254780472

254780472

cytochrome o ubiquinol oxidase subunit III

GeneID in NCBI database:8209461Locus tag:CLIBASIA_01785
Protein GI in NCBI database:254780472Protein Accession:YP_003064885.1
Gene range:-(393968, 394600)Protein Length:210aa
Gene description:cytochrome o ubiquinol oxidase subunit III
COG prediction:[C] Heme/copper-type cytochrome/quinol oxidase, subunit 3
KEGG prediction:cyoC; cytochrome o ubiquinol oxidase subunit III; K02299 cytochrome o ubiquinol oxidase subunit III [EC:1.10.3.-]
SEED prediction:Cytochrome O ubiquinol oxidase subunit III (EC 1.10.3.-)
Pathway involved in KEGG:Oxidative phosphorylation [PATH:las00190]
Subsystem involved in SEED:Terminal cytochrome O ubiquinol oxidase
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM5 TM-Helix
TOPPRED5 TM-Helix
HMMTOP5 TM-Helix
MEMSAT5 TM-Helix
MEMSAT_SVM5 TM-Helix
PHOBIUS5 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210
MSRQKIGKSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV
cccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
ccccccccEHHHHHHHccccccccccccccccccEEEEEEcEEccccEEHHHcccccccccccccccccccccccccccEcccccccccccHHHHHHccHHHHHHHHHHHHHHcccEEEHHHHHHHHHHcccccEEcccccccEEEEccccccccEEEccHHHHHHHHHHHHHHccccccccccHccccccccHHHHHHHEHHEHHHccc
msrqkigkspnfslfyvkdkkescvdhdgtYLGFWIYLMSDCLMFAVFFVTYAVLgknyaagpapidvfdiSGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV
msrqkigkspnfslFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV
MSRQKIGKSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVlllsslscsfamlasaTKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV
**************************HDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV
MSRQKIGKSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV
*****IGKSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSRQKIGKSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV
MSRQKIGKSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV
MSRQKIGKSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target210 cytochrome o ubiquinol oxidase subunit III [Candidatus
315122072209 cytochrome o ubiquinol oxidase subunit III [Candidatus 1 2e-87
150376511210 cytochrome o ubiquinol oxidase subunit III [Sinorhizobi 1 5e-63
220924641222 cytochrome o ubiquinol oxidase subunit III [Methylobact 1 5e-62
307309511210 cytochrome o ubiquinol oxidase, subunit III [Sinorhizob 1 5e-61
16265065210 putative cytochrome o ubiquinol oxidase chain III prote 1 8e-61
319783411208 cytochrome o ubiquinol oxidase subunit III [Mesorhizobi 1 8e-61
227820111210 cytochrome O ubiquinol oxidase subunit III [Sinorhizobi 1 1e-60
86747366209 cytochrome c oxidase, subunit III [Rhodopseudomonas pal 1 2e-60
239817018221 cytochrome o ubiquinol oxidase subunit III [Variovorax 1 2e-60
15887495208 cytochrome o ubiquinol oxidase subunit III [Agrobacteri 1 3e-60
>gi|315122072|ref|YP_004062561.1| cytochrome o ubiquinol oxidase subunit III [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 209 Back     alignment and organism information
 Score =  325 bits (833), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 172/211 (81%), Positives = 190/211 (90%), Gaps = 3/211 (1%)

Query: 1   MSRQKIGKSPNFSLFYVKDKKESCVDH-DGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY 59
           MS++KIGKSPN  +FY+K++K SC+DH DGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY
Sbjct: 1   MSKRKIGKSPNTPVFYLKEEKGSCIDHHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY 60

Query: 60  AAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFI 119
           AAGPAPID+F I  I VSTIVLLLSSLS SFAMLAS   +  +KTV WLLVTAFFG+IFI
Sbjct: 61  AAGPAPIDIFGIRDILVSTIVLLLSSLSYSFAMLASEDVK--NKTVFWLLVTAFFGIIFI 118

Query: 120 IMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGN 179
           +MEI+EFAHLIS  A PQRSAFLSSFF+LV LHGLHVFFGLIW+F+LVIQILKKGLI  N
Sbjct: 119 MMEIHEFAHLISKGATPQRSAFLSSFFSLVALHGLHVFFGLIWIFILVIQILKKGLIPDN 178

Query: 180 QRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           +RRL+CLSMFWHFLDLIWICVFSFVYLMGVV
Sbjct: 179 RRRLMCLSMFWHFLDLIWICVFSFVYLMGVV 209


