254780465

254780465

threonine synthase

GeneID in NCBI database:8209453Locus tag:CLIBASIA_01750
Protein GI in NCBI database:254780465Protein Accession:YP_003064878.1
Gene range:-(385056, 386465)Protein Length:469aa
Gene description:threonine synthase
COG prediction:[E] Threonine synthase
KEGG prediction:thrC; threonine synthase (EC:4.2.3.1); K01733 threonine synthase [EC:4.2.3.1]
SEED prediction:Threonine synthase (EC 4.2.3.1)
Pathway involved in KEGG:Glycine, serine and threonine metabolism [PATH:las00260]
Vitamin B6 metabolism [PATH:las00750]
Subsystem involved in SEED:Threonine and Homoserine Biosynthesis
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSAT2 TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------47
MKYISTRNVDLSLGFCDTILSGLATDGGLYIPKYIPRLSEKEIKDLRGLSYQEIALFIFRLFIGQEIKSSKLRDIVNRSYHCFRNAAVTPLIQLNANEFLLELFHGPTLSFKDIAMQFIAELMDHILEERDHYITIVGATSGDTGAAAIKAFAGKKRINMYILFPEGRISVVQQKQMTTSEASNINVIAVQSSFDDCQKIVKNLFSDVFFCHSVNLSGINSINWARIMAQIVYYFVSSIALGSPNRNISFSVPTGNFGDIFAGYMAKMMGLPIEKLIIATNENDTLVRMFDMGMYRPEIVMETTSPAMDIQIPSNFERLLFEISGRNSLLVKEAFYSLENKKYFRIDSEHLQKMSLSFSAKRASMEDVNSVIKSVLEKSNYLVDPHTAVGIHAALACRKSSSTPMVTLATAHPSKFPDTVKAASGIVPDCPISLEQMMRRPENCKVMNKNIDEIKKFIKKRNMESKIEP
ccEEccccccccccHHHHHHccccccccEEcccccccccHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccccccccEEEEccccEEEEEcccccHHHHHHHHHHHHHHHHHHHHcccccEEEEEEcccccHHHHHHHHHcccccEEEEEEEcccccHHHHHHHHHHccccEEEEEEcccHHHHHHHHHHHHccHHHHccccccccccccHHHHHHHHHHHHHHHHHccccccccEEEEcccccHHHHHHHHHHHHccccHHEEEEcccccHHHHHHHccccccccccccHHHHHHHcccccHHHHHHHHccccHHHHHHHHHHHHHcccEEccHHHHHHHHHHcccccccHHHHHHHHHHHHHHccEEEcccHHHHHHHHHHHHHcccccEEEEEcccccccHHHHHHHccccccccHHHHHHHHccHHHHcccccHHHHHHHHHHHHHcccccc
ccEEEcccccccccHHHHHHHccccccccccccccccccHHHHHHHccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHccccccccHHHcccccEHHHHcccccHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEcccccHHHHHHHHHcccccEEEEEcccccccHHHHHHHccccccccEEEEEEccccHHHHHHHHHHccHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEccccHHHHHHHHHHHHccccHHEEEEEccccHHHHHHHHccccEccccEccccccccccccccHHHHHHHHccccHHHHHHHHHHHHHcccccccHHHHHHHHHHcccccccHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHccccccEEEEcccccccHHHHHHHHHcccccccHHHHHHHHcccHcEEccHHHHHHHHHHHHHHHHccccc
mkyistrnvdlslGFCDTILsglatdgglyipkyiprlseKEIKDLRGLSYQEIALFIFRLFIgqeikssklrdIVNRSYHCFRNAAVTPLIQLNANEFLLelfhgptlsfKDIAMQFIAELMDHILEERDHYITivgatsgdtGAAAIKAFAGkkrinmyilfpegrisvvqqkqmttseasNINVIAVQSSFDDCQKIVKNLFSDVFFChsvnlsginsiNWARIMAQIVYYFVSSIalgspnrnisfsvptgnfgDIFAGYMAKMMGLPIEKLIIATNENDTLVRMFdmgmyrpeivmettspamdiqipSNFERLLFEISGRNSLLVKEAFYSLENKKYFRIDSEHLQKMSLSFSAKRASMEDVNSVIKSVLEksnylvdphtAVGIHAALacrkssstpmvtlatahpskfpdtvkaasgivpdcpisleqmmrrpenckVMNKNIDEIKKFIKKRnmeskiep
mkyistrnvdlslGFCDTILSglatdgglyiPKYIPRLSEKEIKDLRGLSYQEIALFIFRLFIGQEIKSSKLRDIVNRSYHCFRNAAVTPLIQLNANEFLLELFHGPTLSFKDIAMQFIAELMDHILEERDHYITIVGATSGDTGAAAIKAFAGKKRINMYILFPEGRISVVQQKQMTTSEASNINVIAVQSSFDDCQKIVKNLFSDVFFCHSVNLSGINSINWARIMAQIVYYFVSSIALGSPNRNISFSVPTGNFGDIFAGYMAKMMGLPIEKLIIATNENDTLVRMFDMGMYRPEIVMETTSPAMDIQIPSNFERLLFEISGRNSLLVKEAFYSLENKKYFRIDSEHLQKMSLSFSAKRASMEDVNSVIKSVLEKSNYLVDPHTAVGIHAALACRKSSSTPMVTLATAHPSKFPDTVKAASGIVPDCPISLEqmmrrpenckvmnkNIDEIKkfikkrnmeskiep
MKYISTRNVDLSLGFCDTILSGLATDGGLYIPKYIPRLSEKEIKDLRGLSYQEIALFIFRLFIGQEIKSSKLRDIVNRSYHCFRNAAVTPLIQLNANEFLLELFHGPTLSFKDIAMQFIAELMDHILEERDHYITIVGATSgdtgaaaikafagkkRINMYILFPEGRISVVQQKQMTTSEASNINVIAVQSSFDDCQKIVKNLFSDVFFCHSVNLSGINSINWARIMAQIVYYFVSSIALGSPNRNISFSVPTGNFGDIFAGYMAKMMGLPIEKLIIATNENDTLVRMFDMGMYRPEIVMETTSPAMDIQIPSNFERLLFEISGRNSLLVKEAFYSLENKKYFRIDSEHLQKMSLSFSAKRASMEDVNSVIKSVLEKSNYLVDPHTAVGIHAALACRKSSSTPMVTLATAHPSKFPDTVKAASGIVPDCPISLEQMMRRPENCKVMNKNIDEIKKFIKKRNMESKIEP
MKYISTRNVDLSLGFCDTILSGLATDGGLYIPKYIPRLSEKEIKDLRGLSYQEIALFIFRLFIGQEIKSSKLRDIVNRSYHCFRNAAVTPLIQLNANEFLLELFHGPTLSFKDIAMQFIAELMDHILEERDHYITIVGATSGDTGAAAIKAFAGKKRINMYILFPEGRISVVQQKQMTTSEASNINVIAVQSSFDDCQKIVKNLFSDVFFCHSVNLSGINSINWARIMAQIVYYFVSSIALGSPNRNISFSVPTGNFGDIFAGYMAKMMGLPIEKLIIATNENDTLVRMFDMGMYRPEIVMETTSPAMDIQIPSNFERLLFEISGRNSLLVKEAFYSLENKKYFRIDSEHLQKMSLSFSAKRASMEDVNSVIKSVLEKSNYLVDPHTAVGIHAALACRKSSSTPMVTLATAHPSKFPDTVKAASGIVPDCPISLEQMMRRPENCKVMNKNIDEIKKFIKK*N*******
MKYISTRNVDLSLGFCDTILSGLATDGGLYIPKYIPRLSEKEIKDLRGLSYQEIALFIFRLFIGQEIKSSKLRDIVNRSYHCFRNAAVTPLIQLNANEFLLELFHGPTLSFKDIAMQFIAELMDHILEERDHYITIVGATSGDTGAAAIKAFAGKKRINMYILFPEGRISVVQQKQMTTSEASNINVIAVQSSFDDCQKIVKNLFSDVFFCHSVNLSGINSINWARIMAQIVYYFVSSIALGSPNRNISFSVPTGNFGDIFAGYMAKMMGLPIEKLIIATNENDTLVRMFDMGMYRPEIVMETTSPAMDIQIPSNFERLLFEISGRNSLLVKEAFYSLENKKYFRIDSEHLQKMSLSF*********VNSVIKSVLEKSNYLVDPHTAVGIHAALACRKSSSTPMVTLATAHPSKFPDTVKAASGIVPDCPISLEQMMRRPENCKVMNKNIDEIKKFIKKR********
*KYISTRNVDLSLGFCDTILSGLATDGGLYIPKYIPRLSEKEIKDLRGLSYQEIALFIFRLFIGQEIKSSKLRDIVNRSYHCFRNAAVTPLIQLNANEFLLELFHGPTLSFKDIAMQFIAELMDHILEERDHYITIVGATSGDTGAAAIKAFAGKKRINMYILFPEGRISVVQQKQMTTSEASNINVIAVQSSFDDCQKIVKNLFSDVFFCHSVNLSGINSINWARIMAQIVYYFVSSIALGSPNRNISFSVPTGNFGDIFAGYMAKMMGLPIEKLIIATNENDTLVRMFDMGMYRPEIVMETTSPAMDIQIPSNFERLLFEISGRNSLLVKEAFYSLENKKYFRIDSEHLQKMSLSFSAKRASMEDVNSVIKSVLEKSNYLVDPHTAVGIHAALACRKSSSTPMVTLATAHPSKFPDTVKAASGIVPDCPISLEQMMRRPENCKVMNKNIDEIKKFIKKRNMES****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKYISTRNVDLSLGFCDTILSGLATDGGLYIPKYIPRLSEKEIKDLRGLSYQEIALFIFRLFIGQEIKSSKLRDIVNRSYHCFRNAAVTPLIQLNANEFLLELFHGPTLSFKDIAMQFIAELMDHILEERDHYITIVGATSGDTGAAAIKAFAGKKRINMYILFPEGRISVVQQKQMTTSEASNINVIAVQSSFDDCQKIVKNLFSDVFFCHSVNLSGINSINWARIMAQIVYYFVSSIALGSPNRNISFSVPTGNFGDIFAGYMAKMMGLPIEKLIIATNENDTLVRMFDMGMYRPEIVMETTSPAMDIQIPSNFERLLFEISGRNSLLVKEAFYSLENKKYFRIDSEHLQKMSLSFSAKRASMEDVNSVIKSVLEKSNYLVDPHTAVGIHAALACRKSSSTPMVTLATAHPSKFPDTVKAASGIVPDCPISLEQMMRRPENCKVMNKNIDEIKKFIKKRNMESKIEP
MKYISTRNVDLSLGFCDTILSGLATDGGLYIPKYIPRLSEKEIKDLRGLSYQEIALFIFRLFIGQEIKSSKLRDIVNRSYHCFRNAAVTPLIQLNANEFLLELFHGPTLSFKDIAMQFIAELMDHILEERDHYITIVGATSGDTGAAAIKAFAGKKRINMYILFPEGRISVVQQKQMTTSEASNINVIAVQSSFDDCQKIVKNLFSDVFFCHSVNLSGINSINWARIMAQIVYYFVSSIALGSPNRNISFSVPTGNFGDIFAGYMAKMMGLPIEKLIIATNENDTLVRMFDMGMYRPEIVMETTSPAMDIQIPSNFERLLFEISGRNSLLVKEAFYSLENKKYFRIDSEHLQKMSLSFSAKRASMEDVNSVIKSVLEKSNYLVDPHTAVGIHAALACRKSSSTPMVTLATAHPSKFPDTVKAASGIVPDCPISLEQMMRRPENCKVMNKNIDEIKKFIKKRNMESKIEP
MKYISTRNVDLSLGFCDTILSGLATDGGLYIPKYIPRLSEKEIKDLRGLSYQEIALFIFRLFIGQEIKSSKLRDIVNRSYHCFRNAAVTPLIQLNANEFLLELFHGPTLSFKDIAMQFIAELMDHILEERDHYITIVGATSGDTGAAAIKAFAGKKRINMYILFPEGRISVVQQKQMTTSEASNINVIAVQSSFDDCQKIVKNLFSDVFFCHSVNLSGINSINWARIMAQIVYYFVSSIALGSPNRNISFSVPTGNFGDIFAGYMAKMMGLPIEKLIIATNENDTLVRMFDMGMYRPEIVMETTSPAMDIQIPSNFERLLFEISGRNSLLVKEAFYSLENKKYFRIDSEHLQKMSLSFSAKRASMEDVNSVIKSVLEKSNYLVDPHTAVGIHAALACRKSSSTPMVTLATAHPSKFPDTVKAASGIVPDCPISLEQMMRRPENCKVMNKNIDEIKKFIKKRNMESKIEP

