254780471

254780471

cytochrome o ubiquinol oxidase subunit IV

GeneID in NCBI database:8209460Locus tag:CLIBASIA_01780
Protein GI in NCBI database:254780471Protein Accession:YP_003064884.1
Gene range:-(393583, 393942)Protein Length:119aa
Gene description:cytochrome o ubiquinol oxidase subunit IV
COG prediction:[C] Heme/copper-type cytochrome/quinol oxidase, subunit 4
KEGG prediction:cyoD; cytochrome o ubiquinol oxidase subunit IV; K02300 cytochrome o ubiquinol oxidase operon protein cyoD
SEED prediction:Cytochrome O ubiquinol oxidase subunit IV (EC 1.10.3.-)
Pathway involved in KEGG:Oxidative phosphorylation [PATH:las00190]
Subsystem involved in SEED:Terminal cytochrome O ubiquinol oxidase
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM3 TM-Helix
TOPPRED3 TM-Helix
HMMTOP3 TM-Helix
MEMSAT3 TM-Helix
MEMSAT_SVM3 TM-Helix
PHOBIUS3 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------12
MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEGMRSIH
cccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHEEEccccHHHHHHHHccc
cccHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHcc
mkydnihnmnmhsygtkkQCLVGFILSLILTIipfgivmkgffldkniMCLTIVLCAIAQIIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNnmmsmegmrsih
MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMsmegmrsih
MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEGMRSIH
*******************CLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNN************
MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEGMRSIH
**************GTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEG*****
iiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooo
xxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooo
iiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEGMRSIH
MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEGMRSIH
MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEGMRSIH

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target119 cytochrome o ubiquinol oxidase subunit IV [Candidatus L
315122073119 cytochrome o ubiquinol oxidase subunit IV [Candidatus L 1 4e-41
158423725132 cytochrome o ubiquinol oxidase subunit IV [Azorhizobium 1 8e-24
33593692135 cytochrome ubiquinol oxidase subunit IV [Bordetella per 1 9e-24
241667024133 cytochrome o ubiquinol oxidase subunit IV [Rhizobium le 1 1e-23
146338788123 cytochrome o ubiquinol oxidase subunit IV [Bradyrhizobi 1 1e-23
27375263126 cytochrome O ubiquinol oxidase subunit IV [Bradyrhizobi 1 2e-23
163853731126 cytochrome o ubiquinol oxidase subunit IV [Methylobacte 1 2e-23
116255239133 putative cytochrome o ubiquinol oxidase protein CyoD [R 1 3e-23
91975078130 cytochrome C oxidase subunit IV [Rhodopseudomonas palus 1 5e-23
86360305133 cytochrome O ubiquinol oxidase, subunit IV protein [Rhi 1 7e-23
>gi|315122073|ref|YP_004062562.1| cytochrome o ubiquinol oxidase subunit IV [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 119 Back     alignment and organism information
 Score =  171 bits (432), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 86/118 (72%), Positives = 101/118 (85%), Gaps = 2/118 (1%)

Query: 4   DNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGF-FLDKNIMCLTIVLCAIAQII 62
           D  HN   HS+GT+++ L+GFILSLILT IPFG+VM+G  FLDKN+  L IVLCAIAQII
Sbjct: 2   DYNHNKRTHSHGTRRESLIGFILSLILTSIPFGMVMQGSSFLDKNMTYLVIVLCAIAQII 61

Query: 63  VHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSM-EGMRSIH 119
           VHLV+FLHM+ KVEDGW++MAM+FTII++AICFVGSMWVMYHLN NMM M E MRSIH
Sbjct: 62  VHLVYFLHMNVKVEDGWNVMAMVFTIIIIAICFVGSMWVMYHLNYNMMPMDESMRSIH 119