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|150376511|ref|YP_001313107.1| cytochrome o ubiquinol oxidase subunit III [Sinorhizobium medicae WSM419] Length = 210 Back     alignment and organism information
>gi|220924641|ref|YP_002499943.1| cytochrome o ubiquinol oxidase subunit III [Methylobacterium nodulans ORS 2060] Length = 222 Back     alignment and organism information
>gi|307309511|ref|ZP_07589167.1| cytochrome o ubiquinol oxidase, subunit III [Sinorhizobium meliloti BL225C] Length = 210 Back     alignment and organism information
>gi|16265065|ref|NP_437857.1| putative cytochrome o ubiquinol oxidase chain III protein [Sinorhizobium meliloti 1021] Length = 210 Back     alignment and organism information
>gi|319783411|ref|YP_004142887.1| cytochrome o ubiquinol oxidase subunit III [Mesorhizobium ciceri biovar biserrulae WSM1271] Length = 208 Back     alignment and organism information
>gi|227820111|ref|YP_002824082.1| cytochrome O ubiquinol oxidase subunit III [Sinorhizobium fredii NGR234] Length = 210 Back     alignment and organism information
>gi|86747366|ref|YP_483862.1| cytochrome c oxidase, subunit III [Rhodopseudomonas palustris HaA2] Length = 209 Back     alignment and organism information
>gi|239817018|ref|YP_002945928.1| cytochrome o ubiquinol oxidase subunit III [Variovorax paradoxus S110] Length = 221 Back     alignment and organism information
>gi|15887495|ref|NP_353176.1| cytochrome o ubiquinol oxidase subunit III [Agrobacterium tumefaciens str. C58] Length = 208 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target210 cytochrome o ubiquinol oxidase subunit III [Candidatus
TIGR02842180 TIGR02842, CyoC, cytochrome o ubiquinol oxidase, subuni 2e-62
PRK10663204 PRK10663, PRK10663, cytochrome o ubiquinol oxidase subu 1e-54
COG1845209 COG1845, CyoC, Heme/copper-type cytochrome/quinol oxida 9e-41
TIGR02897190 TIGR02897, QoxC, cytochrome aa3 quinol oxidase, subunit 2e-33
cd00386183 cd00386, Heme_Cu_Oxidase_III_like, Heme-copper oxidase 2e-27
cd02862186 cd02862, NorE_like, NorE_like subfamily of heme-copper 3e-21
cd02864202 cd02864, Heme_Cu_Oxidase_III_1, Heme-copper oxidase sub 1e-16
cd01665243 cd01665, Cyt_c_Oxidase_III, Cytochrome c oxidase subuni 8e-15
MTH00141259 MTH00141, COX3, cytochrome c oxidase subunit III; Provi 2e-11
cd02865184 cd02865, Heme_Cu_Oxidase_III_2, Heme-copper oxidase sub 3e-11
pfam00510258 pfam00510, COX3, Cytochrome c oxidase subunit III 2e-10
KOG4664261 KOG4664, KOG4664, KOG4664, Cytochrome oxidase subunit I 1e-08
MTH00024261 MTH00024, COX3, cytochrome c oxidase subunit III; Valid 8e-08
MTH00189260 MTH00189, COX3, cytochrome c oxidase subunit III; Provi 8e-08
PLN02194265 PLN02194, PLN02194, cytochrome-c oxidase 3e-07
MTH00219262 MTH00219, COX3, cytochrome c oxidase subunit III; Provi 5e-07
MTH00049215 MTH00049, COX3, cytochrome c oxidase subunit III; Valid 2e-06
cd02863186 cd02863, Ubiquinol_oxidase_III, Ubiquinol oxidase subun 6e-54
MTH00028297 MTH00028, COX3, cytochrome c oxidase subunit III; Provi 3e-09
MTH00083256 MTH00083, COX3, cytochrome c oxidase subunit III; Provi 1e-07
MTH00039260 MTH00039, COX3, cytochrome c oxidase subunit III; Valid 1e-06
MTH00099261 MTH00099, COX3, cytochrome c oxidase subunit III; Valid 5e-06
MTH00155255 MTH00155, COX3, cytochrome c oxidase subunit III; Provi 3e-09
MTH00009259 MTH00009, COX3, cytochrome c oxidase subunit III; Valid 3e-07
MTH00052262 MTH00052, COX3, cytochrome c oxidase subunit III; Provi 1e-06
MTH00075261 MTH00075, COX3, cytochrome c oxidase subunit III; Provi 2e-06
MTH00118261 MTH00118, COX3, cytochrome c oxidase subunit III; Provi 5e-06
MTH00130261 MTH00130, COX3, cytochrome c oxidase subunit III; Provi 7e-06
>gnl|CDD|131889 TIGR02842, CyoC, cytochrome o ubiquinol oxidase, subunit III Back     alignment and domain information
>gnl|CDD|182628 PRK10663, PRK10663, cytochrome o ubiquinol oxidase subunit III; Provisional Back     alignment and domain information
>gnl|CDD|32030 COG1845, CyoC, Heme/copper-type cytochrome/quinol oxidase, subunit 3 [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|131943 TIGR02897, QoxC, cytochrome aa3 quinol oxidase, subunit III Back     alignment and domain information
>gnl|CDD|29484 cd00386, Heme_Cu_Oxidase_III_like, Heme-copper oxidase subunit III Back     alignment and domain information
>gnl|CDD|29486 cd02862, NorE_like, NorE_like subfamily of heme-copper oxidase subunit III Back     alignment and domain information
>gnl|CDD|29488 cd02864, Heme_Cu_Oxidase_III_1, Heme-copper oxidase subunit III subfamily Back     alignment and domain information
>gnl|CDD|29485 cd01665, Cyt_c_Oxidase_III, Cytochrome c oxidase subunit III Back     alignment and domain information
>gnl|CDD|177199 MTH00141, COX3, cytochrome c oxidase subunit III; Provisional Back     alignment and domain information
>gnl|CDD|29489 cd02865, Heme_Cu_Oxidase_III_2, Heme-copper oxidase subunit III subfamily Back     alignment and domain information
>gnl|CDD|109561 pfam00510, COX3, Cytochrome c oxidase subunit III Back     alignment and domain information
>gnl|CDD|39863 KOG4664, KOG4664, KOG4664, Cytochrome oxidase subunit III and related proteins [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|164597 MTH00024, COX3, cytochrome c oxidase subunit III; Validated Back     alignment and domain information
>gnl|CDD|177238 MTH00189, COX3, cytochrome c oxidase subunit III; Provisional Back     alignment and domain information
>gnl|CDD|177845 PLN02194, PLN02194, cytochrome-c oxidase Back     alignment and domain information
>gnl|CDD|177259 MTH00219, COX3, cytochrome c oxidase subunit III; Provisional Back     alignment and domain information
>gnl|CDD|177124 MTH00049, COX3, cytochrome c oxidase subunit III; Validated Back     alignment and domain information
>gnl|CDD|29487 cd02863, Ubiquinol_oxidase_III, Ubiquinol oxidase subunit III subfamily Back     alignment and domain information
>gnl|CDD|177107 MTH00028, COX3, cytochrome c oxidase subunit III; Provisional Back     alignment and domain information
>gnl|CDD|177150 MTH00083, COX3, cytochrome c oxidase subunit III; Provisional Back     alignment and domain information
>gnl|CDD|177114 MTH00039, COX3, cytochrome c oxidase subunit III; Validated Back     alignment and domain information
>gnl|CDD|177161 MTH00099, COX3, cytochrome c oxidase subunit III; Validated Back     alignment and domain information
>gnl|CDD|177212 MTH00155, COX3, cytochrome c oxidase subunit III; Provisional Back     alignment and domain information
>gnl|CDD|177101 MTH00009, COX3, cytochrome c oxidase subunit III; Validated Back     alignment and domain information