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target469 threonine synthase [Candidatus Liberibacter asiaticus s
315122086467 threonine synthase [Candidatus Liberibacter solanacearu 1 0.0
150395760465 threonine synthase [Sinorhizobium medicae WSM419] Lengt 1 1e-153
227821122465 threonine synthase [Sinorhizobium fredii NGR234] Length 1 1e-153
15964674466 threonine synthase [Sinorhizobium meliloti 1021] Length 1 1e-152
13476245465 threonine synthase [Mesorhizobium loti MAFF303099] Leng 1 1e-150
325292171465 Threonine synthase [Agrobacterium sp. H13-3] Length = 4 1 1e-147
260460282465 threonine synthase [Mesorhizobium opportunistum WSM2075 1 1e-146
209548241471 threonine synthase [Rhizobium leguminosarum bv. trifoli 1 1e-146
218674746471 threonine synthase [Rhizobium etli GR56] Length = 471 1 1e-146
190890695474 threonine synthase [Rhizobium etli CIAT 652] Length = 4 1 1e-145
>gi|315122086|ref|YP_004062575.1| threonine synthase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 467 Back     alignment and organism information
 Score =  751 bits (1940), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/461 (76%), Positives = 415/461 (90%)

Query: 1   MKYISTRNVDLSLGFCDTILSGLATDGGLYIPKYIPRLSEKEIKDLRGLSYQEIALFIFR 60
           MKYISTRNVDL++GFCD ILSGLA DGGLYIPK IP  SEKEI++LRGLSY+EIA FIF 
Sbjct: 1   MKYISTRNVDLNIGFCDAILSGLAEDGGLYIPKDIPYFSEKEIRNLRGLSYEEIAQFIFL 60

Query: 61  LFIGQEIKSSKLRDIVNRSYHCFRNAAVTPLIQLNANEFLLELFHGPTLSFKDIAMQFIA 120
            F+G+EI+SSKL++IVNR+YHCFRNAAVTPL+QL+ N+FLLELFHGPTLSFKDIAMQ +A
Sbjct: 61  PFVGEEIESSKLQEIVNRAYHCFRNAAVTPLVQLDKNDFLLELFHGPTLSFKDIAMQLLA 120

Query: 121 ELMDHILEERDHYITIVGATSGDTGAAAIKAFAGKKRINMYILFPEGRISVVQQKQMTTS 180
           EL+DHILEERD YITIVGATSGDTGAAAIKAFAGKKR+ + ILFP+GR+S+VQQKQMTTS
Sbjct: 121 ELIDHILEERDQYITIVGATSGDTGAAAIKAFAGKKRVKVCILFPKGRVSLVQQKQMTTS 180

Query: 181 EASNINVIAVQSSFDDCQKIVKNLFSDVFFCHSVNLSGINSINWARIMAQIVYYFVSSIA 240
            A N+++IA++ SFDDCQKIVKNLF+DV F +SVNLSGINSINWARIMAQIVYYFVS+I 
Sbjct: 181 RAFNVDIIAIEGSFDDCQKIVKNLFADVHFRNSVNLSGINSINWARIMAQIVYYFVSAIV 240

Query: 241 LGSPNRNISFSVPTGNFGDIFAGYMAKMMGLPIEKLIIATNENDTLVRMFDMGMYRPEIV 300
           LG+P+R ISFSVPTGNFGDIFAGY AK+MGLPIE+LIIATNENDTLVRM + G+Y+PE V
Sbjct: 241 LGAPDRKISFSVPTGNFGDIFAGYFAKLMGLPIEQLIIATNENDTLVRMLNTGIYKPETV 300

Query: 301 METTSPAMDIQIPSNFERLLFEISGRNSLLVKEAFYSLENKKYFRIDSEHLQKMSLSFSA 360
            ETTSPAMDIQI SNFERLLFEISGR+S+LVK+AF SLEN++YF+I  EHLQK+S  FSA
Sbjct: 301 KETTSPAMDIQISSNFERLLFEISGRDSVLVKKAFDSLENQQYFQIYPEHLQKISCLFSA 360

Query: 361 KRASMEDVNSVIKSVLEKSNYLVDPHTAVGIHAALACRKSSSTPMVTLATAHPSKFPDTV 420
           + AS +DVN VI SVLE S+YL+DPHTAVGIHAALACRK+ STPMVTLATAHP+KFPD V
Sbjct: 361 RSASQKDVNDVIHSVLENSSYLLDPHTAVGIHAALACRKTLSTPMVTLATAHPAKFPDIV 420

Query: 421 KAASGIVPDCPISLEQMMRRPENCKVMNKNIDEIKKFIKKR 461
           K AS I P+CP+ L+Q M+RPE+ K+M+ NI+++K+FIK +
Sbjct: 421 KMASSITPNCPVFLQQTMKRPESFKLMSNNIEQVKEFIKNK 461


