254780473

254780473

cytochrome O ubiquinol oxidase subunit I

GeneID in NCBI database:8209462Locus tag:CLIBASIA_01790
Protein GI in NCBI database:254780473Protein Accession:YP_003064886.1
Gene range:-(394602, 396617)Protein Length:671aa
Gene description:cytochrome O ubiquinol oxidase subunit I
COG prediction:[C] Heme/copper-type cytochrome/quinol oxidases, subunit 1
KEGG prediction:cyoB; cytochrome o ubiquinol oxidase subunit I; K02298 cytochrome o ubiquinol oxidase subunit I [EC:1.10.3.-]
SEED prediction:Cytochrome O ubiquinol oxidase subunit I (EC 1.10.3.-)
Pathway involved in KEGG:Oxidative phosphorylation [PATH:las00190]
Subsystem involved in SEED:Terminal cytochrome O ubiquinol oxidase
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM15 TM-Helix
TOPPRED14 TM-Helix
HMMTOP15 TM-Helix
MEMSAT12 TM-Helix
MEMSAT_SVM13 TM-Helix
PHOBIUS15 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-
MLQNIDFHKFIFGRLTINSIPYNIPIVLGTFFVVALVGVSIIFAITYYRLWGYLWKEWFTSVDHKKIGIMYIILSLVMLFRGFADAIMMRLQQAIASGGGEGYLDAHHYDQIFTAHGVIMIFFVAMPMITGIMNFVVPLQIGARDVSFPFLNNFSFWMTVAGAVVIMCSLFIGEFASVGWLAYPPLSGISYSPGVGVDYYIWGLQIAGIGTTLSGINLVVTIIKMRCPGMTMMKMPVFVWTAFCSNIMIIAAFPILTATLFLLTLDRYIGTNFFTNHLGGNPMMYINLIWIWGHPEVYILVLPAFGIFSEVVATFSGKRLFGYNSMVYATLAITILSYTVWLHHFFTMGSGANVNAFFGIMTMVIAVPTGAKIFNWLFTMRLGKVRFEVPMMWTLGFMITFLIGGMTGVLLAVPPADFTLHNSLFLVAHFHNTIIGGVVFGLFAGIVYWFPKAFGYQLNSFWGKVSFWCWFVGFYLAFMPLYALGLKGVTRRLSQYEDTTLQVYYVVALLGAVLIGIGVFSFVLSFIVSFLNRSKLQDTIGDPWDGRTLEWSISSPSPQYNFAFTPIVSTIDAWEHMKNRGYRYPSEGFMPIHMPSNTATGIILAALSIVFSFAMVWYMWWLALLSFISIVFYTIFHTFNYNDGYEVSAKDVAFSEEVHRKMNMPKDREHC
ccccHHHHHHHHHHccccccccccccccccHHHHHccccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccEEccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccEEcccccccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEcHHHHHHHHHHHHHHHHHHccccc
ccccccHHHHccccccccccHHHHHHHHHccccHHccccccHHHHcccHHHHHHHHHHcccccccccccHHHHHHHHHHccccHHHHHHHHHHcccccccccccccHHHccHHHHHHHHHHccHHHHHccHHHHHHHHHHHcccccccHHHHHHHHHcHHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHccccHHHHHccccccHHHHHHHHHHHHHcHHHHHHHHHHHHHHHccccEcccHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHccEHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHcEEccHHHHHHHHHHHHHHHHHHHcHHHHHHHcccEccccccccccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcccEEEccccccccccHHHHHccccccccccccccccccHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEcccccEEEHHcccccHHHHHHcccccccccc
mlqnidfhKFIFGrltinsipynipiVLGTFFVVALVGVSIIFAITYYRLWGYLWKewftsvdhkkIGIMYIILSLVMLFRGFADAIMMRLQQAIAsgggegyldahhydQIFTAHGVIMIFFVAMPMITGIMNFVvplqigardvsfpflnnFSFWMTVAGAVVIMCSLFIGefasvgwlaypplsgisyspgvgvdyYIWGLQIAGIGTTLSGINLVVTIIKMrcpgmtmmkmPVFVWTAFCSNIMIIAAFPILTATLFLLTLDRYigtnfftnhlggnpmMYINLIWIWGHPEVYILVLPAFGIFSEVVATFsgkrlfgynsMVYATLAITILSYTVWLHHFFtmgsganvnAFFGIMTMVIAVPTGAKIFNWLFTMRLgkvrfevpmMWTLGFMITFLIGGMTgvllavppadftlhnSLFLVAHFHNTIIGGVVFGLFAGIVYWFPKAFGYQLNSFWGKVSFWCWFVGFYLAFMPLYALGLKGVTRRLSQYEDTTLQVYYVVALLGAVLIGIGVFSFVLSFIVSFLNRsklqdtigdpwdgrtlewsisspspqynfaftpivSTIDAWEHMknrgyrypsegfmpihmpsntATGIILAALSIVFSFAMVWYMWWLALLSFISIVFYTIFHtfnyndgyevsakdvaFSEEVHrkmnmpkdrehc
MLQNIDFHKFIFGRLTINSIPYNIPIVLGTFFVVALVGVSIIFAITYYRLWGYLWKEWFTSVDHKKIGIMYIILSLVMLFRGFADAIMMRLQQAIASGGGEGYLDAHHYDQIFTAHGVIMIFFVAMPMITGIMNFVVPLQIGARDVSFPFLNNFSFWMTVAGAVVIMCSLFIGEFASVGWLAYPPLSGISYSPGVGVDYYIWGLQIAGIGTTLSGINLVVTIIKMRCPGMTMMKMPVFVWTAFCSNIMIIAAFPILTATLFLLTLDRYIGTNFFTNHLGGNPMMYINLIWIWGHPEVYILVLPAFGIFSEVVATFSGKRLFGYNSMVYATLAITILSYTVWLHHFFTMGSGANVNAFFGIMTMVIAVPTGAKIFNWLFTMRLGKVRFEVPMMWTLGFMITFLIGGMTGVLLAVPPADFTLHNSLFLVAHFHNTIIGGVVFGLFAGIVYWFPKAFGYQLNSFWGKVSFWCWFVGFYLAFMPLYALGLKGVTRRLSQYEDTTLQVYYVVALLGAVLIGIGVFSFVLSFIVSFLNRSKLQDTIGDPWDGRTLEWSisspspqynFAFTPIVSTIDAWEHMKNRGYRYPSEGFMPIHMPSNTATGIILAALSIVFSFAMVWYMWWLALLSFISIVFYTIFHTFNYNDGYEVSAKDVAFSEevhrkmnmpkdrehc
MLQNIDFHKFIFGRLTINSIPYNIPIVLGTFFVVALVGVSIIFAITYYRLWGYLWKEWFTSVDHKKIGIMYIILSLVMLFRGFADAIMMRLQQAIASGGGEGYLDAHHYDQIFTAHGVIMIFFVAMPMITGIMNFVVPLQIGARDVSFPFLNNFSFWMTVAGAVVIMCSLFIGEFASVGWLAYPPLSGISYSPGVGVDYYIWGLQIAGIGTTLSGINLVVTIIKMRCPGMTMMKMPVFVWTAFCSNIMIIAAFPILTATLFLLTLDRYIGTNFFTNHLGGNPMMYINLIWIWGHPEVYILVLPAFGIFSEVVATFSGKRLFGYNSMVYATLAITILSYTVWLHHFFTMGSGANVNAFFGIMTMVIAVPTGAKIFNWLFTMRLGKVRFEVPMMWTLGFMITFLIGGMTGVLLAVPPADFTLHNSLFLVAHFHNTIIGGVVFGLFAGIVYWFPKAFGYQLNSFWGKVSFWCWFVGFYLAFMPLYALGLKGVTRRLSQYEDTTLQvyyvvallgavligigvfsfvlsfivsflNRSKLQDTIGDPWDGRTLEWSISSPSPQYNFAFTPIVSTIDAWEHMKNRGYRYPSEGFMPIHMPSNTATGIILAALSIVFSFAMVWYMWWLALLSFISIVFYTIFHTFNYNDGYEVSAKDVAFSEEVHRKMNMPKDREHC
*****DF*KFIFGRLTINSIPYNIPIVLGTFFVVALVGVSIIFAITYYRLWGYLWKEWFTSVDHKKIGIMYIILSLVMLFRGFADAIMMRLQQAIASGGGEGYLDAHHYDQIFTAHGVIMIFFVAMPMITGIMNFVVPLQIGARDVSFPFLNNFSFWMTVAGAVVIMCSLFIGEFASVGWLAYPPLSGISYSPGVGVDYYIWGLQIAGIGTTLSGINLVVTIIKMRCPGMTMMKMPVFVWTAFCSNIMIIAAFPILTATLFLLTLDRYIGTNFFTNHLGGNPMMYINLIWIWGHPEVYILVLPAFGIFSEVVATFSGKRLFGYNSMVYATLAITILSYTVWLHHFFTMGSGANVNAFFGIMTMVIAVPTGAKIFNWLFTMRLGKVRFEVPMMWTLGFMITFLIGGMTGVLLAVPPADFTLHNSLFLVAHFHNTIIGGVVFGLFAGIVYWFPKAFGYQLNSFWGKVSFWCWFVGFYLAFMPLYALGLKGVTRRLSQYEDTTLQVYYVVALLGAVLIGIGVFSFVLSFIVSFLNRSKLQDTIGDPWDGRTLEWSISSPSPQYNFAFTPIVSTIDAWEHMKNR***********IHMPSNTATGIILAALSIVFSFAMVWYMWWLALLSFISIVFYTIFHTFNYNDGYEVSAKDVAFS****************
MLQNIDFHKFIFGRLTINSIPYNIPIVLGTFFVVALVGVSIIFAITYYRLWGYLWKEWFTSVDHKKIGIMYIILSLVMLFRGFADAIMMRLQQAIASGGGEGYLDAHHYDQIFTAHGVIMIFFVAMPMITGIMNFVVPLQIGARDVSFPFLNNFSFWMTVAGAVVIMCSLFIGEFASVGWLAYPPLSGISYSPGVGVDYYIWGLQIAGIGTTLSGINLVVTIIKMRCPGMTMMKMPVFVWTAFCSNIMIIAAFPILTATLFLLTLDRYIGTNFFTNHLGGNPMMYINLIWIWGHPEVYILVLPAFGIFSEVVATFSGKRLFGYNSMVYATLAITILSYTVWLHHFFTMGSGANVNAFFGIMTMVIAVPTGAKIFNWLFTMRLGKVRFEVPMMWTLGFMITFLIGGMTGVLLAVPPADFTLHNSLFLVAHFHNTIIGGVVFGLFAGIVYWFPKAFGYQLNSFWGKVSFWCWFVGFYLAFMPLYALGLKGVTRRLSQYEDTTLQVYYVVALLGAVLIGIGVFSFVLSFIVSFLNRSKLQDTIGDPWDGRTLEWSISSPSPQYNFAFTPIVSTIDAWEHMKNRGYRYPSEGFMPIHMPSNTATGIILAALSIVFSFAMVWYMWWLALLSFISIVFYTIFHTFNYNDGYEVSAKDVAFSEEVHRK**********
***NIDFHKFIFGRLTINSIPYNIPIVLGTFFVVALVGVSIIFAITYYRLWGYLWKEWFTSVDHKKIGIMYIILSLVMLFRGFADAIMMRLQQAIASGGGEGYLDAHHYDQIFTAHGVIMIFFVAMPMITGIMNFVVPLQIGARDVSFPFLNNFSFWMTVAGAVVIMCSLFIGEFASVGWLAYPPLSGISYSPGVGVDYYIWGLQIAGIGTTLSGINLVVTIIKMRCPGMTMMKMPVFVWTAFCSNIMIIAAFPILTATLFLLTLDRYIGTNFFTNHLGGNPMMYINLIWIWGHPEVYILVLPAFGIFSEVVATFSGKRLFGYNSMVYATLAITILSYTVWLHHFFTMGSGANVNAFFGIMTMVIAVPTGAKIFNWLFTMRLGKVRFEVPMMWTLGFMITFLIGGMTGVLLAVPPADFTLHNSLFLVAHFHNTIIGGVVFGLFAGIVYWFPKAFGYQLNSFWGKVSFWCWFVGFYLAFMPLYALGLKGVTRRLSQYEDTTLQVYYVVALLGAVLIGIGVFSFVLSFIVSFLNRSKLQDTIGDPWDGRTLEWSISSPSPQYNFAFTPIVSTIDAWEHMKNRGYRYPSEGFMPIHMPSNTATGIILAALSIVFSFAMVWYMWWLALLSFISIVFYTIFHTFNYNDGYEVSAKDVAFSEEVHRK**********
oooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLQNIDFHKFIFGRLTINSIPYNIPIVLGTFFVVALVGVSIIFAITYYRLWGYLWKEWFTSVDHKKIGIMYIILSLVMLFRGFADAIMMRLQQAIASGGGEGYLDAHHYDQIFTAHGVIMIFFVAMPMITGIMNFVVPLQIGARDVSFPFLNNFSFWMTVAGAVVIMCSLFIGEFASVGWLAYPPLSGISYSPGVGVDYYIWGLQIAGIGTTLSGINLVVTIIKMRCPGMTMMKMPVFVWTAFCSNIMIIAAFPILTATLFLLTLDRYIGTNFFTNHLGGNPMMYINLIWIWGHPEVYILVLPAFGIFSEVVATFSGKRLFGYNSMVYATLAITILSYTVWLHHFFTMGSGANVNAFFGIMTMVIAVPTGAKIFNWLFTMRLGKVRFEVPMMWTLGFMITFLIGGMTGVLLAVPPADFTLHNSLFLVAHFHNTIIGGVVFGLFAGIVYWFPKAFGYQLNSFWGKVSFWCWFVGFYLAFMPLYALGLKGVTRRLSQYEDTTLQVYYVVALLGAVLIGIGVFSFVLSFIVSFLNRSKLQDTIGDPWDGRTLEWSISSPSPQYNFAFTPIVSTIDAWEHMKNRGYRYPSEGFMPIHMPSNTATGIILAALSIVFSFAMVWYMWWLALLSFISIVFYTIFHTFNYNDGYEVSAKDVAFSEEVHRKMNMPKDREHC
MLQNIDFHKFIFGRLTINSIPYNIPIVLGTFFVVALVGVSIIFAITYYRLWGYLWKEWFTSVDHKKIGIMYIILSLVMLFRGFADAIMMRLQQAIASGGGEGYLDAHHYDQIFTAHGVIMIFFVAMPMITGIMNFVVPLQIGARDVSFPFLNNFSFWMTVAGAVVIMCSLFIGEFASVGWLAYPPLSGISYSPGVGVDYYIWGLQIAGIGTTLSGINLVVTIIKMRCPGMTMMKMPVFVWTAFCSNIMIIAAFPILTATLFLLTLDRYIGTNFFTNHLGGNPMMYINLIWIWGHPEVYILVLPAFGIFSEVVATFSGKRLFGYNSMVYATLAITILSYTVWLHHFFTMGSGANVNAFFGIMTMVIAVPTGAKIFNWLFTMRLGKVRFEVPMMWTLGFMITFLIGGMTGVLLAVPPADFTLHNSLFLVAHFHNTIIGGVVFGLFAGIVYWFPKAFGYQLNSFWGKVSFWCWFVGFYLAFMPLYALGLKGVTRRLSQYEDTTLQVYYVVALLGAVLIGIGVFSFVLSFIVSFLNRSKLQDTIGDPWDGRTLEWSISSPSPQYNFAFTPIVSTIDAWEHMKNRGYRYPSEGFMPIHMPSNTATGIILAALSIVFSFAMVWYMWWLALLSFISIVFYTIFHTFNYNDGYEVSAKDVAFSEEVHRKMNMPKDREHC
MLQNIDFHKFIFGRLTINSIPYNIPIVLGTFFVVALVGVSIIFAITYYRLWGYLWKEWFTSVDHKKIGIMYIILSLVMLFRGFADAIMMRLQQAIASGGGEGYLDAHHYDQIFTAHGVIMIFFVAMPMITGIMNFVVPLQIGARDVSFPFLNNFSFWMTVAGAVVIMCSLFIGEFASVGWLAYPPLSGISYSPGVGVDYYIWGLQIAGIGTTLSGINLVVTIIKMRCPGMTMMKMPVFVWTAFCSNIMIIAAFPILTATLFLLTLDRYIGTNFFTNHLGGNPMMYINLIWIWGHPEVYILVLPAFGIFSEVVATFSGKRLFGYNSMVYATLAITILSYTVWLHHFFTMGSGANVNAFFGIMTMVIAVPTGAKIFNWLFTMRLGKVRFEVPMMWTLGFMITFLIGGMTGVLLAVPPADFTLHNSLFLVAHFHNTIIGGVVFGLFAGIVYWFPKAFGYQLNSFWGKVSFWCWFVGFYLAFMPLYALGLKGVTRRLSQYEDTTLQVYYVVALLGAVLIGIGVFSFVLSFIVSFLNRSKLQDTIGDPWDGRTLEWSISSPSPQYNFAFTPIVSTIDAWEHMKNRGYRYPSEGFMPIHMPSNTATGIILAALSIVFSFAMVWYMWWLALLSFISIVFYTIFHTFNYNDGYEVSAKDVAFSEEVHRKMNMPKDREHC

