-L-methionine-dependent methyltransf 96.57
1yb2_A275 Hypothetical protein TA0852; structural genomics, methy 96.55
3d2l_A243 SAM-dependent methyltransferase; ZP_00538691.1, structu 96.52
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwi 96.52
3lpm_A259 Putative methyltransferase; structural genomics, protei 96.5
3lec_A230 NADB-rossmann superfamily protein; PSI, MCSG, structura 96.42
3hem_A302 Cyclopropane-fatty-acyl-phospholipid synthase 2; protei 96.39
1im8_A244 YECO; methyltransferase, adenosylhomocysteine, structur 96.37
3g2m_A299 PCZA361.24; SAM-dependent methyltransferase, glycopepti 96.28
3hnr_A220 Probable methyltransferase BT9727_4108; structural geno 96.27
2fk8_A318 Methoxy mycolic acid synthase 4; S-adenosylmethionine-d 96.26
3p2e_A225 16S rRNA methylase; methyltransferase, transferase, NPM 96.25
1i1n_A226 Protein-L-isoaspartate O-methyltransferase; S-adenosyl 96.23
3fzg_A200 16S rRNA methylase; methyltransferase, plasmid, transfe 96.22
1jg1_A235 PIMT;, protein-L-isoaspartate O-methyltransferase; ross 96.16
3kkz_A267 Uncharacterized protein Q5LES9; putative methyltransfer 96.14
2r6z_A258 UPF0341 protein in RSP 3' region; alpha-beta protein, s 96.14
2gb4_A252 Thiopurine S-methyltransferase; 18204406, thiopurine me 96.13
3lcv_B281 Sisomicin-gentamicin resistance methylase SGM; antibiot 96.13
1vl5_A260 Unknown conserved protein BH2331; 10174951, hypothetica 96.12
1xva_A292 Glycine N-methyltransferase; HET: SAM; 2.20A {Escherich 96.11
3dh0_A219 SAM dependent methyltransferase; cystal structure, PSI- 96.11
2o57_A297 Putative sarcosine dimethylglycine methyltransferase; s 96.09
2p7i_A250 Hypothetical protein; putative methyltransferase, struc 96.09
1nv8_A284 HEMK protein; class I adoMet-dependent methyltransferas 96.08
3ocj_A305 Putative exported protein; structural genomics, PSI-2, 96.08
3i9f_A170 Putative type 11 methyltransferase; structural genomics 96.0
3gnl_A244 Uncharacterized protein, DUF633, LMOF2365_1472; structu 95.97
1zx0_A236 Guanidinoacetate N-methyltransferase; structural genomi 95.94
2kw5_A202 SLR1183 protein; structural genomics, northeast structu 95.94
2fyt_A 340 Protein arginine N-methyltransferase 3; structural geno 95.91
2ozv_A260 Hypothetical protein ATU0636; structural genomics, pred 95.88
3bus_A273 REBM, methyltransferase; rebeccamycin synthesis; HET: S 95.81
3m70_A286 Tellurite resistance protein TEHB homolog; structural g 95.79
1yzh_A214 TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alph 95.78
3iv6_A261 Putative Zn-dependent alcohol dehydrogenase; alpha/beta 95.78
1fbn_A230 MJ fibrillarin homologue; MJ proteins, ribosomal RNA pr 95.76
3bgv_A 313 MRNA CAP guanine-N7 methyltransferase; alternative spli 95.74
2qfm_A364 Spermine synthase; spermidine aminopropyltransferase, S 95.71
1nt2_A210 Fibrillarin-like PRE-rRNA processing protein; adeMet, b 95.67
3h2b_A203 SAM-dependent methyltransferase; alpha-beta protein, st 95.62
2qy6_A257 UPF0209 protein YFCK; structural genomics, unknown func 95.59
1kpg_A287 CFA synthase;, cyclopropane-fatty-acyl-phospholipid syn 95.55
1vbf_A231 231AA long hypothetical protein-L-isoaspartate O- methy 95.51
2pbf_A227 Protein-L-isoaspartate O-methyltransferase beta- aspart 95.39
3l8d_A242 Methyltransferase; structural genomics, PSI, nysgrc, pr 95.38
3id6_C232 Fibrillarin-like rRNA/TRNA 2'-O- methyltransferase; C/D 95.38
3e23_A211 Uncharacterized protein RPA2492; alpha-beta protein, st 95.35
2pxx_A215 Uncharacterized protein MGC2408; structural genomics co 95.31
2yxe_A215 Protein-L-isoaspartate O-methyltransferase; rossman-typ 95.3