>gnl|CDD|164623 MTH00052, COX3, cytochrome c oxidase subunit III; Provisional Back     alignment and domain information
>gnl|CDD|177146 MTH00075, COX3, cytochrome c oxidase subunit III; Provisional Back     alignment and domain information
>gnl|CDD|177179 MTH00118, COX3, cytochrome c oxidase subunit III; Provisional Back     alignment and domain information
>gnl|CDD|177188 MTH00130, COX3, cytochrome c oxidase subunit III; Provisional Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 210 cytochrome o ubiquinol oxidase subunit III [Candidatus
PRK10663204 cytochrome o ubiquinol oxidase subunit III; Provisional 100.0
COG1845209 CyoC Heme/copper-type cytochrome/quinol oxidase, subuni 100.0
cd02863186 Ubiquinol_oxidase_III Ubiquinol oxidase subunit III sub 100.0
cd02862186 NorE_like NorE_like subfamily of heme-copper oxidase su 100.0
MTH00130261 COX3 cytochrome c oxidase subunit III; Provisional 100.0
MTH00099261 COX3 cytochrome c oxidase subunit III; Validated 100.0
MTH00118261 COX3 cytochrome c oxidase subunit III; Provisional 100.0
MTH00075261 COX3 cytochrome c oxidase subunit III; Provisional 100.0
MTH00189260 COX3 cytochrome c oxidase subunit III; Provisional 100.0
MTH00155261 COX3 cytochrome c oxidase subunit III; Provisional 100.0
pfam00510258 COX3 Cytochrome c oxidase subunit III. 100.0
cd02865184 Heme_Cu_Oxidase_III_2 Heme-copper oxidase subunit III s 100.0
MTH00009259 COX3 cytochrome c oxidase subunit III; Validated 100.0
MTH00039260 COX3 cytochrome c oxidase subunit III; Validated 100.0
MTH00052262 COX3 cytochrome c oxidase subunit III; Provisional 100.0
cd01665243 Cyt_c_Oxidase_III Cytochrome c oxidase subunit III. Cyt 100.0
MTH00024261 COX3 cytochrome c oxidase subunit III; Validated 100.0
MTH00141259 COX3 cytochrome c oxidase subunit III; Provisional 100.0
cd02864202 Heme_Cu_Oxidase_III_1 Heme-copper oxidase subunit III s 100.0
MTH00083256 COX3 cytochrome c oxidase subunit III; Provisional 100.0
cd00386183 Heme_Cu_Oxidase_III_like Heme-copper oxidase subunit II 100.0
MTH00028297 COX3 cytochrome c oxidase subunit III; Provisional 100.0
TIGR02842180 CyoC cytochrome o ubiquinol oxidase, subunit III; Inter 100.0
MTH00049215 COX3 cytochrome c oxidase subunit III; Validated 100.0
TIGR02897190 QoxC cytochrome aa3 quinol oxidase, subunit III; InterP 100.0
KOG4664261 consensus 100.0
COG2322177 Predicted membrane protein [Function unknown] 95.42
pfam04238133 DUF420 Protein of unknown function (DUF420). Predicted 93.47
>PRK10663 cytochrome o ubiquinol oxidase subunit III; Provisional Back     alignment and domain information
>COG1845 CyoC Heme/copper-type cytochrome/quinol oxidase, subunit 3 [Energy production and conversion] Back     alignment and domain information
>cd02863 Ubiquinol_oxidase_III Ubiquinol oxidase subunit III subfamily Back     alignment and domain information
>cd02862 NorE_like NorE_like subfamily of heme-copper oxidase subunit III Back     alignment and domain information
>MTH00130 COX3 cytochrome c oxidase subunit III; Provisional Back     alignment and domain information
>MTH00099 COX3 cytochrome c oxidase subunit III; Validated Back     alignment and domain information
>MTH00118 COX3 cytochrome c oxidase subunit III; Provisional Back     alignment and domain information
>MTH00075 COX3 cytochrome c oxidase subunit III; Provisional Back     alignment and domain information
>MTH00189 COX3 cytochrome c oxidase subunit III; Provisional Back     alignment and domain information
>MTH00155 COX3 cytochrome c oxidase subunit III; Provisional Back     alignment and domain information
>pfam00510 COX3 Cytochrome c oxidase subunit III Back     alignment and domain information
>cd02865 Heme_Cu_Oxidase_III_2 Heme-copper oxidase subunit III subfamily Back     alignment and domain information
>MTH00009 COX3 cytochrome c oxidase subunit III; Validated Back     alignment and domain information
>MTH00039 COX3 cytochrome c oxidase subunit III; Validated Back     alignment and domain information
>MTH00052 COX3 cytochrome c oxidase subunit III; Provisional Back     alignment and domain information
>cd01665 Cyt_c_Oxidase_III Cytochrome c oxidase subunit III Back     alignment and domain information
>MTH00024 COX3 cytochrome c oxidase subunit III; Validated Back     alignment and domain information
>MTH00141 COX3 cytochrome c oxidase subunit III; Provisional Back     alignment and domain information
>cd02864 Heme_Cu_Oxidase_III_1 Heme-copper oxidase subunit III subfamily Back     alignment and domain information
>MTH00083 COX3 cytochrome c oxidase subunit III; Provisional Back     alignment and domain information
>cd00386 Heme_Cu_Oxidase_III_like Heme-copper oxidase subunit III Back     alignment and domain information
>MTH00028 COX3 cytochrome c oxidase subunit III; Provisional Back     alignment and domain information
>TIGR02842 CyoC cytochrome o ubiquinol oxidase, subunit III; InterPro: IPR014206 This entry represents subunit 3 (CyoC) of the cytochrome o terminal oxidase complex, which is a component of the aerobic respiratory chain that reacts with oxygen, reducing it to water with the concomitant transport of 4 protons across the membrane Back     alignment and domain information
>MTH00049 COX3 cytochrome c oxidase subunit III; Validated Back     alignment and domain information
>TIGR02897 QoxC cytochrome aa3 quinol oxidase, subunit III; InterPro: IPR014246 This entry encodes subunit III of the aa3-type quinone oxidase (QoxC), one of several bacterial terminal oxidases Back     alignment and domain information
>KOG4664 consensus Back     alignment and domain information
>COG2322 Predicted membrane protein [Function unknown] Back     alignment and domain information
>pfam04238 DUF420 Protein of unknown function (DUF420) Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target210 cytochrome o ubiquinol oxidase subunit III [Candidatus
1fft_C204 The Structure Of Ubiquinol Oxidase From Escherichia 5e-31
1v54_C261 Bovine Heart Cytochrome C Oxidase At The Fully Oxid 4e-29
1occ_C261 Structure Of Bovine Heart Cytochrome C Oxidase At T 7e-29
1qle_C273 Cryo-Structure Of The Paracoccus Denitrificans Four 6e-28
2dys_C261 Bovine Heart Cytochrome C Oxidase Modified By Dccd 7e-28
1m56_C266 Structure Of Cytochrome C Oxidase From Rhodobactor 2e-23
gi|11514519|pdb|1FFT|C Chain C, The Structure Of Ubiquinol Oxidase From Escherichia Coli Length = 204 Back     alignment and structure
 Score =  138 bits (347), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 100/204 (49%), Positives = 132/204 (64%), Gaps = 2/204 (0%)