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target671 cytochrome O ubiquinol oxidase subunit I [Candidatus Li
315122071671 cytochrome O ubiquinol oxidase subunit I [Candidatus Li 1 0.0
222084386667 cytochrome o ubiquinol oxidase, subunit I [Agrobacteriu 1 0.0
15887496667 cytochrome O ubiquinol oxidase subunit I [Agrobacterium 1 0.0
325291583667 cytochrome ubiquinol oxidase subunit I [Agrobacterium s 1 0.0
222107119667 cytochrome o ubiquinol oxidase subunit I [Agrobacterium 1 0.0
150376512669 cytochrome o ubiquinol oxidase subunit I [Sinorhizobium 1 0.0
16265064669 putative cytochrome o ubiquinol oxidase chain I protein 1 0.0
307309512669 cytochrome o ubiquinol oxidase, subunit I [Sinorhizobiu 1 0.0
307320580669 cytochrome o ubiquinol oxidase, subunit I [Sinorhizobiu 1 0.0
16126016665 ubiquinol oxidase subunit I [Caulobacter crescentus CB1 1 0.0
>gi|315122071|ref|YP_004062560.1| cytochrome O ubiquinol oxidase subunit I [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 671 Back     alignment and organism information
 Score = 1214 bits (3141), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 584/671 (87%), Positives = 630/671 (93%)

Query: 1   MLQNIDFHKFIFGRLTINSIPYNIPIVLGTFFVVALVGVSIIFAITYYRLWGYLWKEWFT 60
           MLQN+DF+KF+FGRLT+ S PY IPIVLGTF VVALVG++ I  +TYYRLWGYLWKEWFT
Sbjct: 1   MLQNVDFYKFVFGRLTLESFPYKIPIVLGTFCVVALVGIATIVTVTYYRLWGYLWKEWFT 60

Query: 61  SVDHKKIGIMYIILSLVMLFRGFADAIMMRLQQAIASGGGEGYLDAHHYDQIFTAHGVIM 120
           SVDHKKIGIMYIILSLVMLFRGFADAIMMRLQQAIASGGGEGYLDAHHYDQIFTAHGVIM
Sbjct: 61  SVDHKKIGIMYIILSLVMLFRGFADAIMMRLQQAIASGGGEGYLDAHHYDQIFTAHGVIM 120

Query: 121 IFFVAMPMITGIMNFVVPLQIGARDVSFPFLNNFSFWMTVAGAVVIMCSLFIGEFASVGW 180
           IFFVAMPM+TG+MNFVVPLQIGARDVSFPFLNNFSFWMT  GAV++M SLFIGEFAS GW
Sbjct: 121 IFFVAMPMVTGVMNFVVPLQIGARDVSFPFLNNFSFWMTAMGAVLMMSSLFIGEFASAGW 180

Query: 181 LAYPPLSGISYSPGVGVDYYIWGLQIAGIGTTLSGINLVVTIIKMRCPGMTMMKMPVFVW 240
           LAYPPLSGISYSPGVGVDYYIWGLQI+GIGTTLSGINLVVTIIK+RCPGMTMMKMPVFVW
Sbjct: 181 LAYPPLSGISYSPGVGVDYYIWGLQISGIGTTLSGINLVVTIIKLRCPGMTMMKMPVFVW 240

Query: 241 TAFCSNIMIIAAFPILTATLFLLTLDRYIGTNFFTNHLGGNPMMYINLIWIWGHPEVYIL 300
           T+FCSNIMIIAAFPILTAT FLLTLDRYIGTNFFTNHLGGNPMMY+NLIWIWGHPEVYIL
Sbjct: 241 TSFCSNIMIIAAFPILTATFFLLTLDRYIGTNFFTNHLGGNPMMYVNLIWIWGHPEVYIL 300

Query: 301 VLPAFGIFSEVVATFSGKRLFGYNSMVYATLAITILSYTVWLHHFFTMGSGANVNAFFGI 360
           VLPAFGIFSEVVATFSGKRLFGY+SMVYATLAITILSYTVWLHHFFTMGSGANVNAFFGI
Sbjct: 301 VLPAFGIFSEVVATFSGKRLFGYSSMVYATLAITILSYTVWLHHFFTMGSGANVNAFFGI 360

Query: 361 MTMVIAVPTGAKIFNWLFTMRLGKVRFEVPMMWTLGFMITFLIGGMTGVLLAVPPADFTL 420
           MTM+IA+PTGAKIFNWLFTMR GKVRFEVPMMWTLGFM+TFLIGGMTGVLLAVPPADFTL
Sbjct: 361 MTMIIAIPTGAKIFNWLFTMRFGKVRFEVPMMWTLGFMLTFLIGGMTGVLLAVPPADFTL 420

Query: 421 HNSLFLVAHFHNTIIGGVVFGLFAGIVYWFPKAFGYQLNSFWGKVSFWCWFVGFYLAFMP 480
           HNSLFLVAHFHNTIIGGVVFGL AGIVYWFPKAFGY+L+ FWGKVSFWCWF+GFY AFMP
Sbjct: 421 HNSLFLVAHFHNTIIGGVVFGLLAGIVYWFPKAFGYRLDPFWGKVSFWCWFMGFYFAFMP 480

Query: 481 LYALGLKGVTRRLSQYEDTTLQVYYVVALLGAVLIGIGVFSFVLSFIVSFLNRSKLQDTI 540
           LYALGLKGVTRRLSQYED +LQVYYVVALLGAVLI  G+FSF+LSFIVSFLNR++L+DT 
Sbjct: 481 LYALGLKGVTRRLSQYEDVSLQVYYVVALLGAVLIAGGIFSFILSFIVSFLNRAQLRDTS 540