3e8s_A227 Putative SAM dependent methyltransferase; NP_744700.1, 95.19
2gs9_A211 Hypothetical protein TT1324; methyl transferase, struct 95.14
2hnk_A239 SAM-dependent O-methyltransferase; modified rossman fol 95.09
1qam_A244 ERMC' methyltransferase; rRNA methyltransferase ERMC', 95.07
3dli_A240 Methyltransferase; PSI-II, NYSGXRC, structural genomics 95.06
1p91_A269 Ribosomal RNA large subunit methyltransferase A; RLMA, 95.04
1sui_A247 Caffeoyl-COA O-methyltransferase; rossmann fold, protei 94.93
3f4k_A257 Putative methyltransferase; structural genomics, PSI-2, 94.93
2oyr_A258 UPF0341 protein YHIQ; alpha-beta protein, structural ge 94.9
2yqz_A263 Hypothetical protein TTHA0223; RNA methyltransferase, S 94.85
2ipx_A233 RRNA 2'-O-methyltransferase fibrillarin; FBL, structura 94.84
3ggd_A245 SAM-dependent methyltransferase; YP_325210.1, structura 94.64
3g5l_A253 Putative S-adenosylmethionine dependent methyltransfera 94.64
2a14_A263 Indolethylamine N-methyltransferase; SGC,INMT, structur 94.57
2vdw_A 302 Vaccinia virus capping enzyme D1 subunit; nucleotidyltr 94.56
3jwh_A217 HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena vari 94.54
3cc8_A230 Putative methyltransferase; NP_977653.1, structural gen 94.36
2fca_A213 TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus 94.18
3dxy_A218 TRNA (guanine-N(7)-)-methyltransferase; rossmann fold m 94.1
2b9e_A309 NOL1/NOP2/SUN domain family, member 5 isoform 2; methyt 94.09
2vdv_E246 TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-me 94.01
3mgg_A276 Methyltransferase; NYSGXRC, PSI-II, protein structure i 93.95
3g07_A292 7SK snRNA methylphosphate capping enzyme; structural ge 93.95
1r18_A227 Protein-L-isoaspartate(D-aspartate)-O- methyltransferas 93.95
2i62_A265 Nicotinamide N-methyltransferase; structural genomics, 93.94
1o9g_A250 RRNA methyltransferase; antibiotic resistance, Se-MAD; 93.72
3ofk_A216 Nodulation protein S; NODS, N-methyltransferase, SAH, S 93.47
3frh_A253 16S rRNA methylase; methyltransferase domain, helical N 93.46
3bkx_A275 SAM-dependent methyltransferase; YP_807781.1, cycloprop 93.08
2p35_A259 Trans-aconitate 2-methyltransferase; SAM dependent meth 92.93
2i6g_A199 Putative methyltransferase; 16420133, structural genomi 92.58
2pt6_A321 Spermidine synthase; transferase, structural genomics c 92.52
3hvi_A221 Catechol O-methyltransferase; neurotransmitter degradat 92.12
3dtn_A234 Putative methyltransferase MM_2633; structural genomics 92.09
2ex4_A241 Adrenal gland protein AD-003; methyltransferase, struct 91.58
3ou2_A218 SAM-dependent methyltransferase; O-methyltransferase, S 91.44
3ckk_A235 TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adeno 91.36
2h00_A254 Methyltransferase 10 domain containing protein; structu 90.75
2h1r_A 299 Dimethyladenosine transferase, putative; SGC toronto di 90.71
3ege_A261 Putative methyltransferase from antibiotic biosynthesis 90.71
3lpm_A259 Putative methyltransferase; structural genomics, protei 98.37
2ozv_A260 Hypothetical protein ATU0636; structural genomics, pred 97.99
1dus_A194 MJ0882; hypothetical protein, methanococcus jannaschii, 97.28
3evz_A230 Methyltransferase; NYSGXRC, NEW YORK SGX research cente 97.11
2e58_A308 MNMC2; tRNA wobble uridine, modification enzyme, geneti 97.06
3bwc_A304 Spermidine synthase; SAM, SGPP, structural genomics, PS 96.84
2b3t_A276 Protein methyltransferase HEMK; translation termination 96.17
1mjf_A281 Spermidine synthase; spermidine synthetase, structural 96.15
2fca_A213 TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus 96.14