Query: 8   KSPNFSLFYVKDKKESCVDHDGTY-LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPI 66
            +   +       +    D  GT   GFWIYLMSDC++F++ F TYAVL    A GP   
Sbjct: 2   ATDTLTHATAHAHEHGHHDAGGTKIFGFWIYLMSDCILFSILFATYAVLVNGTAGGPTGK 61

Query: 67  DVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEF 126
           D+F++  + V T +LL SS++   A +A   K    + +SWL +T  FG  FI MEIYEF
Sbjct: 62  DIFELPFVLVETFLLLFSSITYGMAAIA-MYKNNKSQVISWLALTWLFGAGFIGMEIYEF 120

Query: 127 AHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICL 186
            HLI     P RS FLS+FFALVG HGLHV  GLIW+ VL++QI ++GL S N+ R++CL
Sbjct: 121 HHLIVNGMGPDRSGFLSAFFALVGTHGLHVTSGLIWMAVLMVQIARRGLTSTNRTRIMCL 180

Query: 187 SMFWHFLDLIWICVFSFVYLMGVV 210
           S+FWHFLD++WICVF+ VYLMG +
Sbjct: 181 SLFWHFLDVVWICVFTVVYLMGAM 204


gi|40889825|pdb|1V54|C Chain C, Bovine Heart Cytochrome C Oxidase At The Fully Oxidized State Length = 261 Back     alignment and structure
>gi|1942988|pdb|1OCC|C Chain C, Structure Of Bovine Heart Cytochrome C Oxidase At The Fully Oxidized State Length = 261 Back     alignment and structure
>gi|6730478|pdb|1QLE|C Chain C, Cryo-Structure Of The Paracoccus Denitrificans Four-Subunit Cytochrome C Oxidase In The Completely Oxidized State Complexed With An Antibody Fv Fragment Length = 273 Back     alignment and structure
>gi|145579237|pdb|2DYS|C Chain C, Bovine Heart Cytochrome C Oxidase Modified By Dccd Length = 261 Back     alignment and structure
gi|23200456|pdb|1M56|C Chain C, Structure Of Cytochrome C Oxidase From Rhodobactor Sphaeroides (Wild Type) Length = 266 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target210 cytochrome o ubiquinol oxidase subunit III [Candidatus
1fft_C204 Ubiquinol oxidase; electron transport, cytochrome oxida 7e-30
1qle_C273 Cytochrome C oxidase polypeptide III; oxidoreductase/im 2e-21
1m56_C266 Cytochrome C oxidase; membrane protein, oxidoreductase; 9e-21
1v54_C261 Cytochrome C oxidase polypeptide III; oxidoreductase; H 2e-17
>1fft_C Ubiquinol oxidase; electron transport, cytochrome oxidase, membrane protein, oxidoreductase; HET: HEM HEO; 3.50A {Escherichia coli} SCOP: f.25.1.1 Length = 204 Back     alignment and structure
 Score =  125 bits (315), Expect = 7e-30
 Identities = 96/184 (52%), Positives = 125/184 (67%), Gaps = 1/184 (0%)