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|150395760|ref|YP_001326227.1| threonine synthase [Sinorhizobium medicae WSM419] Length = 465 Back     alignment and organism information
>gi|227821122|ref|YP_002825092.1| threonine synthase [Sinorhizobium fredii NGR234] Length = 465 Back     alignment and organism information
>gi|15964674|ref|NP_385027.1| threonine synthase [Sinorhizobium meliloti 1021] Length = 466 Back     alignment and organism information
>gi|13476245|ref|NP_107815.1| threonine synthase [Mesorhizobium loti MAFF303099] Length = 465 Back     alignment and organism information
>gi|325292171|ref|YP_004278035.1| Threonine synthase [Agrobacterium sp. H13-3] Length = 465 Back     alignment and organism information
>gi|260460282|ref|ZP_05808534.1| threonine synthase [Mesorhizobium opportunistum WSM2075] Length = 465 Back     alignment and organism information
>gi|209548241|ref|YP_002280158.1| threonine synthase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 471 Back     alignment and organism information
>gi|218674746|ref|ZP_03524415.1| threonine synthase [Rhizobium etli GR56] Length = 471 Back     alignment and organism information
>gi|190890695|ref|YP_001977237.1| threonine synthase [Rhizobium etli CIAT 652] Length = 474 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target469 threonine synthase [Candidatus Liberibacter asiaticus s
PRK09225462 PRK09225, PRK09225, threonine synthase; Validated 0.0
COG0498411 COG0498, ThrC, Threonine synthase [Amino acid transport 3e-95
cd01560460 cd01560, Thr-synth_2, Threonine synthase catalyzes the 1e-168
TIGR00260328 TIGR00260, thrC, threonine synthase 4e-48
KOG2616266 KOG2616, KOG2616, KOG2616, Pyridoxalphosphate-dependent 6e-44
cd00640244 cd00640, Trp-synth-beta_II, Tryptophan synthase beta su 2e-31
pfam00291251 pfam00291, PALP, Pyridoxal-phosphate dependent enzyme 4e-12
PRK06352351 PRK06352, PRK06352, threonine synthase; Validated 9e-09
PRK07409353 PRK07409, PRK07409, threonine synthase; Validated 3e-08
PRK06260397 PRK06260, PRK06260, threonine synthase; Validated 5e-08
PRK06721352 PRK06721, PRK06721, threonine synthase; Reviewed 3e-07
PLN02569484 PLN02569, PLN02569, threonine synthase 2e-14
cd01563324 cd01563, Thr-synth_1, Threonine synthase is a pyridoxal 8e-11
>gnl|CDD|181710 PRK09225, PRK09225, threonine synthase; Validated Back     alignment and domain information
>gnl|CDD|30844 COG0498, ThrC, Threonine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|107203 cd01560, Thr-synth_2, Threonine synthase catalyzes the final step of threonine biosynthesis Back     alignment and domain information
>gnl|CDD|161791 TIGR00260, thrC, threonine synthase Back     alignment and domain information
>gnl|CDD|37827 KOG2616, KOG2616, KOG2616, Pyridoxalphosphate-dependent enzyme/predicted threonine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|107202 cd00640, Trp-synth-beta_II, Tryptophan synthase beta superfamily (fold type II); this family of pyridoxal phosphate (PLP)-dependent enzymes catalyzes beta-replacement and beta-elimination reactions Back     alignment and domain information
>gnl|CDD|144031 pfam00291, PALP, Pyridoxal-phosphate dependent enzyme Back     alignment and domain information
>gnl|CDD|180539 PRK06352, PRK06352, threonine synthase; Validated Back     alignment and domain information
>gnl|CDD|180966 PRK07409, PRK07409, threonine synthase; Validated Back     alignment and domain information
>gnl|CDD|180494 PRK06260, PRK06260, threonine synthase; Validated Back     alignment and domain information
>gnl|CDD|136018 PRK06721, PRK06721, threonine synthase; Reviewed Back     alignment and domain information
>gnl|CDD|178182 PLN02569, PLN02569, threonine synthase Back     alignment and domain information
>gnl|CDD|107206 cd01563, Thr-synth_1, Threonine synthase is a pyridoxal phosphate (PLP) dependent enzyme that catalyses the last reaction in the synthesis of threonine from aspartate Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 469 threonine synthase [Candidatus Liberibacter asiaticus s
PRK09225465 threonine synthase; Validated 100.0
cd01560460 Thr-synth_2 Threonine synthase catalyzes the final step 100.0
COG0498411 ThrC Threonine synthase [Amino acid transport and metab 100.0
) is involved in threonine biosynthesis. It catalyses the conversion of O-phospho-L-homoserine and water into L-threonine and orthophosphate, using pyridoxal phosphate as a cofactor. The pyridoxal-phosphate binding site is a Lys (K) residue. The enzyme is distantly related to the serine/threonine dehydratases which are also pyridoxal-phosphate dependent enzymes .; GO: 0004795 threonine synthase activity, 0009088 threonine biosynthetic process." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR00260">TIGR00260423 thrC threonine synthase; InterPro: IPR004450 Threonine 100.0
PRK06260400 threonine synthase; Validated 100.0
PRK05638443 threonine synthase; Validated 99.95
PRK08329348 threonine synthase; Validated 99.93
PRK06450336 threonine synthase; Validated 99.92
cd06446365 Trp-synth_B Tryptophan synthase-beta: Trptophan synthas 99.79
PRK06815318 hypothetical protein; Provisional 99.79
PRK06381319 threonine synthase; Validated 99.78
PRK09224 504 threonine dehydratase; Reviewed 99.41
PRK12483 521 threonine dehydratase; Reviewed 99.39
) and D-serine dehydratase () catalyze the dehydratation of L-serine (respectively D-serine) into ammonia and pyruvate. Threonine dehydratase () (TDH) catalyzes the dehydratation of threonine into alpha-ketobutarate and ammonia. In Escherichia coli and other microorganisms, two classes of TDH are known to exist. One is involved in the biosynthesis of isoleucine, the other in hydroxamino acid catabolism. Threonine synthase () is also a pyridoxal-phosphate enzyme, it catalyzes the transformation of homoserine-phosphate into threonine. It has been shown that threonine synthase is distantly related to the serine/threonine dehydratases. In all these enzymes, the pyridoxal-phosphate group is attached to a lysine residue. This family describes a form of threonine dehydratase, with two copies of the threonine dehydratase C-terminal domain IPR001721 from INTERPRO. Members with known function participate in isoleucine biosynthesis and are inhibited by isoleucine.; GO: 0004794 L-threonine ammonia-lyase activity, 0009097 isoleucine biosynthetic process." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR01124">TIGR01124 508 ilvA_2Cterm threonine ammonia-lyase, biosynthetic; Inte 97.47
PRK12391419 tryptophan synthase subunit beta; Reviewed 94.59
KOG2616266 consensus 100.0
PRK07591422 threonine synthase; Validated 99.97
PRK07409350 threonine synthase; Validated 99.95
PRK06721352 threonine synthase; Reviewed 99.94
PRK06352351 threonine synthase; Validated 99.94
PRK08639418 threonine dehydratase; Validated 99.63
PRK08526403 threonine dehydratase; Provisional 99.53
PRK08198406 threonine dehydratase; Provisional 99.51
PRK06382400 threonine dehydratase; Provisional 99.51
PRK07334399 threonine dehydratase; Provisional 99.47
TIGR02079415 THD1 threonine dehydratase; InterPro: IPR011820 This en 98.67
PRK08197402 threonine synthase; Validated 99.97
cd00640244 Trp-synth-beta_II Tryptophan synthase beta superfamily 99.95
pfam00291251 PALP Pyridoxal-phosphate dependent enzyme. Members of t 99.88
cd01563324 Thr-synth_1 Threonine synthase is a pyridoxal phosphate 99.87
cd01562304 Thr-dehyd Threonine dehydratase: The first step in amin 99.86
PRK06110321 hypothetical protein; Provisional 99.82
PRK08638329 threonine dehydratase; Validated 99.81
cd06448316 L-Ser-dehyd Serine dehydratase is a pyridoxal phosphate 99.81
PRK07048321 serine/threonine dehydratase; Validated 99.81
PRK07476323 threonine dehydratase; Provisional 99.76
PRK08246307 threonine dehydratase; Provisional 99.75
PRK06608330 threonine dehydratase; Provisional 99.67
cd01561291 CBS_like CBS_like: This subgroup includes Cystathionine 99.67
PRK10717334 cysteine synthase A; Provisional 99.63
PRK11761296 cysM cysteine synthase B; Provisional 99.56
PRK08813349 threonine dehydratase; Provisional 99.5
COG1171347 IlvA Threonine dehydratase [Amino acid transport and me 99.4
PRK03910331 D-cysteine desulfhydrase; Validated 99.08
) and D-serine dehydratase () catalyze the dehydratation of L-serine (respectively D-serine) into ammonia and pyruvate. Threonine dehydratase () (TDH) catalyzes the dehydratation of threonine into alpha-ketobutarate and ammonia. In Escherichia coli and other microorganisms, two classes of TDH are known to exist. One is involved in the biosynthesis of isoleucine, the other in hydroxamino acid catabolism. Threonine synthase () is also a pyridoxal-phosphate enzyme, it catalyzes the transformation of homoserine-phosphate into threonine. It has been shown that threonine synthase is distantly related to the serine/threonine dehydratases. In all these enzymes, the pyridoxal-phosphate group is attached to a lysine residue. A form of threonine dehydratase with two copies of the C-terminal domain is described by . This model describes a phylogenetically distinct which branches with the catabolic threonine dehydratase of E. coli; many members are designated as catabolic for this reason. However, the catabolic form lacks any domain. Many members of this model are found in species with other isoleucine biosynthetic enzymes.; GO: 0004794 L-threonine ammonia-lyase activity." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR01127">TIGR01127381 ilvA_1Cterm threonine dehydratase; InterPro: IPR005789 98.88