1nv8_A284 HEMK protein; class I adoMet-dependent methyltransferas 95.45
1yb2_A275 Hypothetical protein TA0852; structural genomics, methy 95.15
3dxy_A218 TRNA (guanine-N(7)-)-methyltransferase; rossmann fold m 94.99
1yzh_A214 TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alph 94.92
2yui_A182 Anamorsin; cytokine-induced apoptosis inhibitor 1, ciap 94.68
2o07_A304 Spermidine synthase; structural genomics, structural ge 94.65
1iy9_A275 Spermidine synthase; rossmann fold, structural genomics 94.49
2oo3_A283 Protein involved in catabolism of external DNA; structu 94.03
1i9g_A280 Hypothetical protein RV2118C; mtase, adoMet, crystal, s 93.94
1uir_A314 Polyamine aminopropyltransferase; spermidien synthase, 93.73
2b25_A336 Hypothetical protein; structural genomics, methyl trans 93.73
2vdv_E246 TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-me 93.44
2i7c_A283 Spermidine synthase; transferase, structural genomics c 92.99
2yvl_A248 TRMI protein, hypothetical protein; tRNA, methyltransfe 92.84
2ih2_A421 Modification methylase TAQI; DNA, DNA methyltransferase 97.52
2fhp_A187 Methylase, putative; alpha-beta-alpha sandwich, structu 97.3
2fpo_A202 Methylase YHHF; structural genomics, putative methyltra 97.13
2esr_A177 Methyltransferase; structural genomics, hypothetical pr 97.07
2igt_A332 SAM dependent methyltransferase; alpha-beta sandwich, b 96.98
2qm3_A373 Predicted methyltransferase; putative methyltransferase 96.63
2ift_A201 Putative methylase HI0767; NESG, Y767_haein, structural 96.43
2dul_A378 N(2),N(2)-dimethylguanosine tRNA methyltransferase; tRN 96.22
1zx0_A236 Guanidinoacetate N-methyltransferase; structural genomi 95.92
1xj5_A334 Spermidine synthase 1; structural genomics, protein str 95.92
3gjy_A317 Spermidine synthase; APC62791, structural genomics, PSI 95.85
2b2c_A314 Spermidine synthase; beta-alpha, transferase; 2.50A {Ca 95.39
1g6q_1328 HnRNP arginine N-methyltransferase; SAM-binding domain, 94.79
2okc_A445 Type I restriction enzyme stysji M protein; NP_813429.1 94.42
2f8l_A344 Hypothetical protein LMO1582; 16411011, structural geno 94.38
3adn_A294 Spermidine synthase; aminopropyltransferase, polyamine 94.17
3lkd_A542 Type I restriction-modification system methyltransferas 93.97
1inl_A296 Spermidine synthase; beta-barrel, rossman fold, structu 93.32
2ar0_A541 M.ecoki, type I restriction enzyme ecoki M protein; str 93.07
3khk_A544 Type I restriction-modification system methylation subu 91.42
1wxx_A382 TT1595, hypothetical protein TTHA1280; thermus thermoph 97.19
2r6z_A258 UPF0341 protein in RSP 3' region; alpha-beta protein, s 95.84
3mb5_A255 SAM-dependent methyltransferase; RNA methyltransferase, 93.15
2ih2_A421 Modification methylase TAQI; DNA, DNA methyltransferase 91.72
2pjd_A343 Ribosomal RNA small subunit methyltransferase C; gene d 96.9
3dlc_A219 Putative S-adenosyl-L-methionine-dependent methyltransf 96.4
3dmg_A381 Probable ribosomal RNA small subunit methyltransferase; 96.36
2zfu_A215 Nucleomethylin, cerebral protein 1; nucleolar protein, 95.94
3ckk_A235 TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adeno 94.85
3ege_A261 Putative methyltransferase from antibiotic biosynthesis 94.15
3dh0_A219 SAM dependent methyltransferase; cystal structure, PSI- 93.86
2pwy_A258 TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, 93.12
2pxx_A215 Uncharacterized protein MGC2408; structural genomics co 92.28
3b3f_A341 Histone-arginine methyltransferase CARM1; protein argin 91.88
3gu3_A284 Methyltransferase; alpha-beta protein, structural genom 91.55
1o54_A277 SAM-dependent O-methyltransferase; TM0748, structural g 91.53