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|158423725|ref|YP_001525017.1| cytochrome o ubiquinol oxidase subunit IV [Azorhizobium caulinodans ORS 571] Length = 132 Back     alignment and organism information
>gi|33593692|ref|NP_881336.1| cytochrome ubiquinol oxidase subunit IV [Bordetella pertussis Tohama I] Length = 135 Back     alignment and organism information
>gi|241667024|ref|YP_002985108.1| cytochrome o ubiquinol oxidase subunit IV [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 133 Back     alignment and organism information
>gi|146338788|ref|YP_001203836.1| cytochrome o ubiquinol oxidase subunit IV [Bradyrhizobium sp. ORS278] Length = 123 Back     alignment and organism information
>gi|27375263|ref|NP_766792.1| cytochrome O ubiquinol oxidase subunit IV [Bradyrhizobium japonicum USDA 110] Length = 126 Back     alignment and organism information
>gi|163853731|ref|YP_001641774.1| cytochrome o ubiquinol oxidase subunit IV [Methylobacterium extorquens PA1] Length = 126 Back     alignment and organism information
>gi|116255239|ref|YP_771072.1| putative cytochrome o ubiquinol oxidase protein CyoD [Rhizobium leguminosarum bv. viciae 3841] Length = 133 Back     alignment and organism information
>gi|91975078|ref|YP_567737.1| cytochrome C oxidase subunit IV [Rhodopseudomonas palustris BisB5] Length = 130 Back     alignment and organism information
>gi|86360305|ref|YP_472193.1| cytochrome O ubiquinol oxidase, subunit IV protein [Rhizobium etli CFN 42] Length = 133 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target119 cytochrome o ubiquinol oxidase subunit IV [Candidatus L
PRK10582109 PRK10582, PRK10582, cytochrome o ubiquinol oxidase subu 2e-22
TIGR0284796 TIGR02847, CyoD, cytochrome o ubiquinol oxidase subunit 5e-22
COG3125111 COG3125, CyoD, Heme/copper-type cytochrome/quinol oxida 2e-17
TIGR0290194 TIGR02901, QoxD, cytochrome aa3 quinol oxidase, subunit 0.001
pfam0362683 pfam03626, COX4_pro, Prokaryotic Cytochrome C oxidase s 2e-18
>gnl|CDD|182568 PRK10582, PRK10582, cytochrome o ubiquinol oxidase subunit IV; Provisional Back     alignment and domain information
>gnl|CDD|131894 TIGR02847, CyoD, cytochrome o ubiquinol oxidase subunit IV Back     alignment and domain information
>gnl|CDD|32939 COG3125, CyoD, Heme/copper-type cytochrome/quinol oxidase, subunit 4 [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|131947 TIGR02901, QoxD, cytochrome aa3 quinol oxidase, subunit IV Back     alignment and domain information
>gnl|CDD|146325 pfam03626, COX4_pro, Prokaryotic Cytochrome C oxidase subunit IV Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 119 cytochrome o ubiquinol oxidase subunit IV [Candidatus L
PRK10582109 cytochrome o ubiquinol oxidase subunit IV; Provisional 100.0
TIGR0284799 CyoD cytochrome o ubiquinol oxidase subunit IV; InterPr 100.0
COG3125111 CyoD Heme/copper-type cytochrome/quinol oxidase, subuni 100.0
pfam0362683 COX4_pro Prokaryotic Cytochrome C oxidase subunit IV. C 99.97
TIGR0290195 QoxD cytochrome aa3 quinol oxidase, subunit IV; InterPr 99.91
TIGR02908110 CoxD_Bacillus cytochrome c oxidase, subunit IV; InterPr 99.82
TIGR0222996 caa3_sub_IV caa(3)-type oxidase, subunit IV; InterPro: 91.43
>PRK10582 cytochrome o ubiquinol oxidase subunit IV; Provisional Back     alignment and domain information
>TIGR02847 CyoD cytochrome o ubiquinol oxidase subunit IV; InterPro: IPR014210 This entry represents subunit 4 (CyoD) of cytochrome o terminal oxidase complex, which is a component of the aerobic respiratory chain that reacts with oxygen, reducing it to water with the concomitant transport of 4 protons across the membrane Back     alignment and domain information
>COG3125 CyoD Heme/copper-type cytochrome/quinol oxidase, subunit 4 [Energy production and conversion] Back     alignment and domain information
>pfam03626 COX4_pro Prokaryotic Cytochrome C oxidase subunit IV Back     alignment and domain information
>TIGR02901 QoxD cytochrome aa3 quinol oxidase, subunit IV; InterPro: IPR014250 This entry represents subunit IV of the aa3-type quinone oxidase (QoxD), one of several bacterial terminal oxidases Back     alignment and domain information
>TIGR02908 CoxD_Bacillus cytochrome c oxidase, subunit IV; InterPro: IPR014257 This entry represents a small clade of cytochrome oxidase subunit IV sequences found in the Bacillaceae Back     alignment and domain information
>TIGR02229 caa3_sub_IV caa(3)-type oxidase, subunit IV; InterPro: IPR011743 This entry represents a small set of proteins with weak similarity to the sequences in Pfam family IPR005171 from INTERPRO, which describes the cytochrome C oxidase subunit IV Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00