KOG1251323 consensus 98.87
COG0031300 CysK Cysteine synthase [Amino acid transport and metabo 98.8
cd06449307 ACCD Aminocyclopropane-1-carboxylate deaminase (ACCD): 98.66
KOG1252362 consensus 98.38
TIGR02991318 ectoine_eutB ectoine utilization protein EutB; InterPro 98.27
TIGR01136315 cysKM cysteine synthases; InterPro: IPR005856 This mode 97.55
TIGR01138300 cysM cysteine synthase B; InterPro: IPR005858 Cysteine 97.13
PRK12390337 1-aminocyclopropane-1-carboxylate deaminase; Provisiona 96.75
TIGR01139312 cysK cysteine synthase A; InterPro: IPR005859 This mode 96.03
PRK08206379 diaminopropionate ammonia-lyase; Provisional 99.34
KOG1250457 consensus 99.01
TIGR03528396 2_3_DAP_am_ly diaminopropionate ammonia-lyase. Members 98.82
PRK13028403 tryptophan synthase subunit beta; Provisional 99.29
PRK04346392 tryptophan synthase subunit beta; Validated 95.93
COG5598526 Trimethylamine:corrinoid methyltransferase [Coenzyme me 91.05
PRK06113255 7-alpha-hydroxysteroid dehydrogenase; Validated 90.01
>PRK09225 threonine synthase; Validated Back     alignment and domain information
>cd01560 Thr-synth_2 Threonine synthase catalyzes the final step of threonine biosynthesis Back     alignment and domain information
>COG0498 ThrC Threonine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00260 thrC threonine synthase; InterPro: IPR004450 Threonine synthase (Back     alignment and domain information
>PRK06260 threonine synthase; Validated Back     alignment and domain information
>PRK05638 threonine synthase; Validated Back     alignment and domain information
>PRK08329 threonine synthase; Validated Back     alignment and domain information
>PRK06450 threonine synthase; Validated Back     alignment and domain information
>cd06446 Trp-synth_B Tryptophan synthase-beta: Trptophan synthase is a bifunctional enzyme that catalyses the last two steps in the biosynthesis of L-tryptophan via its alpha and beta reactions Back     alignment and domain information
>PRK06815 hypothetical protein; Provisional Back     alignment and domain information
>PRK06381 threonine synthase; Validated Back     alignment and domain information
>PRK09224 threonine dehydratase; Reviewed Back     alignment and domain information
>PRK12483 threonine dehydratase; Reviewed Back     alignment and domain information
>TIGR01124 ilvA_2Cterm threonine ammonia-lyase, biosynthetic; InterPro: IPR005787 Serine and threonine dehydratases , are functionally and structurally related pyridoxal-phosphate dependent enzymes Back     alignment and domain information
>PRK12391 tryptophan synthase subunit beta; Reviewed Back     alignment and domain information
>KOG2616 consensus Back     alignment and domain information
>PRK07591 threonine synthase; Validated Back     alignment and domain information
>PRK07409 threonine synthase; Validated Back     alignment and domain information
>PRK06721 threonine synthase; Reviewed Back     alignment and domain information
>PRK06352 threonine synthase; Validated Back     alignment and domain information
>PRK08639 threonine dehydratase; Validated Back     alignment and domain information
>PRK08526 threonine dehydratase; Provisional Back     alignment and domain information
>PRK08198 threonine dehydratase; Provisional Back     alignment and domain information
>PRK06382 threonine dehydratase; Provisional Back     alignment and domain information
>PRK07334 threonine dehydratase; Provisional Back     alignment and domain information
>TIGR02079 THD1 threonine dehydratase; InterPro: IPR011820 This entry represents threonine dehydratase, the first step in the pathway converting threonine into isoleucine Back     alignment and domain information
>PRK08197 threonine synthase; Validated Back     alignment and domain information
>cd00640 Trp-synth-beta_II Tryptophan synthase beta superfamily (fold type II); this family of pyridoxal phosphate (PLP)-dependent enzymes catalyzes beta-replacement and beta-elimination reactions Back     alignment and domain information
>pfam00291 PALP Pyridoxal-phosphate dependent enzyme Back     alignment and domain information
>cd01563 Thr-synth_1 Threonine synthase is a pyridoxal phosphate (PLP) dependent enzyme that catalyses the last reaction in the synthesis of threonine from aspartate Back     alignment and domain information
>cd01562 Thr-dehyd Threonine dehydratase: The first step in amino acid degradation is the removal of nitrogen Back     alignment and domain information
>PRK06110 hypothetical protein; Provisional Back     alignment and domain information
>PRK08638 threonine dehydratase; Validated Back     alignment and domain information
>cd06448 L-Ser-dehyd Serine dehydratase is a pyridoxal phosphate (PLP)-dependent enzyme which catalyzes the conversion of L- , D-serine, or L-threonine to pyruvate/ketobutyrate and ammonia Back     alignment and domain information
>PRK07048 serine/threonine dehydratase; Validated Back     alignment and domain information
>PRK07476 threonine dehydratase; Provisional Back     alignment and domain information
>PRK08246 threonine dehydratase; Provisional Back     alignment and domain information
>PRK06608 threonine dehydratase; Provisional Back     alignment and domain information
>cd01561 CBS_like CBS_like: This subgroup includes Cystathionine beta-synthase (CBS) and Cysteine synthase Back     alignment and domain information
>PRK10717 cysteine synthase A; Provisional Back     alignment and domain information
>PRK11761 cysM cysteine synthase B; Provisional Back     alignment and domain information
>PRK08813 threonine dehydratase; Provisional Back     alignment and domain information
>COG1171 IlvA Threonine dehydratase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK03910 D-cysteine desulfhydrase; Validated Back     alignment and domain information
>TIGR01127 ilvA_1Cterm threonine dehydratase; InterPro: IPR005789 Serine and threonine dehydratases , are functionally and structurally related pyridoxal-phosphate dependent enzymes Back     alignment and domain information
>KOG1251 consensus Back     alignment and domain information
>COG0031 CysK Cysteine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>cd06449 ACCD Aminocyclopropane-1-carboxylate deaminase (ACCD): Pyridoxal phosphate (PLP)-dependent enzyme which catalyzes the conversion of 1-aminocyclopropane-L-carboxylate (ACC), a precursor of the plant hormone ethylene, to alpha-ketobutyrate and ammonia Back     alignment and domain information
>KOG1252 consensus Back     alignment and domain information
>TIGR02991 ectoine_eutB ectoine utilization protein EutB; InterPro: IPR014333 Members of this entry are EutA, a predicted arylmalonate decarboxylase found in a conserved ectoine utilization operon of species that include Mesorhizobium loti, Silicibacter pomeroyi, Agrobacterium tumefaciens, Pseudomonas putida and Sinorhizobium meliloti 1021, where it is known to be induced by ectoine Back     alignment and domain information
>TIGR01136 cysKM cysteine synthases; InterPro: IPR005856 This model discriminates cysteine synthases (both CysK and CysM) from cystathionine beta-synthase, a protein found primarily in eukaryotes and carrying a C-terminal CBS domain lacking from this protein Back     alignment and domain information
>TIGR01138 cysM cysteine synthase B; InterPro: IPR005858 Cysteine synthase B (O-acetylserine (thiol)-lyase, 2 Back     alignment and domain information
>PRK12390 1-aminocyclopropane-1-carboxylate deaminase; Provisional Back     alignment and domain information
>TIGR01139 cysK cysteine synthase A; InterPro: IPR005859 This model discriminates cysteine synthase A (CysK) and cysteine synthase B (CysM) from cystathionine beta-synthase, a protein found primarily in eukaryotes and carrying a C-terminal CBS domain lacking from this protein Back     alignment and domain information
>PRK08206 diaminopropionate ammonia-lyase; Provisional Back     alignment and domain information
>KOG1250 consensus Back     alignment and domain information
>TIGR03528 2_3_DAP_am_ly diaminopropionate ammonia-lyase Back     alignment and domain information
>PRK13028 tryptophan synthase subunit beta; Provisional Back     alignment and domain information
>PRK04346 tryptophan synthase subunit beta; Validated Back     alignment and domain information
>COG5598 Trimethylamine:corrinoid methyltransferase [Coenzyme metabolism] Back     alignment and domain information
>PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target469 threonine synthase [Candidatus Liberibacter asiaticus s
1kl7_A514 Crystal Structure Of Threonine Synthase From Yeast 1e-110
1vb3_A428 Crystal Structure Of Threonine Synthase From Escher 1e-97
2c2b_A486 Crystallographic Structure Of Arabidopsis Thaliana 8e-29
1e5x_A486 Structure Of Threonine Synthase From Arabidopsis Th 3e-26
1uim_A351 Crystal Structure Of Threonine Synthase From Thermu 7e-18
2d1f_A360 Structure Of Mycobacterium Tuberculosis Threonine S 3e-15
2zsj_A352 Crystal Structure Of Threonine Synthase From Aquife 5e-14
>gi|20664123|pdb|1KL7|A Chain A, Crystal Structure Of Threonine Synthase From Yeast Length = 514 Back     alignment and structure
 Score =  402 bits (1034), Expect = e-110,   Method: Composition-based stats.
 Identities = 201/507 (39%), Positives = 292/507 (57%), Gaps = 42/507 (8%)