3mb5_A255 SAM-dependent methyltransferase; RNA methyltransferase, 96.73
2yvl_A248 TRMI protein, hypothetical protein; tRNA, methyltransfe 96.64
1dl5_A317 Protein-L-isoaspartate O-methyltransferase; isoaspartyl 96.46
1o54_A277 SAM-dependent O-methyltransferase; TM0748, structural g 96.4
2pwy_A258 TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, 96.39
2b25_A336 Hypothetical protein; structural genomics, methyl trans 96.25
1i9g_A280 Hypothetical protein RV2118C; mtase, adoMet, crystal, s 94.58
3b3j_A 480 Histone-arginine methyltransferase CARM1; protein argin 92.57
3dli_A240 Methyltransferase; PSI-II, NYSGXRC, structural genomics 96.27
1ws6_A171 Methyltransferase; structural genomics, riken structura 96.17
3ll7_A410 Putative methyltransferase; methytransferase, structura 95.82
1m6y_A301 S-adenosyl-methyltransferase MRAW; SAM-dependent methyl 94.49
1or8_A340 Protein arginine N-methyltransferase 1; protein arginin 94.27
2oyr_A258 UPF0341 protein YHIQ; alpha-beta protein, structural ge 93.63
2g1p_A278 DNA adenine methylase; DAM methylation, GATC recognitio 92.44
1wg8_A285 Predicted S-adenosylmethionine-dependent methyltransfer 91.76
2g1p_A278 DNA adenine methylase; DAM methylation, GATC recognitio 91.43
2qrv_A295 DNA (cytosine-5)-methyltransferase 3A; DNA methyltransf 91.24
1wy7_A207 Hypothetical protein PH1948; seven-stranded beta sheet, 90.63
2dpm_A284 M.dpnii 1, protein (adenine-specific methyltransferase 90.59
3cvo_A202 Methyltransferase-like protein of unknown function; YP_ 94.62
3ldu_A385 Putative methylase; structural genomics, PSI-2, protein 91.46
>1g60_A Adenine-specific methyltransferase MBOIIA; structural genomics, DNA methylation, S- adenosylmethionine, PSI, protein structure initiative; HET: SAM; 1.74A {Moraxella bovis} SCOP: c.66.1.11 Back     alignment and structure
Probab=100.00  E-value=0  Score=423.98  Aligned_cols=232  Identities=33%  Similarity=0.541  Sum_probs=201.8

Q ss_pred             HHCCCEECCCHHHHHHHCCCCCCCEEEECCCCCCCCCCCEECCCCCEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHCC
Q ss_conf             53270851725998972841471189847787615587133367851300134435778989999988999999998639
Q gi|254780466|r   18 EWKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRRVLK   97 (375)
Q Consensus        18 ~~~nkI~~GDcl~~l~~Lpd~sVDlI~tDPPYni~~~~~~~~~~~s~~~~~~d~wd~~~s~~~Y~~f~~~wl~e~~RvLK   97 (375)
                      -.+|+||+|||+++|+.|||+||||||||||||++.                +.||...++++|++|+..|+.+++|+||
T Consensus         2 ~~~n~i~~gD~l~~l~~l~d~sVDlIitdPPY~~~~----------------~~~d~~~~~~~y~~~~~~~~~e~~rvLk   65 (260)
T 1g60_A            2 LEINKIHQMNCFDFLDQVENKSVQLAVIDPPYNLSK----------------ADWDSFDSHNEFLAFTYRWIDKVLDKLD   65 (260)
T ss_dssp             CCSSSEEECCHHHHHHHSCTTCEEEEEECCCCSSCS----------------SGGGCCSSHHHHHHHHHHHHHHHHHHEE
T ss_pred             CCCCEEEECHHHHHHHHCCCCCCCEEEECCCCCCCC----------------CCCCCCCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             865767713199998538678658799899988877----------------7577788999999999999999988871


Q ss_pred             CCCEEEEECCHHHHHHHHHHHHHCCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEECCCCCCCC---
Q ss_conf             68729998346888999987640578601246873156777757751765402132210056666502341001123---
Q gi|254780466|r   98 PNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAA---  174 (375)
Q Consensus        98 ~~Gsi~v~~~~~~i~~i~~~l~~~gf~~~n~IIW~K~n~~pn~~g~r~~~~hE~iiw~~K~~~~k~y~fny~~~k~~---  174 (375)
                      ++|++|++++....+++..++++.||.+.+.|||.|.+..|+ .++++..+||.++|++|+..   ++|+++.++..   