Query: 541 GDPWDGRTLEWSISSPSPQYNFAFTPIVSTIDAWEHMKNRGYRYPSEGFMPIHMPSNTAT 600
           GDPW+GRTLEWSI+SP+P YNF+FTP+V  IDAW  MK +GYR P  GF+PIHMP NTAT
Sbjct: 541 GDPWNGRTLEWSIASPAPMYNFSFTPVVHKIDAWSDMKEQGYRRPINGFLPIHMPQNTAT 600

Query: 601 GIILAALSIVFSFAMVWYMWWLALLSFISIVFYTIFHTFNYNDGYEVSAKDVAFSEEVHR 660
           GI+LA LS +FSFAMVWYMWWLA+LSF+SIV YTIFHTFNY+ GYE+ AKDV  SEE  R
Sbjct: 601 GIVLAGLSFLFSFAMVWYMWWLAILSFVSIVLYTIFHTFNYSHGYEIPAKDVESSEESCR 660

Query: 661 KMNMPKDREHC 671
           +++M +D+E C
Sbjct: 661 QISMEQDKERC 671


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222084386|ref|YP_002542915.1| cytochrome o ubiquinol oxidase, subunit I [Agrobacterium radiobacter K84] Length = 667 Back     alignment and organism information
>gi|15887496|ref|NP_353177.1| cytochrome O ubiquinol oxidase subunit I [Agrobacterium tumefaciens str. C58] Length = 667 Back     alignment and organism information
>gi|325291583|ref|YP_004277447.1| cytochrome ubiquinol oxidase subunit I [Agrobacterium sp. H13-3] Length = 667 Back     alignment and organism information
>gi|222107119|ref|YP_002547910.1| cytochrome o ubiquinol oxidase subunit I [Agrobacterium vitis S4] Length = 667 Back     alignment and organism information
>gi|150376512|ref|YP_001313108.1| cytochrome o ubiquinol oxidase subunit I [Sinorhizobium medicae WSM419] Length = 669 Back     alignment and organism information
>gi|16265064|ref|NP_437856.1| putative cytochrome o ubiquinol oxidase chain I protein [Sinorhizobium meliloti 1021] Length = 669 Back     alignment and organism information
>gi|307309512|ref|ZP_07589168.1| cytochrome o ubiquinol oxidase, subunit I [Sinorhizobium meliloti BL225C] Length = 669 Back     alignment and organism information
>gi|307320580|ref|ZP_07599994.1| cytochrome o ubiquinol oxidase, subunit I [Sinorhizobium meliloti AK83] Length = 669 Back     alignment and organism information
>gi|16126016|ref|NP_420580.1| ubiquinol oxidase subunit I [Caulobacter crescentus CB15] Length = 665 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target671 cytochrome O ubiquinol oxidase subunit I [Candidatus Li
TIGR02843646 TIGR02843, CyoB, cytochrome o ubiquinol oxidase, subuni 0.0
PRK15017663 PRK15017, PRK15017, cytochrome o ubiquinol oxidase subu 0.0
TIGR02882643 TIGR02882, QoxB, cytochrome aa3 quinol oxidase, subunit 0.0
COG0843566 COG0843, CyoB, Heme/copper-type cytochrome/quinol oxida 1e-170
TIGR02891506 TIGR02891, CtaD_CoxA, cytochrome c oxidase, subunit I 1e-157
cd01663488 cd01663, Cyt_c_Oxidase_I, Cytochrome C oxidase subunit 1e-124
MTH00223512 MTH00223, COX1, cytochrome c oxidase subunit I; Provisi 1e-109
MTH00184519 MTH00184, COX1, cytochrome c oxidase subunit I; Provisi 1e-108
MTH00182525 MTH00182, COX1, cytochrome c oxidase subunit I; Provisi 1e-107
MTH00167512 MTH00167, COX1, cytochrome c oxidase subunit I; Provisi 1e-107
MTH00116515 MTH00116, COX1, cytochrome c oxidase subunit I; Provisi 1e-106
MTH00142511 MTH00142, COX1, cytochrome c oxidase subunit I; Provisi 1e-106
MTH00153511 MTH00153, COX1, cytochrome c oxidase subunit I; Provisi 1e-102
MTH00037517 MTH00037, COX1, cytochrome c oxidase subunit I; Provisi 1e-101
MTH00183516 MTH00183, COX1, cytochrome c oxidase subunit I; Provisi 3e-97
MTH00103513 MTH00103, COX1, cytochrome c oxidase subunit I; Validat 4e-96
MTH00007511 MTH00007, COX1, cytochrome c oxidase subunit I; Validat 3e-95
MTH00026534 MTH00026, COX1, cytochrome c oxidase subunit I; Provisi 8e-95
MTH00077514 MTH00077, COX1, cytochrome c oxidase subunit I; Provisi 2e-94
cd01662501 cd01662, Ubiquinol_Oxidase_I, Ubiquinol oxidase subunit 0.0
cd00919463 cd00919, Heme_Cu_Oxidase_I, Heme-copper oxidase subunit 1e-127
pfam00115444 pfam00115, COX1, Cytochrome C and Quinol oxidase polype 1e-119
MTH00079508 MTH00079, COX1, cytochrome c oxidase subunit I; Provisi 1e-100
MTH00048511 MTH00048, COX1, cytochrome c oxidase subunit I; Provisi 1e-78
cd01660473 cd01660, ba3-like_Oxidase_I, ba3-like heme-copper oxida 4e-26
KOG4769182 KOG4769, KOG4769, KOG4769, Cytochrome c oxidase, subuni 3e-31
PRK14485 712 PRK14485, PRK14485, putative bifunctional cbb3-type cyt 0.002
>gnl|CDD|131890 TIGR02843, CyoB, cytochrome o ubiquinol oxidase, subunit I Back     alignment and domain information
>gnl|CDD|184978 PRK15017, PRK15017, cytochrome o ubiquinol oxidase subunit I; Provisional Back     alignment and domain information
>gnl|CDD|131928 TIGR02882, QoxB, cytochrome aa3 quinol oxidase, subunit I Back     alignment and domain information
>gnl|CDD|31185 COG0843, CyoB, Heme/copper-type cytochrome/quinol oxidases, subunit 1 [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|163062 TIGR02891, CtaD_CoxA, cytochrome c oxidase, subunit I Back     alignment and domain information
>gnl|CDD|29934 cd01663, Cyt_c_Oxidase_I, Cytochrome C oxidase subunit I Back     alignment and domain information
>gnl|CDD|177260 MTH00223, COX1, cytochrome c oxidase subunit I; Provisional Back     alignment and domain information
>gnl|CDD|177235 MTH00184, COX1, cytochrome c oxidase subunit I; Provisional Back     alignment and domain information
>gnl|CDD|177233 MTH00182, COX1, cytochrome c oxidase subunit I; Provisional Back     alignment and domain information
>gnl|CDD|177222 MTH00167, COX1, cytochrome c oxidase subunit I; Provisional Back     alignment and domain information
>gnl|CDD|177177 MTH00116, COX1, cytochrome c oxidase subunit I; Provisional Back     alignment and domain information
>gnl|CDD|177200 MTH00142, COX1, cytochrome c oxidase subunit I; Provisional Back     alignment and domain information
>gnl|CDD|177210 MTH00153, COX1, cytochrome c oxidase subunit I; Provisional Back     alignment and domain information
>gnl|CDD|177112 MTH00037, COX1, cytochrome c oxidase subunit I; Provisional Back     alignment and domain information
>gnl|CDD|177234 MTH00183, COX1, cytochrome c oxidase subunit I; Provisional Back     alignment and domain information
>gnl|CDD|177165 MTH00103, COX1, cytochrome c oxidase subunit I; Validated Back     alignment and domain information
>gnl|CDD|133649 MTH00007, COX1, cytochrome c oxidase subunit I; Validated Back     alignment and domain information
>gnl|CDD|164599 MTH00026, COX1, cytochrome c oxidase subunit I; Provisional Back     alignment and domain information
>gnl|CDD|177147 MTH00077, COX1, cytochrome c oxidase subunit I; Provisional Back     alignment and domain information
>gnl|CDD|29933 cd01662, Ubiquinol_Oxidase_I, Ubiquinol oxidase subunit I Back     alignment and domain information
>gnl|CDD|29930 cd00919, Heme_Cu_Oxidase_I, Heme-copper oxidase subunit I Back     alignment and domain information
>gnl|CDD|143891 pfam00115, COX1, Cytochrome C and Quinol oxidase polypeptide I Back     alignment and domain information
>gnl|CDD|177148 MTH00079, COX1, cytochrome c oxidase subunit I; Provisional Back     alignment and domain information
>gnl|CDD|177123 MTH00048, COX1, cytochrome c oxidase subunit I; Provisional Back     alignment and domain information
>gnl|CDD|29931 cd01660, ba3-like_Oxidase_I, ba3-like heme-copper oxidase subunit I Back     alignment and domain information
>gnl|CDD|39966 KOG4769, KOG4769, KOG4769, Cytochrome c oxidase, subunit I [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|184703 PRK14485, PRK14485, putative bifunctional cbb3-type cytochrome c oxidase subunit I/II; Provisional Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 671 cytochrome O ubiquinol oxidase subunit I [Candidatus Li
TIGR02843646 CyoB cytochrome o ubiquinol oxidase, subunit I; InterPr 100.0
TIGR02882648 QoxB cytochrome aa3 quinol oxidase, subunit I; InterPro 100.0
TIGR02891524 CtaD_CoxA cytochrome c oxidase, subunit I; InterPro: IP 100.0
MTH00153511 COX1 cytochrome c oxidase subunit I; Provisional 100.0
MTH00103513 COX1 cytochrome c oxidase subunit I; Validated 100.0
MTH00187517 COX1 cytochrome c oxidase subunit I; Provisional 100.0
MTH00128516 COX1 cytochrome c oxidase subunit I; Provisional 100.0
MTH00182525 COX1 cytochrome c oxidase subunit I; Provisional 100.0
MTH00116515 COX1 cytochrome c oxidase subunit I; Provisional 100.0
MTH00184519 COX1 cytochrome c oxidase subunit I; Provisional 100.0
MTH00078548 COX1 cytochrome c oxidase subunit I; Provisional 100.0
MTH00167513 COX1 cytochrome c oxidase subunit I; Provisional 100.0
MTH00077515 COX1 cytochrome c oxidase subunit I; Provisional 100.0
MTH00037517 COX1 cytochrome c oxidase subunit I; Provisional 100.0
MTH00183511 COX1 cytochrome c oxidase subunit I; Provisional 100.0
MTH00007511 COX1 cytochrome c oxidase subunit I; Validated 100.0
MTH00142511 COX1 cytochrome c oxidase subunit I; Provisional 100.0
MTH00026535 COX1 cytochrome c oxidase subunit I; Provisional 100.0
MTH00079508 COX1 cytochrome c oxidase subunit I; Provisional 100.0
MTH00048514 COX1 cytochrome c oxidase subunit I; Provisional 100.0
cd01663488 Cyt_c_Oxidase_I Cytochrome C oxidase subunit I. Cytochr 100.0
cd01662501 Ubiquinol_Oxidase_I Ubiquinol oxidase subunit I. Ubiqui 100.0
COG0843566 CyoB Heme/copper-type cytochrome/quinol oxidases, subun 100.0
cd00919463 Heme_Cu_Oxidase_I Heme-copper oxidase subunit I. Heme-c 100.0
cd01660473 ba3-like_Oxidase_I ba3-like heme-copper oxidase subunit 100.0
pfam00115444 COX1 Cytochrome C and Quinol oxidase polypeptide I. 100.0
cd01661493 cbb3_Oxidase_I Cytochrome cbb3 oxidase subunit I. Cytoc 100.0
TIGR00780485 ccoN cytochrome c oxidase, cbb3-type, subunit I; InterP 100.0
COG3278482 CcoN Cbb3-type cytochrome oxidase, subunit 1 [Posttrans 100.0
COG3256717 NorB Nitric oxide reductase large subunit [Inorganic io 99.66
KOG4769182 consensus 100.0
cd01661493 cbb3_Oxidase_I Cytochrome cbb3 oxidase subunit I. Cytoc 98.87
pfam00115444 COX1 Cytochrome C and Quinol oxidase polypeptide I. 97.86
cd01660473 ba3-like_Oxidase_I ba3-like heme-copper oxidase subunit 97.97
cd00919463 Heme_Cu_Oxidase_I Heme-copper oxidase subunit I. Heme-c 97.82
cd01662501 Ubiquinol_Oxidase_I Ubiquinol oxidase subunit I. Ubiqui 97.73
pfam12270135 Cyt_c_ox_IV Cytochrome c oxidase subunit IV. This famil 97.59
cd01663488 Cyt_c_Oxidase_I Cytochrome C oxidase subunit I. Cytochr 96.32
TIGR02891524 CtaD_CoxA cytochrome c oxidase, subunit I; InterPro: IP 95.96
MTH00037517 COX1 cytochrome c oxidase subunit I; Provisional 95.59
MTH00048514 COX1 cytochrome c oxidase subunit I; Provisional 94.79
MTH00167513 COX1 cytochrome c oxidase subunit I; Provisional 94.33
MTH00052262 COX3 cytochrome c oxidase subunit III; Provisional 94.92
MTH00141259 COX3 cytochrome c oxidase subunit III; Provisional 94.07
pfam00510258 COX3 Cytochrome c oxidase subunit III. 93.94
MTH00039260 COX3 cytochrome c oxidase subunit III; Validated 93.87
MTH00155261 COX3 cytochrome c oxidase subunit III; Provisional 93.66
MTH00024261 COX3 cytochrome c oxidase subunit III; Validated 93.62
MTH00130261 COX3 cytochrome c oxidase subunit III; Provisional 93.58
MTH00083256 COX3 cytochrome c oxidase subunit III; Provisional 93.42
MTH00075261 COX3 cytochrome c oxidase subunit III; Provisional 93.2
MTH00118261 COX3 cytochrome c oxidase subunit III; Provisional 92.26
MTH00099261 COX3 cytochrome c oxidase subunit III; Validated 94.12
MTH00189260 COX3 cytochrome c oxidase subunit III; Provisional 92.98
>TIGR02843 CyoB cytochrome o ubiquinol oxidase, subunit I; InterPro: IPR014207 This entry represents subunit 1 (CyoB) of the cytochrome o terminal oxidase complex, which is a component of the aerobic respiratory chain that reacts with oxygen, reducing it to water with the concomitant transport of 4 protons across the membrane Back     alignment and domain information
>TIGR02882 QoxB cytochrome aa3 quinol oxidase, subunit I; InterPro: IPR014233 This entry represents subunit I of the aa3-type quinone oxidase, one of several terminal oxidases found in bacteria Back     alignment and domain information
>TIGR02891 CtaD_CoxA cytochrome c oxidase, subunit I; InterPro: IPR014241 This entry represents the bacterial-type cytochrome c oxidase subunit I (CtaD, CoxA, CaaA) Back     alignment and domain information
>MTH00153 COX1 cytochrome c oxidase subunit I; Provisional Back     alignment and domain information
>MTH00103 COX1 cytochrome c oxidase subunit I; Validated Back     alignment and domain information
>MTH00187 COX1 cytochrome c oxidase subunit I; Provisional Back     alignment and domain information
>MTH00128 COX1 cytochrome c oxidase subunit I; Provisional Back     alignment and domain information
>MTH00182 COX1 cytochrome c oxidase subunit I; Provisional Back     alignment and domain information
>MTH00116 COX1 cytochrome c oxidase subunit I; Provisional Back     alignment and domain information
>MTH00184 COX1 cytochrome c oxidase subunit I; Provisional Back     alignment and domain information
>MTH00078 COX1 cytochrome c oxidase subunit I; Provisional Back     alignment and domain information
>MTH00167 COX1 cytochrome c oxidase subunit I; Provisional Back     alignment and domain information
>MTH00077 COX1 cytochrome c oxidase subunit I; Provisional Back     alignment and domain information
>MTH00037 COX1 cytochrome c oxidase subunit I; Provisional Back     alignment and domain information
>MTH00183 COX1 cytochrome c oxidase subunit I; Provisional Back     alignment and domain information
>MTH00007 COX1 cytochrome c oxidase subunit I; Validated Back     alignment and domain information
>MTH00142 COX1 cytochrome c oxidase subunit I; Provisional Back     alignment and domain information
>MTH00026 COX1 cytochrome c oxidase subunit I; Provisional Back     alignment and domain information
>MTH00079 COX1 cytochrome c oxidase subunit I; Provisional Back     alignment and domain information
>MTH00048 COX1 cytochrome c oxidase subunit I; Provisional Back     alignment and domain information
>cd01663 Cyt_c_Oxidase_I Cytochrome C oxidase subunit I Back     alignment and domain information
>cd01662 Ubiquinol_Oxidase_I Ubiquinol oxidase subunit I Back     alignment and domain information
>COG0843 CyoB Heme/copper-type cytochrome/quinol oxidases, subunit 1 [Energy production and conversion] Back     alignment and domain information
>cd00919 Heme_Cu_Oxidase_I Heme-copper oxidase subunit I Back     alignment and domain information
>cd01660 ba3-like_Oxidase_I ba3-like heme-copper oxidase subunit I Back     alignment and domain information
>pfam00115 COX1 Cytochrome C and Quinol oxidase polypeptide I Back     alignment and domain information
>cd01661 cbb3_Oxidase_I Cytochrome cbb3 oxidase subunit I Back     alignment and domain information
>TIGR00780 ccoN cytochrome c oxidase, cbb3-type, subunit I; InterPro: IPR004677 This family represents the largest subunit, I, of the ccb3-type cytochrome c oxidase 1 Back     alignment and domain information
>COG3278 CcoN Cbb3-type cytochrome oxidase, subunit 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3256 NorB Nitric oxide reductase large subunit [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG4769 consensus Back     alignment and domain information
>cd01661 cbb3_Oxidase_I Cytochrome cbb3 oxidase subunit I Back     alignment and domain information
>pfam00115 COX1 Cytochrome C and Quinol oxidase polypeptide I Back     alignment and domain information
>cd01660 ba3-like_Oxidase_I ba3-like heme-copper oxidase subunit I Back     alignment and domain information
>cd00919 Heme_Cu_Oxidase_I Heme-copper oxidase subunit I Back     alignment and domain information
>cd01662 Ubiquinol_Oxidase_I Ubiquinol oxidase subunit I Back     alignment and domain information
>pfam12270 Cyt_c_ox_IV Cytochrome c oxidase subunit IV Back     alignment and domain information
>cd01663 Cyt_c_Oxidase_I Cytochrome C oxidase subunit I Back     alignment and domain information
>TIGR02891 CtaD_CoxA cytochrome c oxidase, subunit I; InterPro: IPR014241 This entry represents the bacterial-type cytochrome c oxidase subunit I (CtaD, CoxA, CaaA) Back     alignment and domain information
>MTH00037 COX1 cytochrome c oxidase subunit I; Provisional Back     alignment and domain information
>MTH00048 COX1 cytochrome c oxidase subunit I; Provisional Back     alignment and domain information
>MTH00167 COX1 cytochrome c oxidase subunit I; Provisional Back     alignment and domain information
>MTH00052 COX3 cytochrome c oxidase subunit III; Provisional Back     alignment and domain information
>MTH00141 COX3 cytochrome c oxidase subunit III; Provisional Back     alignment and domain information
>pfam00510 COX3 Cytochrome c oxidase subunit III Back     alignment and domain information
>MTH00039 COX3 cytochrome c oxidase subunit III; Validated Back     alignment and domain information
>MTH00155 COX3 cytochrome c oxidase subunit III; Provisional Back     alignment and domain information
>MTH00024 COX3 cytochrome c oxidase subunit III; Validated Back     alignment and domain information
>MTH00130 COX3 cytochrome c oxidase subunit III; Provisional Back     alignment and domain information
>MTH00083 COX3 cytochrome c oxidase subunit III; Provisional Back     alignment and domain information
>MTH00075 COX3 cytochrome c oxidase subunit III; Provisional Back     alignment and domain information
>MTH00118 COX3 cytochrome c oxidase subunit III; Provisional Back     alignment and domain information
>MTH00099 COX3 cytochrome c oxidase subunit III; Validated Back     alignment and domain information
>MTH00189 COX3 cytochrome c oxidase subunit III; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target671 cytochrome O ubiquinol oxidase subunit I [Candidatus Li
1fft_A663 The Structure Of Ubiquinol Oxidase From Escherichia 0.0
1v54_A514 Bovine Heart Cytochrome C Oxidase At The Fully Oxid 1e-128
1occ_A514 Structure Of Bovine Heart Cytochrome C Oxidase At T 1e-128
1ar1_A558 Structure At 2.7 Angstrom Resolution Of The Paracoc 1e-126
3ehb_A558 A D-Pathway Mutation Decouples The Paracoccus Denit 1e-126
1qle_A538 Cryo-Structure Of The Paracoccus Denitrificans Four 1e-125
1m57_A566 Structure Of Cytochrome C Oxidase From Rhodobacter 1e-122
1m56_A566 Structure Of Cytochrome C Oxidase From Rhodobactor 1e-122
3om3_A535 Catalytic Core Subunits (I And Ii) Of Cytochrome C 1e-116
3omi_A535 Catalytic Core Subunits (I And Ii) Of Cytochrome C 1e-116
gi|11514517|pdb|1FFT|A Chain A, The Structure Of Ubiquinol Oxidase From Escherichia Coli Length = 663 Back     alignment and structure
 Score =  693 bits (1788), Expect = 0.0,   Method: Composition-based stats.
 Identities = 405/660 (61%), Positives = 507/660 (76%), Gaps = 1/660 (0%)