Query: 27  HDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSL 86
                 GFWIYLMSDC++F++ F TYAVL    A GP   D+F++  + V T +LL SS+
Sbjct: 22  GGTKIFGFWIYLMSDCILFSILFATYAVLVNGTAGGPTGKDIFELPFVLVETFLLLFSSI 81

Query: 87  SCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFF 146
           +   A +A        + +SWL +T  FG  FI MEIYEF HLI     P RS FLS+FF
Sbjct: 82  TYGMAAIAMYKNN-KSQVISWLALTWLFGAGFIGMEIYEFHHLIVNGMGPDRSGFLSAFF 140

Query: 147 ALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYL 206
           ALVG HGLHV  GLIW+ VL++QI ++GL S N+ R++CLS+FWHFLD++WICVF+ VYL
Sbjct: 141 ALVGTHGLHVTSGLIWMAVLMVQIARRGLTSTNRTRIMCLSLFWHFLDVVWICVFTVVYL 200

Query: 207 MGVV 210
           MG +
Sbjct: 201 MGAM 204


>1qle_C Cytochrome C oxidase polypeptide III; oxidoreductase/immune system, complex (oxidoreductase/antibody), electron transport; HET: HEA PC1; 3.0A {Paracoccus denitrificans} SCOP: f.25.1.1 Length = 273 Back     alignment and structure
>1m56_C Cytochrome C oxidase; membrane protein, oxidoreductase; HET: HEA PEH; 2.30A {Rhodobacter sphaeroides} SCOP: f.25.1.1 PDB: 1m57_C* Length = 266 Back     alignment and structure
>1v54_C Cytochrome C oxidase polypeptide III; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: f.25.1.1 PDB: 1v55_C* 2dyr_C* 2eij_C* 2eik_C* 2eil_C* 2eim_C* 2ein_C* 2zxw_C* 2occ_C* 1oco_C* 1occ_C* 1ocz_C* 1ocr_C* 2dys_C* Length = 261 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target210 cytochrome o ubiquinol oxidase subunit III [Candidatus
1fft_C204 Ubiquinol oxidase; electron transport, cytochrome oxida 100.0
1v54_C261 Cytochrome C oxidase polypeptide III; oxidoreductase; H 100.0
1m56_C266 Cytochrome C oxidase; membrane protein, oxidoreductase; 100.0
1qle_C273 Cytochrome C oxidase polypeptide III; oxidoreductase/im 100.0
>1fft_C Ubiquinol oxidase; electron transport, cytochrome oxidase, membrane protein, oxidoreductase; HET: HEM HEO; 3.50A {Escherichia coli} SCOP: f.25.1.1 Back     alignment and structure
Probab=100.00  E-value=0  Score=343.74  Aligned_cols=192  Identities=50%  Similarity=0.935  Sum_probs=176.7

Q ss_pred             EECCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHCCCCHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             53077657202566026888999999999999999999942788888866000024035789999999999999999999
Q gi|254780472|r   16 YVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLAS   95 (210)
Q Consensus        16 ~~~~~~~~~~~~~~~~~G~w~Fi~SE~~~Fa~lf~~y~~~~~~~~~~~~~~~~~~~~~~~~nT~iLl~SS~~~~~a~~a~   95 (210)
                      ++++++|++ +.+++++|||+||+||+|+|++++++|+++|...+.+|++.+.++++.+.+||.+|++||+++++|+++.
T Consensus        12 ~~~~~~~~~-~~~~~~~Gmwlfi~SE~m~F~~lf~ay~~~~~~~~~~~~~~~~~~~~~~~~~T~lLl~SS~~~~~a~~a~   90 (204)
T 1fft_C           12 HAHEHGHHD-AGGTKIFGFWIYLMSDCILFSILFATYAVLVNGTAGGPTGKDIFELPFVLVETFLLLFSSITYGMAAIAM   90 (204)
T ss_dssp             -------CC-STTHHHHHHHTTHHHHTTHHHHHHHHHTTTTTTCCCSCCCCCCTTHHHHHHHHHHHGGGTTTTTSGGGTT
T ss_pred             CCCCCCCCC-CCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHCCCHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             666668888-8765058999999999999999999999999676889861020131089999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             63333688776558999999999889999875543111001478601679999899799999999999999999970799
Q gi|254780472|r   96 ATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGL  175 (210)
Q Consensus        96 ~~~~~~~~~~~~L~~t~~lG~~Fl~~Q~~E~~~l~~~g~~~~~~~~~S~fy~lTG~H~lHV~~Gli~L~~~~~~~~~~~~  175 (210)
                      +++ ++++.+.++..|+++|.+|++.|.+||.++.+.|+++++|+|+|+||++||+|++||++|+++|.++.+|.+++++
T Consensus        91 ~~~-~~~~~~~~L~~t~~lG~~Fl~~q~~e~~~l~~~g~~~~~~~~~s~fy~lTGlH~lHVi~Gli~L~~~~~r~~~~~~  169 (204)
T 1fft_C           91 YKN-NKSQVISWLALTWLFGAGFIGMEIYEFHHLIVNGMGPDRSGFLSAFFALVGTHGLHVTSGLIWMAVLMVQIARRGL  169 (204)
T ss_dssp             TTC-CGGGGTHHHHHHHHHHHHHHHHHHHHHHHHHHSSCSCCCCSTTTHHHHHHHHHTTHHHHTTHHHHHHHHHHHHTCC
T ss_pred             HCC-CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             847-8888999999999999999888998899999746776565078999999999999999999999999999983699


Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             8304267999989999999999999999999820
Q gi|254780472|r  176 ISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGV  209 (210)
Q Consensus       176 ~~~~~~~~~~~~~YWHFVdivWi~lf~llYl~g~  209 (210)
                      +++++.++|.+++||||||+||+++|+++|++|.
T Consensus       170 ~~~~~~~v~~~~~YWHFvD~vWl~lf~~lYl~G~  203 (204)
T 1fft_C          170 TSTNRTRIMCLSLFWHFLDVVWICVFTVVYLMGA  203 (204)
T ss_dssp             CTTCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCC
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             9531026899999999999999999999999727



>1v54_C Cytochrome C oxidase polypeptide III; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: f.25.1.1 PDB: 1v55_C* 2dyr_C* 2eij_C* 2eik_C* 2eil_C* 2eim_C* 2ein_C* 2zxw_C* 3abk_C* 3abl_C* 3abm_C* 3ag1_C* 3ag2_C* 3ag3_C* 3ag4_C* 2occ_C* 1oco_C* 1occ_C* 1ocz_C* 1ocr_C* ... Back     alignment and structure
>1m56_C Cytochrome C oxidase; membrane protein, oxidoreductase; HET: HEA PEH; 2.30A {Rhodobacter sphaeroides} SCOP: f.25.1.1 PDB: 1m57_C* Back     alignment and structure
>1qle_C Cytochrome C oxidase polypeptide III; oxidoreductase/immune system, complex (oxidoreductase/antibody), electron transport; HET: HEA PC1; 3.0A {Paracoccus denitrificans} SCOP: f.25.1.1 Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 210 cytochrome o ubiquinol oxidase subunit III [Candidatus
d1fftc_185 f.25.1.1 (C:) Cytochrome O ubiquinol oxidase, subunit I 5e-25
d1v54c_259 f.25.1.1 (C:) Mitochondrial cytochrome c oxidase, subun 3e-18
d1m56c_265 f.25.1.1 (C:) Bacterial aa3 type cytochrome c oxidase s 5e-17
>d1fftc_ f.25.1.1 (C:) Cytochrome O ubiquinol oxidase, subunit III {Escherichia coli [TaxId: 562]} Length = 185 Back     information, alignment and structure

class: Membrane and cell surface proteins and peptides
fold: Cytochrome c oxidase subunit III-like
superfamily: Cytochrome c oxidase subunit III-like
family: Cytochrome c oxidase subunit III-like
domain: Cytochrome O ubiquinol oxidase, subunit III
species: Escherichia coli [TaxId: 562]
 Score =  108 bits (270), Expect = 5e-25
 Identities = 97/182 (53%), Positives = 125/182 (68%), Gaps = 1/182 (0%)

Query: 27  HDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSL 86
                 GFWIYLMSDC++F++ F TYAVL    A GP   D+F++  + V T +LL SS+
Sbjct: 4   GGTKIFGFWIYLMSDCILFSILFATYAVLVNGTAGGPTGKDIFELPFVLVETFLLLFSSI 63

Query: 87  SCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFF 146
           +   A +A   K    + +SWL +T  FG  FI MEIYEF HLI     P RS FLS+FF
Sbjct: 64  TYGMAAIA-MYKNNKSQVISWLALTWLFGAGFIGMEIYEFHHLIVNGMGPDRSGFLSAFF 122

Query: 147 ALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYL 206
           ALVG HGLHV  GLIW+ VL++QI ++GL S N+ R++CLS+FWHFLD++WICVF+ VYL
Sbjct: 123 ALVGTHGLHVTSGLIWMAVLMVQIARRGLTSTNRTRIMCLSLFWHFLDVVWICVFTVVYL 182

Query: 207 MG 208
           MG
Sbjct: 183 MG 184


>d1v54c_ f.25.1.1 (C:) Mitochondrial cytochrome c oxidase, subunit III {Cow (Bos taurus) [TaxId: 9913]} Length = 259 Back     information, alignment and structure
>d1m56c_ f.25.1.1 (C:) Bacterial aa3 type cytochrome c oxidase subunit III {Rhodobacter sphaeroides [TaxId: 1063]} Length = 265 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target210 cytochrome o ubiquinol oxidase subunit III [Candidatus
d1fftc_185 Cytochrome O ubiquinol oxidase, subunit III {Escherichi 100.0
d1m56c_265 Bacterial aa3 type cytochrome c oxidase subunit III {Rh 100.0
d1v54c_259 Mitochondrial cytochrome c oxidase, subunit III {Cow (B 100.0
>d1fftc_ f.25.1.1 (C:) Cytochrome O ubiquinol oxidase, subunit III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Membrane and cell surface proteins and peptides
fold: Cytochrome c oxidase subunit III-like
superfamily: Cytochrome c oxidase subunit III-like
family: Cytochrome c oxidase subunit III-like
domain: Cytochrome O ubiquinol oxidase, subunit III
species: Escherichia coli [TaxId: 562]
Probab=100.00  E-value=0  Score=337.55  Aligned_cols=182  Identities=53%  Similarity=0.990  Sum_probs=172.0