Query: 3   YISTRNVDLS-LGFCDTILSGLATDGGLYIPKYIPRLSEKEI-KDLRGLSYQEIALFIFR 60
           Y STR+     + F + I+ GLATDGGL+IP  IP++ +  +  D   LS+Q++A  I R
Sbjct: 8   YRSTRSSSPKTISFEEAIIQGLATDGGLFIPPTIPQVDQATLFNDWSKLSFQDLAFAIXR 67

Query: 61  LFIG-QEIKSSKLRDIVNRSYHCFRNAAVTPLIQL----NANEFLLELFHGPTLSFKDIA 115
           L+I  +EI  + L+D++ RSY  FR+  VTPL+Q       N  +LELFHGPT +FKD+A
Sbjct: 68  LYIAQEEIPDADLKDLIKRSYSTFRSDEVTPLVQNVTGDKENLHILELFHGPTYAFKDVA 127

Query: 116 MQFIAELMDHILEERD--------HYITIVGATSGDTGAAAIKAFAGKKRINMYILFPEG 167
           +QF+  L ++ L+  +          IT+VGATSGDTG+AAI    GKK ++++IL+P G
Sbjct: 128 LQFVGNLFEYFLQRTNANLPEGEKKQITVVGATSGDTGSAAIYGLRGKKDVSVFILYPTG 187

Query: 168 RISVVQQKQMTTSEASNINVIAVQSSFDDCQKIVKNLFSDVFFCHSVNLSGINSINWARI 227
           RIS +Q++Q TT    N+  ++V  +FD+CQ IVK +F D  F    N+  +NSINWARI
Sbjct: 188 RISPIQEEQXTTVPDENVQTLSVTGTFDNCQDIVKAIFGDKEFNSKHNVGAVNSINWARI 247

Query: 228 MAQIVYYFVSSIA--LGSPNRNISFSVPTGNFGDIFAGYMAKMMGLPIEKLIIATNENDT 285
           +AQ  YYF S      G  ++ + F VP+GNFGDI AGY AK  GLPIEKL IATNEND 
Sbjct: 248 LAQXTYYFYSFFQATNGKDSKKVKFVVPSGNFGDILAGYFAKKXGLPIEKLAIATNENDI 307

Query: 286 LVRMFDMGMY-RPEIVMETTSPAMDIQIPSNFERLLFEISGRN---------SLLVKEAF 335
           L R    G+Y R + V  T SPA DI I SNFERLL+ ++              +V   F
Sbjct: 308 LDRFLKSGLYERSDKVAATLSPAXDILISSNFERLLWYLAREYLANGDDLKAGEIVNNWF 367

Query: 336 YSLENKKYFRIDSEHLQKMSLSFSAKRASMEDVNSVIKSVLEKS----NYLVDPHTAVGI 391
             L+    F++D   ++  S  F+++R S E+ +  IK + E S    +Y++DPHTAVG+
Sbjct: 368 QELKTNGKFQVDKSIIEGASKDFTSERVSNEETSETIKKIYESSVNPKHYILDPHTAVGV 427

Query: 392 HAALACRKSSSTP---MVTLATAHPSKFPDTVKAASG-------IVPDCPISLEQMMRRP 441
            A        +      ++L+TAHP+KF D V  A              P  L+++    
Sbjct: 428 CATERLIAKDNDKSIQYISLSTAHPAKFADAVNNALSGFSNYSFEKDVLPEELKKLSTLK 487

Query: 442 ENCKVMN-KNIDEIKKFIKKRNMESKI 467
           +  K +   +++ +K  I++   + K+
Sbjct: 488 KKLKFIERADVELVKNAIEEELAKXKL 514


gi|71041761|pdb|1VB3|A Chain A, Crystal Structure Of Threonine Synthase From Escherichia Coli Length = 428 Back     alignment and structure
>gi|83754491|pdb|2C2B|A Chain A, Crystallographic Structure Of Arabidopsis Thaliana Threonine Synthase Complexed With Pyridoxal Phosphate And S-Adenosylmethionine Length = 486 Back     alignment and structure
>gi|15825882|pdb|1E5X|A Chain A, Structure Of Threonine Synthase From Arabidopsis Thaliana Length = 486 Back     alignment and structure
gi|39654919|pdb|1UIM|A Chain A, Crystal Structure Of Threonine Synthase From Thermus Thermophilus Hb8, Orthorhombic Crystal Form Length = 351 Back     alignment and structure
gi|114793663|pdb|2D1F|A Chain A, Structure Of Mycobacterium Tuberculosis Threonine Synthase Length = 360 Back     alignment and structure
gi|209870329|pdb|2ZSJ|A Chain A, Crystal Structure Of Threonine Synthase From Aquifex Aeolicus Vf5 Length = 352 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target469 threonine synthase [Candidatus Liberibacter asiaticus s
1kl7_A514 Threonine synthase; threonine synthesis, pyridoxal 5-ph 1e-140
1vb3_A428 Threonine synthase; PLP-dependent enzyme, lyase; HET: K 6e-88
1e5x_A486 Threonine synthase; threonine biosynthesis, PLP enzyme, 4e-43
3aey_A351 Threonine synthase; PLP, pyridoxal phosphate, lyase; 1. 1e-20
1v7c_A351 Threonine synthase; PLP-dependent enzyme, riken structu 3e-15
2d1f_A360 Threonine synthase; amino acid synthesis, pyridoxal-5'- 6e-15
2zsj_A352 Threonine synthase; PLP dependent enzyme, lyase; HET: P 3e-11
1p5j_A372 L-serine dehydratase; lyase; HET: PLP; 2.50A {Homo sapi 2e-06
3iau_A366 Threonine deaminase; pyridoxal phosphate, amino-acid bi 6e-04
1tdj_A 514 Biosynthetic threonine deaminase; allostery, cooperativ 2e-04
1jbq_A435 Cystathionine beta-synthase, serine sulfhydrase; fold t 0.001
1wkv_A389 Cysteine synthase; homodimer, open alpha/beta folding, 3e-04
>1kl7_A Threonine synthase; threonine synthesis, pyridoxal 5-phosphate, beta-family, monomer, lyase; HET: PLP; 2.70A {Saccharomyces cerevisiae} SCOP: c.79.1.1 Length = 514 Back     alignment and structure
 Score =  494 bits (1273), Expect = e-140
 Identities = 207/509 (40%), Positives = 299/509 (58%), Gaps = 42/509 (8%)

Query: 1   MKYISTRNVDL-SLGFCDTILSGLATDGGLYIPKYIPRLSEKEI-KDLRGLSYQEIALFI 58
             Y STR+    ++ F + I+ GLATDGGL+IP  IP++ +  +  D   LS+Q++A  I
Sbjct: 6   QVYRSTRSSSPKTISFEEAIIQGLATDGGLFIPPTIPQVDQATLFNDWSKLSFQDLAFAI 65

Query: 59  FRLFIGQ-EIKSSKLRDIVNRSYHCFRNAAVTPLIQL----NANEFLLELFHGPTLSFKD 113
            RL+I Q EI  + L+D++ RSY  FR+  VTPL+Q       N  +LELFHGPT +FKD
Sbjct: 66  MRLYIAQEEIPDADLKDLIKRSYSTFRSDEVTPLVQNVTGDKENLHILELFHGPTYAFKD 125

Query: 114 IAMQFIAELMDHILEE--------RDHYITIVGATSGDTGAAAIKAFAGKKRINMYILFP 165
           +A+QF+  L ++ L+             IT+VGATSGDTG+AAI    GKK ++++IL+P
Sbjct: 126 VALQFVGNLFEYFLQRTNANLPEGEKKQITVVGATSGDTGSAAIYGLRGKKDVSVFILYP 185

Query: 166 EGRISVVQQKQMTTSEASNINVIAVQSSFDDCQKIVKNLFSDVFFCHSVNLSGINSINWA 225
            GRIS +Q++QMTT    N+  ++V  +FD+CQ IVK +F D  F    N+  +NSINWA
Sbjct: 186 TGRISPIQEEQMTTVPDENVQTLSVTGTFDNCQDIVKAIFGDKEFNSKHNVGAVNSINWA 245