Query: 11  IFGRLTINSIPYNIPIVLGTFFVVALVGVSIIFAITYYRLWGYLWKEWFTSVDHKKIGIM 70
           +FG+L+++++P++ PIV+ T   + L G++++  ITY+  W YLWKEW TSVDHK++GIM
Sbjct: 1   MFGKLSLDAVPFHEPIVMVTIAGIILGGLALVGLITYFGKWTYLWKEWLTSVDHKRLGIM 60

Query: 71  YIILSLVMLFRGFADAIMMRLQQAIASGGGEGYLDAHHYDQIFTAHGVIMIFFVAMPMIT 130
           YII+++VML RGFADAIMMR QQA+AS G  G+L  HHYDQIFTAHGVIMIFFVAMP + 
Sbjct: 61  YIIVAIVMLLRGFADAIMMRSQQALASAGEAGFLPPHHYDQIFTAHGVIMIFFVAMPFVI 120

Query: 131 GIMNFVVPLQIGARDVSFPFLNNFSFWMTVAGAVVIMCSLFIGEFASVGWLAYPPLSGIS 190
           G+MN VVPLQIGARDV+FPFLNN SFW TV G +++  SL +GEFA  GWLAYPPLSGI 
Sbjct: 121 GLMNLVVPLQIGARDVAFPFLNNLSFWFTVVGVILVNVSLGVGEFAQTGWLAYPPLSGIE 180