Q ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             25660268889999999999999999999427888888660000240357899999999999999999996333368877
Q gi|254780472|r   26 DHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTV  105 (210)
Q Consensus        26 ~~~~~~~G~w~Fi~SE~~~Fa~lf~~y~~~~~~~~~~~~~~~~~~~~~~~~nT~iLl~SS~~~~~a~~a~~~~~~~~~~~  105 (210)
                      +++++++|||+||+||+|+|+++|++|++.|.+.+.+|++.+..+++.+++||.+|++||+++++|+++.++ +++++++
T Consensus         3 ~~~~~~~G~w~Fi~se~~~F~~lf~~y~~~~~~~~~~~~~~~~~~~~~~~~nT~vLl~SS~~~~~a~~~~~~-~~~~~~~   81 (185)
T d1fftc_           3 AGGTKIFGFWIYLMSDCILFSILFATYAVLVNGTAGGPTGKDIFELPFVLVETFLLLFSSITYGMAAIAMYK-NNKSQVI   81 (185)
T ss_dssp             STTHHHHHHHTTHHHHTTHHHHHHHHHTTTTTTCCCSCCCCCCTTHHHHHHHHHHHGGGTTTTTSGGGTTTT-CCGGGGT
T ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHH
T ss_conf             998762658999999999999999999999967777876410124239999999999999999999999998-7889999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHH
Q ss_conf             65589999999998899998755431110014786016799998997999999999999999999707998304267999
Q gi|254780472|r  106 SWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLIC  185 (210)
Q Consensus       106 ~~L~~t~~lG~~Fl~~Q~~E~~~l~~~g~~~~~~~~~S~fy~lTG~H~lHV~~Gli~L~~~~~~~~~~~~~~~~~~~~~~  185 (210)
                      .++..|+++|.+|+..|..||++++++|.++++|+|+|+||++||+|++||++|+++|.++.+|..+++.+++++.++|.
T Consensus        82 ~~L~~t~~lG~~Fl~~q~~e~~~l~~~g~~~~~~~~~s~fy~lTGlH~lHV~~Gli~L~~~~~r~~~~~~~~~~~~~v~~  161 (185)
T d1fftc_          82 SWLALTWLFGAGFIGMEIYEFHHLIVNGMGPDRSGFLSAFFALVGTHGLHVTSGLIWMAVLMVQIARRGLTSTNRTRIMC  161 (185)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHSSCSCCCCSTTTHHHHHHHHHTTHHHHTTHHHHHHHHHHHHTCCCTTCCCHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHH
T ss_conf             99999999999999988876999997166643342033399989999999999999999999999807999540068999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             98999999999999999999982
Q gi|254780472|r  186 LSMFWHFLDLIWICVFSFVYLMG  208 (210)
Q Consensus       186 ~~~YWHFVdivWi~lf~llYl~g  208 (210)
                      +++||||||++|+++|+++|++|
T Consensus       162 ~~~YWHFvd~vWi~lf~~lYl~g  184 (185)
T d1fftc_         162 LSLFWHFLDVVWICVFTVVYLMG  184 (185)
T ss_dssp             HHHHHHHHHHHHHHHCCCCCCCC
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             99999999999999999897049



>d1m56c_ f.25.1.1 (C:) Bacterial aa3 type cytochrome c oxidase subunit III {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1v54c_ f.25.1.1 (C:) Mitochondrial cytochrome c oxidase, subunit III {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 210 cytochrome o ubiquinol oxidase subunit III [Candid
1fft_C_204 (C:) Ubiquinol oxidase; electron transport, cytoch 5e-25
1qle_C_78-273196 (C:78-273) Cytochrome C oxidase polypeptide III; o 1e-22
1m56_C_71-266196 (C:71-266) Cytochrome C oxidase; membrane protein, 2e-22
1v54_C_70-261192 (C:70-261) Cytochrome C oxidase polypeptide III; o 1e-21
>1fft_C (C:) Ubiquinol oxidase; electron transport, cytochrome oxidase, membrane protein, oxidoreductase; HET: HEM HEO; 3.50A {Escherichia coli}Length = 204 Back     alignment and structure
 Score =  108 bits (271), Expect = 5e-25
 Identities = 97/183 (53%), Positives = 126/183 (68%), Gaps = 1/183 (0%)

Query: 28  DGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLS 87
                GFWIYLMSDC++F++ F TYAVL    A GP   D+F++  + V T +LL SS++
Sbjct: 23  GTKIFGFWIYLMSDCILFSILFATYAVLVNGTAGGPTGKDIFELPFVLVETFLLLFSSIT 82

Query: 88  CSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFA 147
              A +A   K    + +SWL +T  FG  FI MEIYEF HLI     P RS FLS+FFA
Sbjct: 83  YGMAAIAM-YKNNKSQVISWLALTWLFGAGFIGMEIYEFHHLIVNGMGPDRSGFLSAFFA 141