Query: 226 RIMAQIVYYFVSSIAL--GSPNRNISFSVPTGNFGDIFAGYMAKMMGLPIEKLIIATNEN 283
           RI+AQ+ YYF S      G  ++ + F VP+GNFGDI AGY AK MGLPIEKL IATNEN
Sbjct: 246 RILAQMTYYFYSFFQATNGKDSKKVKFVVPSGNFGDILAGYFAKKMGLPIEKLAIATNEN 305

Query: 284 DTLVRMFDMGMY-RPEIVMETTSPAMDIQIPSNFERLLFEISG---------RNSLLVKE 333
           D L R    G+Y R + V  T SPAMDI I SNFERLL+ ++          +   +V  
Sbjct: 306 DILDRFLKSGLYERSDKVAATLSPAMDILISSNFERLLWYLAREYLANGDDLKAGEIVNN 365

Query: 334 AFYSLENKKYFRIDSEHLQKMSLSFSAKRASMEDVNSVIKSVLEKS----NYLVDPHTAV 389
            F  L+    F++D   ++  S  F+++R S E+ +  IK + E S    +Y++DPHTAV
Sbjct: 366 WFQELKTNGKFQVDKSIIEGASKDFTSERVSNEETSETIKKIYESSVNPKHYILDPHTAV 425

Query: 390 GIHAA---LACRKSSSTPMVTLATAHPSKFPDTVKAASGIV-------PDCPISLEQMMR 439
           G+ A    +A     S   ++L+TAHP+KF D V  A              P  L+++  
Sbjct: 426 GVCATERLIAKDNDKSIQYISLSTAHPAKFADAVNNALSGFSNYSFEKDVLPEELKKLST 485

Query: 440 RPENCKVM-NKNIDEIKKFIKKRNMESKI 467
             +  K +   +++ +K  I++   + K+
Sbjct: 486 LKKKLKFIERADVELVKNAIEEELAKMKL 514


>1vb3_A Threonine synthase; PLP-dependent enzyme, lyase; HET: KPA; 2.20A {Escherichia coli} SCOP: c.79.1.1 Length = 428 Back     alignment and structure
>1e5x_A Threonine synthase; threonine biosynthesis, PLP enzyme, S-adenosyl-methionine, allostery; 2.25A {Arabidopsis thaliana} SCOP: c.79.1.1 PDB: 2c2b_A* 2c2g_A* Length = 486 Back     alignment and structure
>3aey_A Threonine synthase; PLP, pyridoxal phosphate, lyase; 1.92A {Thermus thermophilus} PDB: 1uin_A* 1uim_A* 3aex_A* 1v7c_A Length = 351 Back     alignment and structure
>1v7c_A Threonine synthase; PLP-dependent enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics, lyase; HET: HEY; 2.00A {Thermus thermophilus} SCOP: c.79.1.1 PDB: 1uin_A* 1uim_A* Length = 351 Back     alignment and structure
>2d1f_A Threonine synthase; amino acid synthesis, pyridoxal-5'-phosphate, PLP, lyase; HET: PLP; 2.50A {Mycobacterium tuberculosis} Length = 360 Back     alignment and structure
>2zsj_A Threonine synthase; PLP dependent enzyme, lyase; HET: PLP; 1.80A {Aquifex aeolicus} Length = 352 Back     alignment and structure
>1p5j_A L-serine dehydratase; lyase; HET: PLP; 2.50A {Homo sapiens} SCOP: c.79.1.1 PDB: 1pwh_A* 1pwe_A* Length = 372 Back     alignment and structure
>3iau_A Threonine deaminase; pyridoxal phosphate, amino-acid biosynthesis, defensive protein, jasmonic acid pathway; HET: LLP 15P; 2.35A {Solanum lycopersicum} Length = 366 Back     alignment and structure
>1tdj_A Biosynthetic threonine deaminase; allostery, cooperative, tetramer, regulation, pyridoxal phosphate, isoleucine biosynthesis; HET: PLP; 2.80A {Escherichia coli} SCOP: c.79.1.1 d.58.18.2 d.58.18.2 Length = 514 Back     alignment and structure
>1jbq_A Cystathionine beta-synthase, serine sulfhydrase; fold type II of PLP enzymes, lyase; HET: HEM PLP; 2.60A {Homo sapiens} SCOP: c.79.1.1 PDB: 1m54_A* Length = 435 Back     alignment and structure
>1wkv_A Cysteine synthase; homodimer, open alpha/beta folding, transferase; HET: PLP; 2.00A {Aeropyrum pernix K1} SCOP: c.79.1.1 Length = 389 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target469 threonine synthase [Candidatus Liberibacter asiaticus s
1kl7_A514 Threonine synthase; threonine synthesis, pyridoxal 5-ph 100.0
1vb3_A428 Threonine synthase; PLP-dependent enzyme, lyase; HET: K 100.0
1e5x_A486 Threonine synthase; threonine biosynthesis, PLP enzyme, 100.0
2d1f_A360 Threonine synthase; amino acid synthesis, pyridoxal-5'- 99.95
3aey_A351 Threonine synthase; PLP, pyridoxal phosphate, lyase; 1. 99.96
2zsj_A352 Threonine synthase; PLP dependent enzyme, lyase; HET: P 99.96
2rkb_A318 Serine dehydratase-like; PLP bound enzyme, enzyme found 99.83
1tdj_A 514 Biosynthetic threonine deaminase; allostery, cooperativ 99.81
2gn0_A342 Threonine dehydratase catabolic; TDCB, biodegradative t 99.81
1o58_A303 O-acetylserine sulfhydrylase; TM0665, structural genomi 99.75
1jbq_A435 Cystathionine beta-synthase, serine sulfhydrase; fold t 99.69
2egu_A308 Cysteine synthase; O-acetylserine sulfhydrase, structur 99.68
1y7l_A316 O-acetylserine sulfhydrylase, O-acetylserine (thiol)-ly 99.61
2v03_A303 Cysteine synthase B; pyridoxal phosphate, cysteine bios 99.6
1ve1_A304 O-acetylserine sulfhydrylase; PLP, transferase, riken s 99.57
2pqm_A343 Cysteine synthase; OASS, PLP, lyase; HET: PLP; 1.86A {E 99.53
1z7w_A322 Cysteine synthase; transferase; HET: PLP; 2.20A {Arabid 99.53
3dwg_A325 Cysteine synthase B; sulfur carrier protein complex, be 99.53
2q3b_A313 Cysteine synthase A; pyridoxal-5'-phosphate, sulphur me 99.5
1p5j_A372 L-serine dehydratase; lyase; HET: PLP; 2.50A {Homo sapi 99.85
3iau_A366 Threonine deaminase; pyridoxal phosphate, amino-acid bi 99.84
1ve5_A311 Threonine deaminase; riken structural genomics/proteomi 99.83
1v71_A323 Serine racemase, hypothetical protein C320.14 in chromo 99.79
3l6b_A346 Serine racemase; pyridoxal phosphate, PLP, isomerase; H 99.77
1j0a_A325 1-aminocyclopropane-1-carboxylate deaminase; PLP depend 99.5
1tzj_A338 ACC deaminase, 1-aminocyclopropane-1-carboxylate deamin 99.43
1f2d_A341 1-aminocyclopropane-1-carboxylate deaminase; carbon-car 99.35
2o2e_A422 Tryptophan synthase beta chain; amino-acid biosynthesis 99.69
1v8z_A388 Tryptophan synthase beta chain 1; beta+alpha, riken str 99.64
1x1q_A418 Tryptophan synthase beta chain; structural genomics, ri 99.64
1qop_B396 Tryptophan synthase beta chain; lyase, carbon-oxygen ly 99.62
1wkv_A389 Cysteine synthase; homodimer, open alpha/beta folding, 99.52
3h7a_A252 Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGX 90.12
>1kl7_A Threonine synthase; threonine synthesis, pyridoxal 5-phosphate, beta-family, monomer, lyase; HET: PLP; 2.70A {Saccharomyces cerevisiae} SCOP: c.79.1.1 Back     alignment and structure
Probab=100.00  E-value=0  Score=1282.96  Aligned_cols=467  Identities=43%  Similarity=0.737  Sum_probs=445.5