Query: 191 YSPGVGVDYYIWGLQIAGIGTTLSGINLVVTIIKMRCPGMTMMKMPVFVWTAFCSNIMII 250
           YSPGVGVDY+IW LQ++GIGTTL+GIN  VTI+KMR PGMTM KMPVF W + C+N++II
Sbjct: 181 YSPGVGVDYWIWSLQLSGIGTTLTGINFFVTILKMRAPGMTMFKMPVFTWASLCANVLII 240

Query: 251 AAFPILTATLFLLTLDRYIGTNFFTNHLGGNPMMYINLIWIWGHPEVYILVLPAFGIFSE 310
           A+FPILT T+ LLTLDRY+GT+FFTN +GGN MMYINLIW WGHPEVYIL+LP FG+FSE
Sbjct: 241 ASFPILTVTVALLTLDRYLGTHFFTNDMGGNMMMYINLIWAWGHPEVYILILPVFGVFSE 300

Query: 311 VVATFSGKRLFGYNSMVYATLAITILSYTVWLHHFFTMGSGANVNAFFGIMTMVIAVPTG 370
           + ATFS KRLFGY S+V+AT+ IT+LS+ VWLHHFFTMG+GANVNAFFGI TM+IA+PTG
Sbjct: 301 IAATFSRKRLFGYTSLVWATVCITVLSFIVWLHHFFTMGAGANVNAFFGITTMIIAIPTG 360

Query: 371 AKIFNWLFTMRLGKVRFEVPMMWTLGFMITFLIGGMTGVLLAVPPADFTLHNSLFLVAHF 430
            KIFNWLFTM  G++ F   M+WT+GF++TF +GGMTGVLLAVP ADF LHNSLFL+AHF
Sbjct: 361 VKIFNWLFTMYQGRIVFHSAMLWTIGFIVTFSVGGMTGVLLAVPGADFVLHNSLFLIAHF 420

Query: 431 HNTIIGGVVFGLFAGIVYWFPKAFGYQLNSFWGKVSFWCWFVGFYLAFMPLYALGLKGVT 490
           HN IIGGVVFG FAG+ YW+PKAFG++LN  WGK +FW W +GF++AFMPLYALG  G+T
Sbjct: 421 HNVIIGGVVFGCFAGMTYWWPKAFGFKLNETWGKRAFWFWIIGFFVAFMPLYALGFMGMT 480

Query: 491 RRLSQYEDTTLQVYYVVALLGAVLIGIGVFSFVLSFIVSFLNRSKLQDTIGDPWDGRTLE 550
           RRLSQ  D       ++A  GAVLI +G+   V+   VS  +R + +D  GDPW GRTLE
Sbjct: 481 RRLSQQIDPQFHTMLMIAASGAVLIALGILCLVIQMYVSIRDRDQNRDLTGDPWGGRTLE 540

Query: 551 WSISSPSPQYNFAFTPIVSTIDAWEHMKNRGYRY-PSEGFMPIHMPSNTATGIILAALSI 609
           W+ SSP P YNFA  P V   DA+  MK +G  Y   + +  IHMP N+  GI++AA S 
Sbjct: 541 WATSSPPPFYNFAVVPHVHERDAFWEMKEKGEAYKKPDHYEEIHMPKNSGAGIVIAAFST 600

Query: 610 VFSFAMVWYMWWLALLSFISIVFYTIFHTFNYNDGYEVSAKDVAFSEEVHRKMNMPKDRE 669
           +F FAM+W++WWLA++ F  ++   I  +F+ +  Y V   ++   E  H         +
Sbjct: 601 IFGFAMIWHIWWLAIVGFAGMIITWIVKSFDEDVDYYVPVAEIEKLENQHFDEITKAGLK 660


>gi|40889823|pdb|1V54|A Chain A, Bovine Heart Cytochrome C Oxidase At The Fully Oxidized State Length = 514 Back     alignment and structure
gi|1942986|pdb|1OCC|A Chain A, Structure Of Bovine Heart Cytochrome C Oxidase At The Fully Oxidized State Length = 514 Back     alignment and structure
gi|2914141|pdb|1AR1|A Chain A, Structure At 2.7 Angstrom Resolution Of The Paracoccus Denitrificans Two-Subunit Cytochrome C Oxidase Complexed With An Antibody Fv Fragment Length = 558 Back     alignment and structure
>gi|208435762|pdb|3EHB|A Chain A, A D-Pathway Mutation Decouples The Paracoccus Denitrificans Cytochrome C Oxidase By Altering The Side Chain Orientation Of A Distant, Conserved Glutamate Length = 558 Back     alignment and structure
>gi|6730476|pdb|1QLE|A Chain A, Cryo-Structure Of The Paracoccus Denitrificans Four-Subunit Cytochrome C Oxidase In The Completely Oxidized State Complexed With An Antibody Fv Fragment Length = 538 Back     alignment and structure
>gi|23200462|pdb|1M57|A Chain A, Structure Of Cytochrome C Oxidase From Rhodobacter Sphaeroides (Eq(I-286) Mutant)) Length = 566 Back     alignment and structure
gi|23200454|pdb|1M56|A Chain A, Structure Of Cytochrome C Oxidase From Rhodobactor Sphaeroides (Wild Type) Length = 566 Back     alignment and structure
>gi|321159889|pdb|3OM3|A Chain A, Catalytic Core Subunits (I And Ii) Of Cytochrome C Oxidase From Rhodobacter Sphaeroides With K362m Mutation In The Reduced State Length = 535 Back     alignment and structure
>gi|321159897|pdb|3OMI|A Chain A, Catalytic Core Subunits (I And Ii) Of Cytochrome C Oxidase From Rhodobacter Sphaeroides With D132a Mutation Length = 535 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target671 cytochrome O ubiquinol oxidase subunit I [Candidatus Li
1fft_A663 Ubiquinol oxidase; electron transport, cytochrome oxida 0.0
1v54_A514 Cytochrome C oxidase polypeptide I; oxidoreductase; HET 1e-137
2gsm_A566 Cytochrome C oxidase subunit 1; transmembrane protein c 1e-131
1xme_A568 Cytochrome C oxidase polypeptide I; cytochrome oxidase, 1e-76
3mk7_A474 Cytochrome C oxidase, CBB3-type, subunit N; TM helices, 5e-53
>1fft_A Ubiquinol oxidase; electron transport, cytochrome oxidase, membrane protein, oxidoreductase; HET: HEM HEO; 3.50A {Escherichia coli} SCOP: f.24.1.1 Length = 663 Back     alignment and structure
 Score =  704 bits (1819), Expect = 0.0
 Identities = 405/652 (62%), Positives = 506/652 (77%), Gaps = 1/652 (0%)

Query: 11  IFGRLTINSIPYNIPIVLGTFFVVALVGVSIIFAITYYRLWGYLWKEWFTSVDHKKIGIM 70
           +FG+L+++++P++ PIV+ T   + L G++++  ITY+  W YLWKEW TSVDHK++GIM
Sbjct: 1   MFGKLSLDAVPFHEPIVMVTIAGIILGGLALVGLITYFGKWTYLWKEWLTSVDHKRLGIM 60

Query: 71  YIILSLVMLFRGFADAIMMRLQQAIASGGGEGYLDAHHYDQIFTAHGVIMIFFVAMPMIT 130
           YII+++VML RGFADAIMMR QQA+AS G  G+L  HHYDQIFTAHGVIMIFFVAMP + 
Sbjct: 61  YIIVAIVMLLRGFADAIMMRSQQALASAGEAGFLPPHHYDQIFTAHGVIMIFFVAMPFVI 120

Query: 131 GIMNFVVPLQIGARDVSFPFLNNFSFWMTVAGAVVIMCSLFIGEFASVGWLAYPPLSGIS 190
           G+MN VVPLQIGARDV+FPFLNN SFW TV G +++  SL +GEFA  GWLAYPPLSGI 
Sbjct: 121 GLMNLVVPLQIGARDVAFPFLNNLSFWFTVVGVILVNVSLGVGEFAQTGWLAYPPLSGIE 180

Query: 191 YSPGVGVDYYIWGLQIAGIGTTLSGINLVVTIIKMRCPGMTMMKMPVFVWTAFCSNIMII 250
           YSPGVGVDY+IW LQ++GIGTTL+GIN  VTI+KMR PGMTM KMPVF W + C+N++II
Sbjct: 181 YSPGVGVDYWIWSLQLSGIGTTLTGINFFVTILKMRAPGMTMFKMPVFTWASLCANVLII 240

Query: 251 AAFPILTATLFLLTLDRYIGTNFFTNHLGGNPMMYINLIWIWGHPEVYILVLPAFGIFSE 310
           A+FPILT T+ LLTLDRY+GT+FFTN +GGN MMYINLIW WGHPEVYIL+LP FG+FSE
Sbjct: 241 ASFPILTVTVALLTLDRYLGTHFFTNDMGGNMMMYINLIWAWGHPEVYILILPVFGVFSE 300

Query: 311 VVATFSGKRLFGYNSMVYATLAITILSYTVWLHHFFTMGSGANVNAFFGIMTMVIAVPTG 370
           + ATFS KRLFGY S+V+AT+ IT+LS+ VWLHHFFTMG+GANVNAFFGI TM+IA+PTG
Sbjct: 301 IAATFSRKRLFGYTSLVWATVCITVLSFIVWLHHFFTMGAGANVNAFFGITTMIIAIPTG 360

Query: 371 AKIFNWLFTMRLGKVRFEVPMMWTLGFMITFLIGGMTGVLLAVPPADFTLHNSLFLVAHF 430
            KIFNWLFTM  G++ F   M+WT+GF++TF +GGMTGVLLAVP ADF LHNSLFL+AHF
Sbjct: 361 VKIFNWLFTMYQGRIVFHSAMLWTIGFIVTFSVGGMTGVLLAVPGADFVLHNSLFLIAHF 420

Query: 431 HNTIIGGVVFGLFAGIVYWFPKAFGYQLNSFWGKVSFWCWFVGFYLAFMPLYALGLKGVT 490
           HN IIGGVVFG FAG+ YW+PKAFG++LN  WGK +FW W +GF++AFMPLYALG  G+T
Sbjct: 421 HNVIIGGVVFGCFAGMTYWWPKAFGFKLNETWGKRAFWFWIIGFFVAFMPLYALGFMGMT 480

Query: 491 RRLSQYEDTTLQVYYVVALLGAVLIGIGVFSFVLSFIVSFLNRSKLQDTIGDPWDGRTLE 550
           RRLSQ  D       ++A  GAVLI +G+   V+   VS  +R + +D  GDPW GRTLE
Sbjct: 481 RRLSQQIDPQFHTMLMIAASGAVLIALGILCLVIQMYVSIRDRDQNRDLTGDPWGGRTLE 540

Query: 551 WSISSPSPQYNFAFTPIVSTIDAWEHMKNRGYRY-PSEGFMPIHMPSNTATGIILAALSI 609
           W+ SSP P YNFA  P V   DA+  MK +G  Y   + +  IHMP N+  GI++AA S 
Sbjct: 541 WATSSPPPFYNFAVVPHVHERDAFWEMKEKGEAYKKPDHYEEIHMPKNSGAGIVIAAFST 600

Query: 610 VFSFAMVWYMWWLALLSFISIVFYTIFHTFNYNDGYEVSAKDVAFSEEVHRK 661
           +F FAM+W++WWLA++ F  ++   I  +F+ +  Y V   ++   E  H  
Sbjct: 601 IFGFAMIWHIWWLAIVGFAGMIITWIVKSFDEDVDYYVPVAEIEKLENQHFD 652