T Consensus        66 ~~g~~~~~~~~~~~~~~~~~l~~~~~~~~~~iiW~k~~~~~~-~~~~~~~~~e~~~~~~k~~~---~~~~~~~~~~~~~~  141 (260)
T 1g60_A           66 KDGSLYIFNTPFNCAFICQYLVSKGMIFQNWITWDKRDGMGS-AKRRFSTGQETILFFSKSKN---HTFNYDEVRVPYES  141 (260)
T ss_dssp             EEEEEEEEECHHHHHHHHHHHHHTTCEEEEEEEECCCCSCCC-CSSSCBCCCEEEEEEESSTT---CCCCGGGSCBCCCH
T ss_pred             CCCCCCCCCCCHHHHHHHHHHHHCCCCEEEEEEEECCCCCCC-CCCCCCCCCCEEEEECCCCC---CCCCHHHHCCCCCC
T ss_conf             588632015704789999998751443026899941446544-46667764111331035764---42567773365346


Q ss_pred             ----------------------CCCEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCEEEECCC
Q ss_conf             ----------------------7980104654221025854145778753368778189999999852899888998688
Q gi|254780466|r  175 ----------------------NEDVQMRSDWLIPICSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFF  232 (375)
Q Consensus       175 ----------------------n~~~~~~s~w~~pi~~g~er~k~~~g~k~HPTqKP~~LleriI~~~S~~gDiVLDPF~  232 (375)
                                            .....+.++|.++...+.++......+..||||||++|++++|+++|++||+|||||+
T Consensus       142 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~vw~~~~~~~~~~~~~~~~~~~Hpt~kP~~L~~~~I~~~s~~gd~VlDpF~  221 (260)
T 1g60_A          142 TDRIKHASEKGILKNGKRWFPNPNGRLCGEVWHFSSQRHKEKVNGKTVKLTHITPKPRDLIERIIRASSNPNDLVLDCFM  221 (260)
T ss_dssp             HHHHHHHHHHTSCBTTBCCCCCTTCBCCBSEECCC------------------CCCCHHHHHHHHHHHCCTTCEEEESSC
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEECCCCCCCEECCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCEEEECCC
T ss_conf             64202100047543353015775665433202114656410015764444565556768888899964899998998999


Q ss_pred             CCHHHHHHHHHHCCEEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             8517999999809816999728999999999996305
Q gi|254780466|r  233 GSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       233 GSGTT~~aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
                      |||||++||+++||+|||||++++|+++|.+||++++
T Consensus       222 GSGtT~~aa~~~~R~~ig~E~~~~y~~~a~~Rl~~~~  258 (260)
T 1g60_A          222 GSGTTAIVAKKLGRNFIGCDMNAEYVNQANFVLNQLE  258 (260)
T ss_dssp             TTCHHHHHHHHTTCEEEEEESCHHHHHHHHHHHHC--
T ss_pred             CCHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHC
T ss_conf             8319999999809949999679999999999999851



>2zig_A TTHA0409, putative modification methylase; methyltransferase, S- adenosylmethionine, structural genomics, NPPSFA; 2.10A {Thermus thermophilus} PDB: 2zie_A* 2zif_A Back     alignment and structure
>1boo_A Protein (N-4 cytosine-specific methyltransferase PVU II); type II DNA-(cytosine N4) methyltransferase, amino methylation, selenomethionine; HET: SAH; 2.80A {Proteus vulgaris} SCOP: c.66.1.11 Back     alignment and structure
>1eg2_A Modification methylase RSRI; rossmann fold, exocyclic amino DNA methyltransferase RSRI, DNA binding, DNA modification, DNA methylation; HET: MTA; 1.75A {Rhodobacter sphaeroides} SCOP: c.66.1.11 PDB: 1nw5_A* 1nw6_A* 1nw7_A* 1nw8_A Back     alignment and structure
>3ldu_A Putative methylase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE GTP; 1.70A {Clostridium difficile} Back     alignment and structure
>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransferase posttranslational modification; 1.59A {Thermus thermophilus HB8} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* Back     alignment and structure
>3k0b_A Predicted N6-adenine-specific DNA methylase; methylase,PF01170, putative RNA methylase, PSI,MCSG, structural genomics; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structural genomics; HET: SAH; 2.20A {Pyrococcus horikoshii OT3} SCOP: c.66.1.32 Back     alignment and structure