Q ss_pred             CCEECCCCCCC-CCCHHHHHHCCCCCCCCCCCCCCCCCCCHHHH-HHHCCCCHHHHHHHHHHHHCC-CCCCHHHHHHHHH
Q ss_conf             93261789888-88889998615678786328610788898899-877099989999999987515-7899899999999
Q gi|254780465|r    1 MKYISTRNVDL-SLGFCDTILSGLATDGGLYIPKYIPRLSEKEI-KDLRGLSYQEIALFIFRLFIG-QEIKSSKLRDIVN   77 (469)
Q Consensus         1 M~y~STRg~~~-~~~f~~a~~~Gla~DGGL~vP~~~p~~~~~~~-~~~~~~sy~e~a~~il~~f~~-~~i~~~~l~~ii~   77 (469)
                      |.|+||||+.+ .+||+||+++|||+|||||||++||+++.+++ ..|+++||.|+|++|+++|++ ++|++++|++||+
T Consensus         6 ~~Y~STR~~~~~~~sf~~a~l~Gla~DGGLyvP~~~P~~~~~~l~~~~~~lsy~ela~~il~~fi~~~~i~~~~L~~i~~   85 (514)
T 1kl7_A            6 QVYRSTRSSSPKTISFEEAIIQGLATDGGLFIPPTIPQVDQATLFNDWSKLSFQDLAFAIMRLYIAQEEIPDADLKDLIK   85 (514)
T ss_dssp             SCBEETTCCSSCCBCHHHHHHHCSCTTSCCEECSSCCCCCHHHHHHTTTTCCHHHHHHHHHHTTSCTTTSCHHHHHHHHH
T ss_pred             CEEEECCCCCCCCCCHHHHHHHCCCCCCCEECCCCCCCCCHHHHHHHHHCCCHHHHHHHHHHHHCCCCCCCHHHHHHHHH
T ss_conf             37887969789976899999847688995364775798998999988757999999999999865954289999999999


Q ss_pred             HHHHHCCCCCCCEEEEC----CCCCEEEEECCCCCCCCCCCHHHHHHHHHHHHHHC--------CCCCEEEEECCCCCHH
Q ss_conf             98630476678604772----48825466213898120682388899999999731--------7982079971665404
Q gi|254780465|r   78 RSYHCFRNAAVTPLIQL----NANEFLLELFHGPTLSFKDIAMQFIAELMDHILEE--------RDHYITIVGATSGDTG  145 (469)
Q Consensus        78 ~ay~~f~~~~~~pl~~l----~~~~~vlELfHGPT~aFKD~a~q~l~~~~~~~l~~--------~~~~~~il~ATSGDTG  145 (469)
                      +||+.|++++++||+++    ++++|+||||||||+||||+|||++|+|++|+|++        ++++++||||||||||
T Consensus        86 ~ay~~F~~~~v~pl~~l~~~~~~~~~vlELfHGPT~aFKD~a~q~~~~l~~~~l~~~~~~~~~~~~~~~~il~ATSGDTG  165 (514)
T 1kl7_A           86 RSYSTFRSDEVTPLVQNVTGDKENLHILELFHGPTYAFKDVALQFVGNLFEYFLQRTNANLPEGEKKQITVVGATSGDTG  165 (514)
T ss_dssp             HHTTTCSSTTSSCEECCTTCSSSCEEEEECCCSTTSBTHHHHHHHHHHHHHHHHHHHHTTSCSSSCCCEEEEEECSSSHH
T ss_pred             HHHCCCCCCCCCCCCCCCCCCCCCEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCEEEEEECCCCCH
T ss_conf             99725998766775333557778648998304898772455788899999999986144323456753799982887519


Q ss_pred             HHHHHHHCCCCCCEEEEECCCCCCCHHHHCCCEEECCCCEEEEEECCCHHHHHHHHHHHHCCHHHHCCCCCCCCCCCCHH
Q ss_conf             67999861667855999735776760332131134478708997179658889999997501543135831134556544
Q gi|254780465|r  146 AAAIKAFAGKKRINMYILFPEGRISVVQQKQMTTSEASNINVIAVQSSFDDCQKIVKNLFSDVFFCHSVNLSGINSINWA  225 (469)
Q Consensus       146 sAa~~a~~~~~~i~v~vlyP~g~vS~~Q~~qmtt~~~~Nv~~i~v~G~FDDcq~~Vk~~f~D~~~~~~~~l~s~NSIN~~  225 (469)
                      +||++||++++|++++||||+|+||++||+||||+.++|||+++|+|+|||||++||++|+|++|++++.|+|+|||||+
T Consensus       166 ~Aa~~af~~~~~i~v~vlyP~g~vS~iQ~~Qmtt~~~~Nv~~i~v~G~FDDcQ~~VK~~f~d~~~~~~~~l~s~NSiN~~  245 (514)
T 1kl7_A          166 SAAIYGLRGKKDVSVFILYPTGRISPIQEEQMTTVPDENVQTLSVTGTFDNCQDIVKAIFGDKEFNSKHNVGAVNSINWA  245 (514)
T ss_dssp             HHHHHHHTTCTTEEEEEEEETTSSCHHHHHHHHHCCCTTEEEEEESSCHHHHHHHHHHHHHCSSCC--CCBCCCCSCCHH
T ss_pred             HHHHHHHCCCCCCEEEEECCCCCCCHHHHHHHCCCCCCCEEEEEECCCHHHHHHHHHHHHCCHHHHHHHCCCCCCCHHHH
T ss_conf             99999955899824999616878754368874122799889999547869987999998503434322012556623099


Q ss_pred             HCCCCHHHHHHHHHHHCC--CCCCEEEEEECCCHHHHHHHHHHHHCCCCCCEEEEECCCCCHHHHHHHCCCHHCC-CCCC
Q ss_conf             401105589999987447--7887389963465788788667775089877058723676335677532220102-3455
Q gi|254780465|r  226 RIMAQIVYYFVSSIALGS--PNRNISFSVPTGNFGDIFAGYMAKMMGLPIEKLIIATNENDTLVRMFDMGMYRPE-IVME  302 (469)
Q Consensus       226 Ril~Q~vyYf~a~~~~~~--~~~~i~f~VPtGNfGni~Ag~~Ak~MGLPI~kli~AtN~NdiL~rf~~tG~y~~~-~~~~  302 (469)
                      |||||+|||||||+|+..  .+++++|+||||||||++|||+||+|||||+|||||||+||+|+|||++|+|.++ ++.+
T Consensus       246 Rll~QivyYf~ay~~~~~~~~~~~v~f~VPTGNfGni~Ag~~Ak~MGlPI~kli~AtN~NdiL~rf~~tG~y~~~~~v~~  325 (514)
T 1kl7_A          246 RILAQMTYYFYSFFQATNGKDSKKVKFVVPSGNFGDILAGYFAKKMGLPIEKLAIATNENDILDRFLKSGLYERSDKVAA  325 (514)
T ss_dssp             HHHHHHHHHHHHHHHHHSSSSCCCEEEEEECSSSHHHHHHHHHHHHTCCCCCEEEEECSCCHHHHHHHHSEEECCSSCCC
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCCHHHHHHHHHHHHCCCCCCCEEEECCCCHHHHHHHHCCCCCCCCCCCC
T ss_conf             99887899999999975302587048996357188899999999839980035783377066888974697434764456


Q ss_pred             CCCCCCCCCCHHHHHHHHHHHHC---------CCHHHHHHHHHHHCCCCCCCCCCHHHHHHHCCCCCCCCCHHHHHHHHH
Q ss_conf             65642001340137889998709---------708999999875202651055202211000121342138899999999
Q gi|254780465|r  303 TTSPAMDIQIPSNFERLLFEISG---------RNSLLVKEAFYSLENKKYFRIDSEHLQKMSLSFSAKRASMEDVNSVIK  373 (469)
Q Consensus       303 T~SpsMDI~v~SNfERllf~l~~---------~d~~~v~~~m~~l~~~g~~~i~~~~l~~l~~~f~s~svsDeet~~~Ik  373 (469)
                      |+|||||||+|||||||||+++|         +|+.++++||++|+++|.|+++.+.|+++++.|.|++++|+||+++||
T Consensus       326 T~SPSMDI~vsSNfERLl~~l~~~~~~~~d~~~~~~~v~~~M~~l~~~g~~~l~~~~l~~l~~~F~S~svsDeet~~~Ik  405 (514)
T 1kl7_A          326 TLSPAMDILISSNFERLLWYLAREYLANGDDLKAGEIVNNWFQELKTNGKFQVDKSIIEGASKDFTSERVSNEETSETIK  405 (514)
T ss_dssp             CSCGGGCCSSCTTHHHHHHHHHHHHTSTTCHHHHHHHHHHHHHHHHHHSEEECCHHHHHHHTTTEEEEECCHHHHHHHHH
T ss_pred             CCCCCCCCCCCCCHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCHHHHHCCCCCCCEEEECHHHHHHHHH
T ss_conf             78850201352119999999703311135235559999999999986598103766621200220005667899999999