>1v54_A Cytochrome C oxidase polypeptide I; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: f.24.1.1 PDB: 1oco_A* 1occ_A* 1ocz_A* 1ocr_A* 1v55_A* 2dyr_A* 2dys_A* 2eij_A* 2eik_A* 2eil_A* 2eim_A* 2ein_A* 2occ_A* 2zxw_A* Length = 514 Back     alignment and structure
>2gsm_A Cytochrome C oxidase subunit 1; transmembrane protein complex, oxidoreductase; HET: DMU HEA TRD; 2.00A {Rhodobacter sphaeroides} SCOP: f.24.1.1 PDB: 1m56_A* 3dtu_A* 3fye_A* 3fyi_A* 1m57_A* 3hb3_A* 1ar1_A* 3ehb_A* 1qle_A* Length = 566 Back     alignment and structure
>1xme_A Cytochrome C oxidase polypeptide I; cytochrome oxidase, heme, heme-AS, integral membrane protein, oxidoreductase; HET: BNG HEM HAS; 2.30A {Thermus thermophilus} SCOP: f.24.1.1 PDB: 2qpe_A* 2qpd_A* 3bvd_A* 1ehk_A* 3eh5_A* 3eh3_A* 3eh4_A* Length = 568 Back     alignment and structure
>3mk7_A Cytochrome C oxidase, CBB3-type, subunit N; TM helices, oxidoreductase; HET: HEM HEC FC6; 3.20A {Pseudomonas stutzeri} Length = 474 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target671 cytochrome O ubiquinol oxidase subunit I [Candidatus Li
1fft_A663 Ubiquinol oxidase; electron transport, cytochrome oxida 100.0
1v54_A514 Cytochrome C oxidase polypeptide I; oxidoreductase; HET 100.0
2gsm_A566 Cytochrome C oxidase subunit 1; transmembrane protein c 100.0
1xme_A568 Cytochrome C oxidase polypeptide I; cytochrome oxidase, 100.0
3mk7_A474 Cytochrome C oxidase, CBB3-type, subunit N; TM helices, 100.0
3mk7_A474 Cytochrome C oxidase, CBB3-type, subunit N; TM helices, 98.57
1xme_A568 Cytochrome C oxidase polypeptide I; cytochrome oxidase, 98.08
1fft_A663 Ubiquinol oxidase; electron transport, cytochrome oxida 97.68
1v54_A514 Cytochrome C oxidase polypeptide I; oxidoreductase; HET 96.77
2gsm_A566 Cytochrome C oxidase subunit 1; transmembrane protein c 96.2
>1fft_A Ubiquinol oxidase; electron transport, cytochrome oxidase, membrane protein, oxidoreductase; HET: HEM HEO; 3.50A {Escherichia coli} SCOP: f.24.1.1 Back     alignment and structure
Probab=100.00  E-value=0  Score=1679.38  Aligned_cols=657  Identities=62%  Similarity=1.165  Sum_probs=646.2

Q ss_pred             HHCCCCHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             60233521465757379999999999999999999750633234430300001479999999999999999999999999
Q gi|254780473|r   11 IFGRLTINSIPYNIPIVLGTFFVVALVGVSIIFAITYYRLWGYLWKEWFTSVDHKKIGIMYIILSLVMLFRGFADAIMMR   90 (671)
Q Consensus        11 ~~g~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~t~~~~w~~lw~~wltt~dHK~IGi~Yiv~a~~~ll~Gg~~allmR   90 (671)
                      ||||||||+|||||||++++++.++++++++++++||+|||+||||||+|||||||||++|+++|++++++|+++|++||
T Consensus         1 ~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~w~~~w~~wl~t~dHK~IG~~Yli~a~~~~l~Gg~~allmR   80 (663)
T 1fft_A            1 MFGKLSLDAVPFHEPIVMVTIAGIILGGLALVGLITYFGKWTYLWKEWLTSVDHKRLGIMYIIVAIVMLLRGFADAIMMR   80 (663)
T ss_dssp             ---------------------------------------------------CCHHHHHHHHHHHHHHHHHHHHHHHHHHT
T ss_pred             CCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             98756711168766779999999999999999999998688899876702367999999999999999999999999999


Q ss_pred             HHHCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             98507675667766878989999999999999999999999999999986498640058899999999999999999999
Q gi|254780473|r   91 LQQAIASGGGEGYLDAHHYDQIFTAHGVIMIFFVAMPMITGIMNFVVPLQIGARDVSFPFLNNFSFWMTVAGAVVIMCSL  170 (671)
Q Consensus        91 ~qla~p~~~~~~~l~~~~Ynq~~T~HG~~Mif~~a~p~~~G~~n~lvPl~iGardlaFPrlna~sfWl~~~g~~l~~~S~  170 (671)
                      +||+.|+.+.+++++||+|||++|+||++|+|+++||++.|++||++|+|+|||||||||+|++|||++++|+++++.|+
T Consensus        81 ~qla~~~~~~~~~l~~~~Y~q~~T~HG~~Mif~~~~p~~~Gf~n~lvPl~iGard~afPrLn~~sfWl~~~G~~l~~~s~  160 (663)
T 1fft_A           81 SQQALASAGEAGFLPPHHYDQIFTAHGVIMIFFVAMPFVIGLMNLVVPLQIGARDVAFPFLNNLSFWFTVVGVILVNVSL  160 (663)
T ss_dssp             TTTTSSSSCTTCCCSTHHHHHHHHHHHHHHHHTTSSHHHHHHHHHHHHHHHCCSSCSSHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99861688877778878898988998999999999999999999999997599731278899999999999999999998


Q ss_pred             HHCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHCCHHHHHHHHHHHHHH
Q ss_conf             71767788831347865587788520458877999999999875568999999723689883133156668999999999
Q gi|254780473|r  171 FIGEFASVGWLAYPPLSGISYSPGVGVDYYIWGLQIAGIGTTLSGINLVVTIIKMRCPGMTMMKMPVFVWTAFCSNIMII  250 (671)
Q Consensus       171 ~~g~~~~~GWt~YpPLs~~~~spg~g~d~~i~gl~l~gigsll~~iNfi~TI~~~RapGm~l~rmPlf~W~~l~tsil~i  250 (671)
                      +.|++|++|||+|||||+.+++|+.++|+|++|++++|+||+++++|+++||+|+|+|||+++|||+|+|+.++|+++++
T Consensus       161 ~~~~~a~~gWt~YpPLs~~~~~~g~~vd~~i~gl~l~gvgsll~~in~i~Ti~~~RapGm~l~rmPlf~w~~l~t~il~~  240 (663)
T 1fft_A          161 GVGEFAQTGWLAYPPLSGIEYSPGVGVDYWIWSLQLSGIGTTLTGINFFVTILKMRAPGMTMFKMPVFTWASLCANVLII  240 (663)
T ss_dssp             TTTCCCCSTTTTCTTTSSCSCTTCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCSCTTCCGGGCCHHHHHHHHHHHHHH
T ss_pred             HCCCCCCCCCEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHH
T ss_conf             25887777742166742335688630899999999999999999999999999980599952027606789999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHCCCEECCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHH
Q ss_conf             97333578889987776329801146543210132212333401257999987999999998531056402668999999
Q gi|254780473|r  251 AAFPILTATLFLLTLDRYIGTNFFTNHLGGNPMMYINLIWIWGHPEVYILVLPAFGIFSEVVATFSGKRLFGYNSMVYAT  330 (671)
Q Consensus       251 ~a~PvL~~al~ll~lDr~~g~~FF~~~~GGdplL~q~LFW~fGHPeVYIliLPa~Gi~seiip~fs~kplfgy~~~v~A~  330 (671)
                      +++|+++++++++++||++|++||+++.||||+|||||||+||||||||+++||+|++||++|++||||+|||+.+++|+
T Consensus       241 la~P~la~a~~~llldr~~g~~ff~~~~GGdplL~q~LFW~fGHPeVYi~iLPa~Gi~seiip~~s~k~lfg~~~~v~A~  320 (663)
T 1fft_A          241 ASFPILTVTVALLTLDRYLGTHFFTNDMGGNMMMYINLIWAWGHPEVYILILPVFGVFSEIAATFSRKRLFGYTSLVWAT  320 (663)
T ss_dssp             HTTHHHHHHHHHHHHHHHHCCCSSCTTTTCCHHHHHHHHHHHHHHHHHHTTHHHHHHHHHHHHHHHTSCCSSHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCEEECCCCCCHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHH
T ss_conf             99788899999999887558752103678728899999998188177765987879999974875088774649999999


Q ss_pred             HHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEECHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999975332210224787588998765334678898779999878742587302243799999999999988755653
Q gi|254780473|r  331 LAITILSYTVWLHHFFTMGSGANVNAFFGIMTMVIAVPTGAKIFNWLFTMRLGKVRFEVPMMWTLGFMITFLIGGMTGVL  410 (671)
Q Consensus       331 ~~i~~lsf~VW~HHmFt~G~~~~~~~~F~i~Tm~IaIPTgvkiFnwl~Tl~~G~ir~~~pml~~lgfi~~F~iGG~tGv~  410 (671)
                      ++|+++|+.||.|||||+|.++..|.+|+++||+|++|||+|+|||++|+|+||+|+++||+|+++|+++|++||+||++
T Consensus       321 ~~i~~lsf~VW~HHmft~g~~~~~~~~f~i~T~~IaiPtgvkvFnwl~Tl~~g~i~~~~pml~~lgfi~~F~iGG~tGv~  400 (663)
T 1fft_A          321 VCITVLSFIVWLHHFFTMGAGANVNAFFGITTMIIAIPTGVKIFNWLFTMYQGRIVFHSAMLWTIGFIVTFSVGGMTGVL  400 (663)
T ss_dssp             HHHHHTTSSCGGGGTTTTTCCHHHHHHHHHHHHHTTHHHHHHHHHHHHTTTTCCCCCSHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHCCEECCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEECCCHHHHHHHHHHHHHHHHHCHHH
T ss_conf             99999998863201003688747787899999999999999999999986268530350789999999999986102243


Q ss_pred             CCCCCCCEEECCCEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             03432111212742204478999999999999999999624430767471689999999999999999999998764053
Q gi|254780473|r  411 LAVPPADFTLHNSLFLVAHFHNTIIGGVVFGLFAGIVYWFPKAFGYQLNSFWGKVSFWCWFVGFYLAFMPLYALGLKGVT  490 (671)
Q Consensus       411 lA~~~~D~~lHnT~fVVAHFHyvl~gg~vf~~fagiyyW~Pk~~Gr~l~e~lgk~~Fwl~~iGf~l~F~pm~~lGl~Gmp  490 (671)
                      +|+.++|+++||||||||||||++++|++|++|||+|||+||++||++|||+||+|||++++|++++|+|||++|++|||
T Consensus       401 la~~~~d~~~HnT~fVVaHFH~vl~gg~vf~~fag~yyw~Pk~tGr~l~e~lg~~~fwl~fiG~~l~f~pmh~lGl~GmP  480 (663)
T 1fft_A          401 LAVPGADFVLHNSLFLIAHFHNVIIGGVVFGCFAGMTYWWPKAFGFKLNETWGKRAFWFWIIGFFVAFMPLYALGFMGMT  480 (663)
T ss_dssp             HTSHHHHHTTTTBHHHHHHHHHHHHTTTHHHHHHHHHHHHHHHHSCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCB
T ss_pred             HHHHHHHHHHHCCCEEECCHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCC
T ss_conf             21377778862563664632434688999999999999999874440438899999999999899999999998728998