Query: 148 LVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLM 207
           LVG HGLHV  GLIW+ VL++QI ++GL S N+ R++CLS+FWHFLD++WICVF+ VYLM
Sbjct: 142 LVGTHGLHVTSGLIWMAVLMVQIARRGLTSTNRTRIMCLSLFWHFLDVVWICVFTVVYLM 201

Query: 208 GVV 210
           G +
Sbjct: 202 GAM 204


>1qle_C (C:78-273) Cytochrome C oxidase polypeptide III; oxidoreductase/immune system, complex (oxidoreductase/antibody), electron transport; HET: HEA PC1; 3.0A {Paracoccus denitrificans}Length = 196 Back     alignment and structure
>1m56_C (C:71-266) Cytochrome C oxidase; membrane protein, oxidoreductase; HET: HEA PEH; 2.30A {Rhodobacter sphaeroides}Length = 196 Back     alignment and structure
>1v54_C (C:70-261) Cytochrome C oxidase polypeptide III; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus}Length = 192 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target210 cytochrome o ubiquinol oxidase subunit III [Candidatus
1m56_C_71-266196 Cytochrome C oxidase; membrane protein, oxidoreduc 100.0
1fft_C_204 Ubiquinol oxidase; electron transport, cytochrome 100.0
1v54_C_70-261192 Cytochrome C oxidase polypeptide III; oxidoreducta 100.0
1qle_C_78-273196 Cytochrome C oxidase polypeptide III; oxidoreducta 100.0
>1m56_C (C:71-266) Cytochrome C oxidase; membrane protein, oxidoreductase; HET: HEA PEH; 2.30A {Rhodobacter sphaeroides} Back     alignment and structure
Probab=100.00  E-value=0  Score=319.10  Aligned_cols=185  Identities=23%  Similarity=0.461  Sum_probs=168.1

Q ss_pred             CCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCC-----------HHHCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             57202566026888999999999999999999942788888866-----------0000240357899999999999999
Q gi|254780472|r   22 ESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAP-----------IDVFDISGIFVSTIVLLLSSLSCSF   90 (210)
Q Consensus        22 ~~~~~~~~~~~G~w~Fi~SE~~~Fa~lf~~y~~~~~~~~~~~~~-----------~~~~~~~~~~~nT~iLl~SS~~~~~   90 (210)
                      |+..++++.|+|||+|++||.|+|++++++|+++|.+.++++.+           .+..+++.+.+||.+|++||.++..
T Consensus         1 h~~~~~~~~~~g~w~fl~SE~~lF~~~f~ay~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~T~~Ll~Ss~~~~~   80 (196)
T 1m56_C            1 HTPVVRLGLRWGFILFIMSEVMFFSAWFWSFFKHALYPMGPESPIIDGIFPPEGIITFDPWHLPLINTLILLCSGCAATW   80 (196)
T ss_dssp             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHSCCCTBTTTBCCCSSCTTCCCCCTTTTHHHHHHHHHHHHHHHHH
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHH
T ss_conf             85887632468989999999999999999999998287788886537868996534176245488999999833799999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999633336887765589999999998899998755431110014786016799998997999999999999999999
Q gi|254780472|r   91 AMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQI  170 (210)
Q Consensus        91 a~~a~~~~~~~~~~~~~L~~t~~lG~~Fl~~Q~~E~~~l~~~g~~~~~~~~~S~fy~lTG~H~lHV~~Gli~L~~~~~~~  170 (210)
                      |+++.++++.++..+.++..|+++|.+|+.+|.+||.++   +.++++|+|+|+||++||+|++||++|++.+..+..|.
T Consensus        81 a~~a~~~~~~~~~~~~~L~~t~~lg~~Fl~~Q~~E~~~~---~~~~~~~~~~s~fy~lTGlH~lHV~~Gli~l~~~~~~~  157 (196)
T 1m56_C           81 AHHALVHENNRRDVAWGLALAIALGALFTVFQAYEYSHA---AFGFAGNIYGANFFMATGFHGFHVIVGTIFLLVCLIRV  157 (196)
T ss_dssp             HHHHHHHTCCHHHHHHHHHHHHHHHHHHHHHHHHHHHTC---SSCSSSSHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC---CCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             999988612688999999999999999999999998631---36643249998999999999999999999999999999


Q ss_pred             HCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             707998304267999989999999999999999999820
Q gi|254780472|r  171 LKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGV  209 (210)
Q Consensus       171 ~~~~~~~~~~~~~~~~~~YWHFVdivWi~lf~llYl~g~  209 (210)
                      .+++++++++.++|.+++||||||+||+++|+++|++|.
T Consensus       158 ~~~~~~~~~~~~~~~~~~YWHFVD~vWi~lf~~~Ylwg~  196 (196)
T 1m56_C          158 QRGHFTPEKHVGFEAAIWYWHFVDVVWLFLFASIYIWGQ  196 (196)
T ss_dssp             HTCCCCSSCCHHHHHHHHHHHHHHHHHHHHHHHHTTTCC
T ss_pred             HHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC
T ss_conf             827998331289999999998899889988888862279



>1fft_C (C:) Ubiquinol oxidase; electron transport, cytochrome oxidase, membrane protein, oxidoreductase; HET: HEM HEO; 3.50A {Escherichia coli} Back     alignment and structure
>1v54_C (C:70-261) Cytochrome C oxidase polypeptide III; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} Back     alignment and structure
>1qle_C (C:78-273) Cytochrome C oxidase polypeptide III; oxidoreductase/immune system, complex (oxidoreductase/antibody), electron transport; HET: HEA PC1; 3.0A {Paracoccus denitrificans} Back     alignment and structure