Q ss_pred             HHHHHC----CCEECCCHHHHHHHHHHHH---HCCCCCEEEEECCCCCCCHHHHHHHHCCC-------CCCCHHHHHHHC
Q ss_conf             999863----9598383399999999987---47998399997188434988899980879-------888988988741
Q gi|254780465|r  374 SVLEKS----NYLVDPHTAVGIHAALACR---KSSSTPMVTLATAHPSKFPDTVKAASGIV-------PDCPISLEQMMR  439 (469)
Q Consensus       374 ~~y~~~----gyiiDPHTAvG~~aa~~~~---~~~~~p~VvLATAHPaKFpe~V~~Aig~~-------~~~P~~L~~l~~  439 (469)
                      ++|+++    ||++|||||||+.|+++++   .+.+.|+|+||||||||||++|++|||..       +++|++|++|++
T Consensus       406 ~vye~~~n~~gYllDPHTAVG~~a~~k~~~~~~~~~~p~VvLATAHPaKFpeaV~~Alg~~~~~~~~~~~lP~~L~~L~~  485 (514)
T 1kl7_A          406 KIYESSVNPKHYILDPHTAVGVCATERLIAKDNDKSIQYISLSTAHPAKFADAVNNALSGFSNYSFEKDVLPEELKKLST  485 (514)
T ss_dssp             HHHHHCCSSTTCCCCHHHHHHHHHHHHHHHHHCCTTSEEEEEECBCGGGGHHHHHHHHTTCSSCCHHHHTSCHHHHSGGG
T ss_pred             HHHHHCCCCCCEEECCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHC
T ss_conf             99986275688487983799999999998743699986899958685666999999857776555556667699998864


Q ss_pred             CCCCEEECCC-CHHHHHHHHHHHHHHHCC
Q ss_conf             7211010689-999999999961155205
Q gi|254780465|r  440 RPENCKVMNK-NIDEIKKFIKKRNMESKI  467 (469)
Q Consensus       440 k~e~~~~l~n-d~~~ik~fI~~k~~~~~~  467 (469)
                      ++|++..++| |+++||+||+++..+-|+
T Consensus       486 k~er~~~l~n~d~e~vk~~I~e~i~~~~~  514 (514)
T 1kl7_A          486 LKKKLKFIERADVELVKNAIEEELAKMKL  514 (514)
T ss_dssp             SCCCCCEECSCCHHHHHHHHHCSCSCC--
T ss_pred             CCHHHHHCCCCCHHHHHHHHHHHHHHHCC
T ss_conf             76032541544799999999999997249



>1vb3_A Threonine synthase; PLP-dependent enzyme, lyase; HET: KPA; 2.20A {Escherichia coli} SCOP: c.79.1.1 Back     alignment and structure
>1e5x_A Threonine synthase; threonine biosynthesis, PLP enzyme, S-adenosyl-methionine, allostery; 2.25A {Arabidopsis thaliana} SCOP: c.79.1.1 PDB: 2c2b_A* 2c2g_A* Back     alignment and structure
>2d1f_A Threonine synthase; amino acid synthesis, pyridoxal-5'-phosphate, PLP, lyase; HET: PLP; 2.50A {Mycobacterium tuberculosis} Back     alignment and structure
>3aey_A Threonine synthase; PLP, pyridoxal phosphate, lyase; 1.92A {Thermus thermophilus} PDB: 1uin_A* 1uim_A* 3aex_A* 1v7c_A Back     alignment and structure
>2zsj_A Threonine synthase; PLP dependent enzyme, lyase; HET: PLP; 1.80A {Aquifex aeolicus} Back     alignment and structure
>2rkb_A Serine dehydratase-like; PLP bound enzyme, enzyme found in human cancer cells, lyase, pyridoxal phosphate; HET: PLP; 2.80A {Homo sapiens} Back     alignment and structure
>1tdj_A Biosynthetic threonine deaminase; allostery, cooperative, tetramer, regulation, pyridoxal phosphate, isoleucine biosynthesis; HET: PLP; 2.80A {Escherichia coli} SCOP: c.79.1.1 d.58.18.2 d.58.18.2 Back     alignment and structure
>1o58_A O-acetylserine sulfhydrylase; TM0665, structural genomics, JCSG, PSI, protein structure initiative, joint center for structural genomics; 1.80A {Thermotoga maritima} SCOP: c.79.1.1 PDB: 3fca_A* Back     alignment and structure
>1jbq_A Cystathionine beta-synthase, serine sulfhydrase; fold type II of PLP enzymes, lyase; HET: HEM PLP; 2.60A {Homo sapiens} SCOP: c.79.1.1 PDB: 1m54_A* Back     alignment and structure
>2egu_A Cysteine synthase; O-acetylserine sulfhydrase, structural genomics, NPPSFA; 1.90A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>1y7l_A O-acetylserine sulfhydrylase, O-acetylserine (thiol)-lyase; X-RAY crystallography, sulfhydrylase; HET: LLP; 1.55A {Haemophilus influenzae} SCOP: c.79.1.1 PDB: 3iqg_X* 3iqh_X* 3iqi_X* 1fcj_A* 1oas_A* 1d6s_A* Back     alignment and structure
>2v03_A Cysteine synthase B; pyridoxal phosphate, cysteine biosynthesis, transferase, enzyme kinetics, X-RAY diffraction; HET: LLP CIT; 1.33A {Escherichia coli} PDB: 2bhs_A* 2bht_A* 2jc3_A* Back     alignment and structure
>1ve1_A O-acetylserine sulfhydrylase; PLP, transferase, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: PLP; 1.45A {Thermus thermophilus} SCOP: c.79.1.1 PDB: 2eco_A* 2ecq_A* 2efy_A* Back     alignment and structure
>2pqm_A Cysteine synthase; OASS, PLP, lyase; HET: PLP; 1.86A {Entamoeba histolytica hm-1} PDB: 3bm5_A* Back     alignment and structure
>1z7w_A Cysteine synthase; transferase; HET: PLP; 2.20A {Arabidopsis thaliana} SCOP: c.79.1.1 PDB: 1z7y_A* 2isq_A* Back     alignment and structure
>3dwg_A Cysteine synthase B; sulfur carrier protein complex, beta-grAsp fold, amino-acid biosynthesis; HET: PLP; 1.53A {Mycobacterium tuberculosis H37RV} PDB: 3fgp_A* 3dki_A* 3dwi_A* Back     alignment and structure
>2q3b_A Cysteine synthase A; pyridoxal-5'-phosphate, sulphur metabolism, cysteine biosynthesis, transferase; HET: LLP; 1.80A {Mycobacterium tuberculosis} PDB: 2q3c_A* 2q3d_A* Back     alignment and structure
>1p5j_A L-serine dehydratase; lyase; HET: PLP; 2.50A {Homo sapiens} SCOP: c.79.1.1 PDB: 1pwh_A* 1pwe_A* Back     alignment and structure
>3iau_A Threonine deaminase; pyridoxal phosphate, amino-acid biosynthesis, defensive protein, jasmonic acid pathway; HET: LLP 15P; 2.35A {Solanum lycopersicum} Back     alignment and structure
>1ve5_A Threonine deaminase; riken structural genomics/proteomics initiative, RSGI, structural genomics, lyase; HET: PLP; 2.15A {Thermus thermophilus HB8} SCOP: c.79.1.1 Back     alignment and structure
>1v71_A Serine racemase, hypothetical protein C320.14 in chromosome III; dimer, PLP, isomerase; HET: PLP; 1.70A {Schizosaccharomyces pombe} SCOP: c.79.1.1 PDB: 1wtc_A* 2zpu_A* 2zr8_A* Back     alignment and structure
>3l6b_A Serine racemase; pyridoxal phosphate, PLP, isomerase; HET: PLP; 1.50A {Homo sapiens} PDB: 3l6r_A* 3hmk_A* 3l6c_A* Back     alignment and structure
>1j0a_A 1-aminocyclopropane-1-carboxylate deaminase; PLP dependent, lyase; HET: PLP; 2.50A {Pyrococcus horikoshii OT3} SCOP: c.79.1.1 PDB: 1j0b_A* Back     alignment and structure
>1tzj_A ACC deaminase, 1-aminocyclopropane-1-carboxylate deaminase; substrate, PLP, crystal, structure, complex, hydrolase; HET: PLP; 1.99A {Pseudomonas SP} SCOP: c.79.1.1 PDB: 1rqx_A* 1tz2_A* 1tyz_A* 1tzk_A* 1tzm_A* Back     alignment and structure
>1f2d_A 1-aminocyclopropane-1-carboxylate deaminase; carbon-carbon lyase, open twisted alpha/beta; HET: PLP; 2.00A {Williopsis saturnus} SCOP: c.79.1.1 PDB: 1j0e_A* 1j0d_A* 1j0c_A* Back     alignment and structure
>2o2e_A Tryptophan synthase beta chain; amino-acid biosynthesis, tryptophan biosynthesis, structural genomics; 2.20A {Mycobacterium tuberculosis} PDB: 2o2j_A Back     alignment and structure
>1v8z_A Tryptophan synthase beta chain 1; beta+alpha, riken structural genomics/proteomics initiative, RSGI, structural genomics, lyase; HET: PLP; 2.21A {Pyrococcus furiosus} SCOP: c.79.1.1 PDB: 1wdw_B* Back     alignment and structure
>1x1q_A Tryptophan synthase beta chain; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.50A {Thermus thermophilus HB8} Back     alignment and structure