Q ss_pred             HHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEECC
Q ss_conf             03002587005799999999999999999999999999974495356899989999710126998119989475960784
Q gi|254780473|r  491 RRLSQYEDTTLQVYYVVALLGAVLIGIGVFSFVLSFIVSFLNRSKLQDTIGDPWDGRTLEWSISSPSPQYNFAFTPIVST  570 (671)
Q Consensus       491 RR~~~y~~~~~~~~n~istiGa~l~~~g~l~f~~nl~~S~~~~~~~~~~~~dPW~~~tLEW~~~sPpp~~nF~~~P~v~~  570 (671)
                      ||+++|+|++|++||+++++|++++++|+++|++|+++|+|+|++.+++++||||+|||||+|+||||+|||+++|+|++
T Consensus       481 RR~~~y~~~~~~~~n~vssiGa~i~~~g~l~f~~~i~~si~~~~~~~~~~~~PW~~~tLEW~~~sPpp~~nf~~~P~v~~  560 (663)
T 1fft_A          481 RRLSQQIDPQFHTMLMIAASGAVLIALGILCLVIQMYVSIRDRDQNRDLTGDPWGGRTLEWATSSPPPFYNFAVVPHVHE  560 (663)
T ss_dssp             TTCSCCCCTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHSSCCCCCCSCSSCTTCCCTTTTSCSSCCTTCC--------
T ss_pred             CCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             73577887035999999999999999999999999999999520467788999999983559899999877788881157


Q ss_pred             CCCHHHHHHCCCCC-CCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEECH
Q ss_conf             55047755539767-76787366189988589999999999999999999999999999999999999831489845567
Q gi|254780473|r  571 IDAWEHMKNRGYRY-PSEGFMPIHMPSNTATGIILAALSIVFSFAMVWYMWWLALLSFISIVFYTIFHTFNYNDGYEVSA  649 (671)
Q Consensus       571 ~d~~~~~k~~~~~~-~~~~~~~ihmP~~t~~~~~~~~~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  649 (671)
                      |||+||+|++|++. ++++|||||||+||++|+++++++++++|+++||+||++++|++++++|++.||+|+|+|||||+
T Consensus       561 ~~~~~~~~~~~~~~~~~~~~~~ihmp~~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  640 (663)
T 1fft_A          561 RDAFWEMKEKGEAYKKPDHYEEIHMPKNSGAGIVIAAFSTIFGFAMIWHIWWLAIVGFAGMIITWIVKSFDEDVDYYVPV  640 (663)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEECCH
T ss_conf             87430133146667898888898599997089999999999999999999999999999999999999955899914379


Q ss_pred             HHHHHHHHHHHHCCCCCC
Q ss_conf             899999999751255000
Q gi|254780473|r  650 KDVAFSEEVHRKMNMPKD  667 (671)
Q Consensus       650 ~~~~~~e~~~~~~~~~~~  667 (671)
                      |||+|+|++|.+...+++
T Consensus       641 ~~~~~~~~~~~~~~~~~~  658 (663)
T 1fft_A          641 AEIEKLENQHFDEITKAG  658 (663)
T ss_dssp             ------------------
T ss_pred             HHHHHHHHHHHHHHHHCC
T ss_conf             999999999999998614



>1v54_A Cytochrome C oxidase polypeptide I; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: f.24.1.1 PDB: 1oco_A* 1occ_A* 1ocz_A* 1ocr_A* 1v55_A* 2dyr_A* 2dys_A* 2eij_A* 2eik_A* 2eil_A* 2eim_A* 2ein_A* 2occ_A* 2zxw_A* 3abk_A* 3abl_A* 3abm_A* 3ag1_A* 3ag2_A* 3ag3_A* ... Back     alignment and structure
>2gsm_A Cytochrome C oxidase subunit 1; transmembrane protein complex, oxidoreductase; HET: DMU HEA TRD; 2.00A {Rhodobacter sphaeroides} SCOP: f.24.1.1 PDB: 1m56_A* 3dtu_A* 3fye_A* 3fyi_A* 1m57_A* 3hb3_A* 1ar1_A* 3ehb_A* 1qle_A* Back     alignment and structure
>1xme_A Cytochrome C oxidase polypeptide I; cytochrome oxidase, heme, heme-AS, integral membrane protein, oxidoreductase; HET: BNG HEM HAS; 2.30A {Thermus thermophilus} SCOP: f.24.1.1 PDB: 2qpe_A* 2qpd_A* 3bvd_A* 1ehk_A* 3eh5_A* 3eh3_A* 3eh4_A* Back     alignment and structure
>3mk7_A Cytochrome C oxidase, CBB3-type, subunit N; TM helices, oxidoreductase; HET: HEM HEC FC6; 3.20A {Pseudomonas stutzeri} Back     alignment and structure
>3mk7_A Cytochrome C oxidase, CBB3-type, subunit N; TM helices, oxidoreductase; HET: HEM HEC FC6; 3.20A {Pseudomonas stutzeri} Back     alignment and structure
>1xme_A Cytochrome C oxidase polypeptide I; cytochrome oxidase, heme, heme-AS, integral membrane protein, oxidoreductase; HET: BNG HEM HAS; 2.30A {Thermus thermophilus} SCOP: f.24.1.1 PDB: 2qpe_A* 2qpd_A* 3bvd_A* 1ehk_A* 3eh5_A* 3eh3_A* 3eh4_A* Back     alignment and structure
>1fft_A Ubiquinol oxidase; electron transport, cytochrome oxidase, membrane protein, oxidoreductase; HET: HEM HEO; 3.50A {Escherichia coli} SCOP: f.24.1.1 Back     alignment and structure
>1v54_A Cytochrome C oxidase polypeptide I; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: f.24.1.1 PDB: 1oco_A* 1occ_A* 1ocz_A* 1ocr_A* 1v55_A* 2dyr_A* 2dys_A* 2eij_A* 2eik_A* 2eil_A* 2eim_A* 2ein_A* 2occ_A* 2zxw_A* 3abk_A* 3abl_A* 3abm_A* 3ag1_A* 3ag2_A* 3ag3_A* ... Back     alignment and structure
>2gsm_A Cytochrome C oxidase subunit 1; transmembrane protein complex, oxidoreductase; HET: DMU HEA TRD; 2.00A {Rhodobacter sphaeroides} SCOP: f.24.1.1 PDB: 1m56_A* 3dtu_A* 3fye_A* 3fyi_A* 1m57_A* 3hb3_A* 1ar1_A* 3ehb_A* 1qle_A* Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 671 cytochrome O ubiquinol oxidase subunit I [Candidatus Li
d1v54a_514 f.24.1.1 (A:) Mitochondrial cytochrome c oxidase, subun 1e-131
d3dtua1538 f.24.1.1 (A:14-551) Bacterial aa3 type cytochrome c oxi 1e-126
d1ffta_501 f.24.1.1 (A:) Cytochrome O ubiquinol oxidase, subunit I 1e-113
d1xmea1549 f.24.1.1 (A:14-562) Bacterial ba3 type cytochrome c oxi 8e-72
>d1v54a_ f.24.1.1 (A:) Mitochondrial cytochrome c oxidase, subunit I {Cow (Bos taurus) [TaxId: 9913]} Length = 514 Back     information, alignment and structure

class: Membrane and cell surface proteins and peptides
fold: Cytochrome c oxidase subunit I-like
superfamily: Cytochrome c oxidase subunit I-like
family: Cytochrome c oxidase subunit I-like
domain: Mitochondrial cytochrome c oxidase, subunit I
species: Cow (Bos taurus) [TaxId: 9913]
 Score =  463 bits (1194), Expect = e-131
 Identities = 192/518 (37%), Positives = 293/518 (56%), Gaps = 9/518 (1%)

Query: 55  WKEWFTSVDHKKIGIMYIILSLVMLFRGFADAIMMRLQQAIASGGGEGYLDAHHYDQIFT 114
              W  S +HK IG +Y++        G A ++++R +       G    D   Y+ + T
Sbjct: 3   INRWLFSTNHKDIGTLYLLFGAWAGMVGTALSLLIRAELGQP---GTLLGDDQIYNVVVT 59

Query: 115 AHGVIMIFFVAMP-MITGIMNFVVPLQIGARDVSFPFLNNFSFWMTVAGAVVIMCSLFIG 173
           AH  +MIFF+ MP MI G  N++VPL IGA D++FP +NN SFW+     ++++ S  + 
Sbjct: 60  AHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASSMVE 119

Query: 174 EFASVGWLAYPPLSGISYSPGVGVDYYIWGLQIAGIGTTLSGINLVVTIIKMRCPGMTMM 233
             A  GW  YPPL+G     G  VD  I+ L +AG+ + L  IN + TII M+ P M+  
Sbjct: 120 AGAGTGWTVYPPLAGNLAHAGASVDLTIFSLHLAGVSSILGAINFITTIINMKPPAMSQY 179

Query: 234 KMPVFVWTAFCSNIMIIAAFPILTATLFLLTLDRYIGTNFFTNHLGGNPMMYINLIWIWG 293
           + P+FVW+   + ++++ + P+L A + +L  DR + T FF    GG+P++Y +L W +G
Sbjct: 180 QTPLFVWSVMITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHLFWFFG 239

Query: 294 HPEVYILVLPAFGIFSEVVATFSGKR-LFGYNSMVYATLAITILSYTVWLHHFFTMGSGA 352
           HPEVYIL+LP FG+ S +V  +SGK+  FGY  MV+A ++I  L + VW HH FT+G   
Sbjct: 240 HPEVYILILPGFGMISHIVTYYSGKKEPFGYMGMVWAMMSIGFLGFIVWAHHMFTVGMDV 299

Query: 353 NVNAFFGIMTMVIAVPTGAKIFNWLFTMRLGKVRFEVPMMWTLGFMITFLIGGMTGVLLA 412
           +  A+F   TM+IA+PTG K+F+WL T+  G +++   MMW LGF+  F +GG+TG++LA
Sbjct: 300 DTRAYFTSATMIIAIPTGVKVFSWLATLHGGNIKWSPAMMWALGFIFLFTVGGLTGIVLA 359

Query: 413 VPPADFTLHNSLFLVAHFHNTIIGGVVFGLFAGIVYWFPKAFGYQLNSFWGKVSFWCWFV 472
               D  LH++ ++VAHFH  +  G VF +  G V+WFP   GY LN  W K+ F   FV
Sbjct: 360 NSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMGGFVHWFPLFSGYTLNDTWAKIHFAIMFV 419

Query: 473 GFYLAFMPLYALGLKGVTRRLSQYEDTTLQVYYVVALLGAVLIGIGVFSFVLSFIVSFLN 532
           G  + F P + LGL G+ RR S Y D    ++  ++ +G+ +    V   V     +F +
Sbjct: 420 GVNMTFFPQHFLGLSGMPRRYSDYPD-AYTMWNTISSMGSFISLTAVMLMVFIIWEAFAS 478

Query: 533 RSKLQDTIGDPWDGRTLEWSISSPSPQYNFAFTPIVST 570
           +   ++ +        LEW    P P + F     V+ 
Sbjct: 479 K---REVLTVDLTTTNLEWLNGCPPPYHTFEEPTYVNL 513