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} Back     alignment and structure
>3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* Back     alignment and structure
>1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus HB8} SCOP: c.66.1.46 Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics, protein structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis V583} SCOP: c.66.1.46 Back     alignment and structure
>3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 2zzm_A* Back     alignment and structure
>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, NYSGXRC, structural genomics; 2.00A {Lactobacillus delbrueckii subsp} Back     alignment and structure
>2esr_A Methyltransferase; structural genomics, hypothetical protein, PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes MGAS10394} SCOP: c.66.1.46 Back     alignment and structure
>1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 Back     alignment and structure
>2ar0_A M.ecoki, type I restriction enzyme ecoki M protein; structural genomics, protein structure initiative, nysgxrc; 2.80A {Escherichia coli} SCOP: c.66.1.45 Back     alignment and structure
>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 Back     alignment and structure
>3khk_A Type I restriction-modification system methylation subunit; structural genomics, PSI-2, protein structure initiative; 2.55A {Methanosarcina mazei} Back     alignment and structure
>3lkd_A Type I restriction-modification system methyltransferase subunit; Q5M500_STRT2, STU0711, NESG, SUR80, structural genomics, PSI-2; 2.25A {Streptococcus thermophilus} Back     alignment and structure
>2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* Back     alignment and structure
>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Back     alignment and structure
>2f8l_A Hypothetical protein LMO1582; 16411011, structural genomics, PSI, protein structure initiative, joint center for structural genomics; HET: MSE SAM; 2.20A {Listeria monocytogenes} SCOP: c.66.1.45 Back     alignment and structure
>2okc_A Type I restriction enzyme stysji M protein; NP_813429.1, N-6 DNA methylase, structural genomics; HET: SAM; 2.20A {Bacteroides thetaiotaomicron vpi-5482} SCOP: c.66.1.45 Back     alignment and structure
>2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protein structure initiative, midwest center for structural genomics; HET: MSE; 2.05A {Escherichia coli K12} SCOP: c.66.1.46 Back     alignment and structure
>3bt7_A TRNA (uracil-5-)-methyltransferase; methyluridine, methyltransferase, TRMA, RUMT; HET: 5MU; 2.43A {Escherichia coli} Back     alignment and structure
>2yxd_A Probable cobalt-precorrin-6Y C(15)- methyltransferase [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii DSM2661} Back     alignment and structure
>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research center for structural genomics, protein structure initiative, PSI-2; 2.20A {Pyrococcus furiosus} Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Back     alignment and structure
>2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638} Back     alignment and structure
>2as0_A Hypothetical protein PH1915; RNA methyltransferase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: b.122.1.9 c.66.1.51 Back     alignment and structure
>1nw3_A Histone methyltransferase DOT1L; HDOT1, histone lysine methyltransferase,; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.31 Back     alignment and structure
>3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} Back     alig