>d3dtua1 f.24.1.1 (A:14-551) Bacterial aa3 type cytochrome c oxidase subunit I {Rhodobacter sphaeroides [TaxId: 1063]} Length = 538 Back     information, alignment and structure
>d1ffta_ f.24.1.1 (A:) Cytochrome O ubiquinol oxidase, subunit I {Escherichia coli [TaxId: 562]} Length = 501 Back     information, alignment and structure
>d1xmea1 f.24.1.1 (A:14-562) Bacterial ba3 type cytochrome c oxidase subunit I {Thermus thermophilus [TaxId: 274]} Length = 549 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target671 cytochrome O ubiquinol oxidase subunit I [Candidatus Li
d1v54a_514 Mitochondrial cytochrome c oxidase, subunit I {Cow (Bos 100.0
d3dtua1538 Bacterial aa3 type cytochrome c oxidase subunit I {Rhod 100.0
d1ffta_501 Cytochrome O ubiquinol oxidase, subunit I {Escherichia 100.0
d1xmea1549 Bacterial ba3 type cytochrome c oxidase subunit I {Ther 100.0
d1xmea1549 Bacterial ba3 type cytochrome c oxidase subunit I {Ther 98.14
d3dtua1538 Bacterial aa3 type cytochrome c oxidase subunit I {Rhod 97.55
d1ffta_501 Cytochrome O ubiquinol oxidase, subunit I {Escherichia 97.16
d1v54a_514 Mitochondrial cytochrome c oxidase, subunit I {Cow (Bos 95.63
>d1v54a_ f.24.1.1 (A:) Mitochondrial cytochrome c oxidase, subunit I {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
class: Membrane and cell surface proteins and peptides
fold: Cytochrome c oxidase subunit I-like
superfamily: Cytochrome c oxidase subunit I-like
family: Cytochrome c oxidase subunit I-like
domain: Mitochondrial cytochrome c oxidase, subunit I
species: Cow (Bos taurus) [TaxId: 9913]
Probab=100.00  E-value=0  Score=1289.25  Aligned_cols=511  Identities=37%  Similarity=0.760  Sum_probs=500.5

Q ss_pred             HHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHH-HH
Q ss_conf             44303000014799999999999999999999999999850767566776687898999999999999999999999-99
Q gi|254780473|r   54 LWKEWFTSVDHKKIGIMYIILSLVMLFRGFADAIMMRLQQAIASGGGEGYLDAHHYDQIFTAHGVIMIFFVAMPMIT-GI  132 (671)
Q Consensus        54 lw~~wltt~dHK~IGi~Yiv~a~~~ll~Gg~~allmR~qla~p~~~~~~~l~~~~Ynq~~T~HG~~Mif~~a~p~~~-G~  132 (671)
                      .||+|+|||||||||++|++++++++++|+++|++||+||+.|+   ..+.++|.|||++|+||++|+|+++||++. ||
T Consensus         2 f~~~w~~t~dHK~iG~lYl~~~~~~~~~G~~lslliR~eL~~p~---~~~~~~~~Yn~~~T~Hg~iMiF~~~~P~~~ggF   78 (514)
T d1v54a_           2 FINRWLFSTNHKDIGTLYLLFGAWAGMVGTALSLLIRAELGQPG---TLLGDDQIYNVVVTAHAFVMIFFMVMPIMIGGF   78 (514)
T ss_dssp             HHHHHTSCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHSSSS---CSSCSHHHHHHHHHHHHHHHHHTTHHHHHTTHH
T ss_pred             CHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC---CCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             47775102778999999999999999999999999999876997---667982389998999999999999999999999


Q ss_pred             HHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             99999986498640058899999999999999999999717677888313478655877885204588779999999998
Q gi|254780473|r  133 MNFVVPLQIGARDVSFPFLNNFSFWMTVAGAVVIMCSLFIGEFASVGWLAYPPLSGISYSPGVGVDYYIWGLQIAGIGTT  212 (671)
Q Consensus       133 ~n~lvPl~iGardlaFPrlna~sfWl~~~g~~l~~~S~~~g~~~~~GWt~YpPLs~~~~spg~g~d~~i~gl~l~gigsl  212 (671)
                      +||++|+|+|||||||||+|++|||+++.|.+++..|.+.++++++|||+|||||+.+++++.++|++++++++.|+||+
T Consensus        79 gn~lvPl~iGa~dmafPRlN~~sfWl~~~~~~ll~~s~~~~~g~~~GWT~YpPLs~~~~~~~~~vdl~i~~l~l~gissi  158 (514)
T d1v54a_          79 GNWLVPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASSMVEAGAGTGWTVYPPLAGNLAHAGASVDLTIFSLHLAGVSSI  158 (514)
T ss_dssp             HHHHHHHHTTCSSCSSHHHHHHHHHTHHHHHHHHHHHHHSTTCCCSTTTTCTTTTSTTTTCSSHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHH
T ss_conf             99999985699643437789999999999999999997148889886634655204687898579999999999999999


Q ss_pred             HHHHHHHHHHHHHCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEECCCCCCCCHHHHHHHHHHH
Q ss_conf             75568999999723689883133156668999999999973335788899877763298011465432101322123334
Q gi|254780473|r  213 LSGINLVVTIIKMRCPGMTMMKMPVFVWTAFCSNIMIIAAFPILTATLFLLTLDRYIGTNFFTNHLGGNPMMYINLIWIW  292 (671)
Q Consensus       213 l~~iNfi~TI~~~RapGm~l~rmPlf~W~~l~tsil~i~a~PvL~~al~ll~lDr~~g~~FF~~~~GGdplL~q~LFW~f  292 (671)
                      ++++|+++||.|+|+|||+++|+|+|+|+.++|++++++++|+|+++++++++||++|++||+++.||||+|||||||+|
T Consensus       159 lg~iNfi~Ti~~~r~~gm~~~r~Plf~Ws~~vtsil~l~a~PvLa~a~~~ll~dr~~gt~ff~~~~Ggdp~L~qhLFWff  238 (514)
T d1v54a_         159 LGAINFITTIINMKPPAMSQYQTPLFVWSVMITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHLFWFF  238 (514)
T ss_dssp             HHHHHHHHHHHHSSCTTCCGGGSCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHSCCCSSCGGGTCCHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEECCCCCCCHHHHHHHHHHC
T ss_conf             98899999998761688741466068999999999999998999999999999985798304777786799999999854


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHC-CCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHH
Q ss_conf             012579999879999999985310-5640266899999999999975332210224787588998765334678898779
Q gi|254780473|r  293 GHPEVYILVLPAFGIFSEVVATFS-GKRLFGYNSMVYATLAITILSYTVWLHHFFTMGSGANVNAFFGIMTMVIAVPTGA  371 (671)
Q Consensus       293 GHPeVYIliLPa~Gi~seiip~fs-~kplfgy~~~v~A~~~i~~lsf~VW~HHmFt~G~~~~~~~~F~i~Tm~IaIPTgv  371 (671)
                      ||||||+++|||+|++||++|+++ |||+|||+.+++|+++|+++|+.||+|||||+|++++.|.+|+++|++|+|||++
T Consensus       239 gHPeVYi~iLPa~g~~s~ii~~~s~rk~~fg~~~~v~a~~~i~~ls~~Vw~HHmft~g~~~~~~~~f~~~T~~IaiPt~v  318 (514)
T d1v54a_         239 GHPEVYILILPGFGMISHIVTYYSGKKEPFGYMGMVWAMMSIGFLGFIVWAHHMFTVGMDVDTRAYFTSATMIIAIPTGV  318 (514)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHTTCSSCTTHHHHHHHHHHHHHHTTSCGGGGCTTSCCCHHHHHHHHHHHHHTHHHHHH
T ss_pred             CCCEEEEEHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCEEECCCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             88602212998899999999987388745571999999999999820112346221388688899999999999987899


Q ss_pred             HHHHHHHHHCCCCCEECHHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEECCCEEHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99987874258730224379999999999998875565303432111212742204478999999999999999999624
Q gi|254780473|r  372 KIFNWLFTMRLGKVRFEVPMMWTLGFMITFLIGGMTGVLLAVPPADFTLHNSLFLVAHFHNTIIGGVVFGLFAGIVYWFP  451 (671)
Q Consensus       372 kiFnwl~Tl~~G~ir~~~pml~~lgfi~~F~iGG~tGv~lA~~~~D~~lHnT~fVVAHFHyvl~gg~vf~~fagiyyW~P  451 (671)
                      |+|||++|+|+|++|+++||+|+++|+++|++||+||+++|+++.|.++||||||||||||++.+|++++++||+|||+|
T Consensus       319 kvfnwi~T~~~g~~~~~~~~l~~l~fi~~F~~GG~tGi~la~~~~D~~lHdTy~VVaHFH~vl~~g~v~~~~a~~y~w~P  398 (514)
T d1v54a_         319 KVFSWLATLHGGNIKWSPAMMWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMGGFVHWFP  398 (514)
T ss_dssp             HHHHHHHHHTTCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHTTBHHHHHHHHHHHTTHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHEECCCCHHHEEECCCEEEEEEEEEEEEHHHHHHHHHHHHHHHH
T ss_conf             99999998618865688788999999999998642120115313331332550577323465344899999999999998


Q ss_pred             HHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             43076747168999999999999999999999876405303002587005799999999999999999999999999974
Q gi|254780473|r  452 KAFGYQLNSFWGKVSFWCWFVGFYLAFMPLYALGLKGVTRRLSQYEDTTLQVYYVVALLGAVLIGIGVFSFVLSFIVSFL  531 (671)
Q Consensus       452 k~~Gr~l~e~lgk~~Fwl~~iGf~l~F~pm~~lGl~GmpRR~~~y~~~~~~~~n~istiGa~l~~~g~l~f~~nl~~S~~  531 (671)
                      |++||++|||++|+|||++++|+|++|+|||++|++|||||+++|++ +|++||+++++|+++++++++++++|++.|++
T Consensus       399 k~~Gr~~~e~l~~~~f~~~fiG~~~~f~pmh~lGl~GmpRR~~~Y~~-~~~~~n~~~siG~~i~~~~~~~f~~~~~~s~~  477 (514)
T d1v54a_         399 LFSGYTLNDTWAKIHFAIMFVGVNMTFFPQHFLGLSGMPRRYSDYPD-AYTMWNTISSMGSFISLTAVMLMVFIIWEAFA  477 (514)
T ss_dssp             HHHSBCCCHHHHHHHHHHHHHHHHHHHTHHHHHHHTTCBTTCSSCCG-GGHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             15686067888999999999999999999999765899773667847-79999999999999999999999999999998


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEECCC
Q ss_conf             4953568999899997101269981199894759607845
Q gi|254780473|r  532 NRSKLQDTIGDPWDGRTLEWSISSPSPQYNFAFTPIVSTI  571 (671)
Q Consensus       532 ~~~~~~~~~~dPW~~~tLEW~~~sPpp~~nF~~~P~v~~~  571 (671)
                      +|||+.   .|||+++||||+++||||+|||++.|+|+-+
T Consensus       478 ~~~~~~---~~pw~~~tlEW~~~sPpp~~nF~~~p~v~~~  514 (514)
T d1v54a_         478 SKREVL---TVDLTTTNLEWLNGCPPPYHTFEEPTYVNLK  514 (514)
T ss_dssp             HCCBBC---CCTTGGGCGGGTTCSSCCSSCCSSCCEECCC
T ss_pred             HCCCCC---CCCCCCCCHHHCCCCCCCCCCCCCCCCCCCC
T ss_conf             588778---9999999821066999998787999824789



>d3dtua1 f.24.1.1 (A:14-551) Bacterial aa3 type cytochrome c oxidase subunit I {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1ffta_ f.24.1.1 (A:) Cytochrome O ubiquinol oxidase, subunit I {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xmea1 f.24.1.1 (A:14-562) Bacterial ba3 type cytochrome c oxidase subunit I {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xmea1 f.24.1.1 (A:14-562) Bacterial ba3 type cytochrome c oxidase subunit I {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d3dtua1 f.24.1.1 (A:14-551) Bacterial aa3 type cytochrome c oxidase subunit I {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1ffta_ f.24.1.1 (A:) Cytochrome O ubiquinol oxidase, subunit I {Escherichia coli [TaxId: 562]} Back     information, alignment and structure