254780478

254780478

hypothetical protein CLIBASIA_01815

GeneID in NCBI database:8209467Locus tag:CLIBASIA_01815
Protein GI in NCBI database:254780478Protein Accession:YP_003064891.1
Gene range:-(399950, 400435)Protein Length:161aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:Argininosuccinate synthase
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOP1 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-
MIHFSQVIDDLLDPFLRRRAGISMSLVSAWSEIVGSNIARCCRPEKIIWPNRTSIERQDISSDVSGTLIIACEGSHALFLMHDQSKIIRNVNIFFGFCAIKRIRFLQRSMSIVNQAPSVSIPALEKDDCEKIDKMTEGIKDEQLKRALIRFGHAVVGCSYL
cccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcccEEEEcccccccccccccccccEEEEEEEccccHHHHHHHHHHHHHHHHHHccccccEEEEEEEccccccccccccccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccc
cccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcHHHHHHccccEEEEccccccccccccccccEEEEEEEcccHHHHHHHcHHHHHHHHHHHHcHHHEEEEEEEEccccccccccccccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcc
MIHFSQVIDDLLDPFLRRRAGISMSLVSAWSEIVgsniarccrpekiiwpnrtsierqdissdvsGTLIIACEGSHALFLMHDQSKIIRNVNIFFGFCAIKRIRFLQRSMSivnqapsvsipalekddceKIDKMTEGIKDEQLKRALIRFGHAVVGCSYL
MIHFSQVIDDLLDPFLRRRAGISMSLVSAWSEIVgsniarccrpekiiwpnrtsierqdisSDVSGTLIIACEGSHALFLMHDQSKIIRNVNIFFGFCAIKRIRFLQRSMSIVnqapsvsipalekddCEKIDKMTEGIKDEQLKRALIRFGHAVVGCSYL
MIHFSQVIDDLLDPFLRRRAGISMSLVSAWSEIVGSNIARCCRPEKIIWPNRTSIERQDISSDVSGTLIIACEGSHALFLMHDQSKIIRNVNIFFGFCAIKRIRFLQRSMSIVNQAPSVSIPALEKDDCEKIDKMTEGIKDEQLKRALIRFGHAVVGCSYL
**HFSQVIDDLLDPFLRRRAGISMSLVSAWSEIVGSNIARCCRPEKIIWPNRTSIERQDISSDVSGTLIIACEGSHALFLMHDQSKIIRNVNIFFGFCAIKRIR**************************************QLKRALIRFGHAVV*****
MIHFSQVIDDLLDPFLRRRAGISMSLVSAWSEIVGSNIARCCRPEKIIWPNRTSIERQDISSDVSGTLIIACEGSHALFLMHDQSKIIRNVNIFFGFCAIKRIRFLQRSMSIVNQAPSVSIPALEKDDCEKIDKMTEGIKDEQLKRALIRFGHAVVGCSYL
MIHFSQVIDDLLDPFLRRRAGISMSLVSAWSEIVGSNIARCCRPEKIIWPNRTSIERQDISSDVSGTLIIACEGSHALFLMHDQSKIIRNVNIFFGFCAIKRIRFLQRSMSI********IPALEKDDCEKIDKMTEGIKDEQLKRALIRFGHAVVGCSYL
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIHFSQVIDDLLDPFLRRRAGISMSLVSAWSEIVGSNIARCCRPEKIIWPNRTSIERQDISSDVSGTLIIACEGSHALFLMHDQSKIIRNVNIFFGFCAIKRIRFLQRSMSIVNQAPSVSIPALEKDDCEKIDKMTEGIKDEQLKRALIRFGHAVVGCSYL
MIHFSQVIDDLLDPFLRRRAGISMSLVSAWSEIVGSNIARCCRPEKIIWPNRTSIERQDISSDVSGTLIIACEGSHALFLMHDQSKIIRNVNIFFGFCAIKRIRFLQRSMSIVNQAPSVSIPALEKDDCEKIDKMTEGIKDEQLKRALIRFGHAVVGCSYL
MIHFSQVIDDLLDPFLRRRAGISMSLVSAWSEIVGSNIARCCRPEKIIWPNRTSIERQDISSDVSGTLIIACEGSHALFLMHDQSKIIRNVNIFFGFCAIKRIRFLQRSMSIVNQAPSVSIPALEKDDCEKIDKMTEGIKDEQLKRALIRFGHAVVGCSYL

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target161 hypothetical protein CLIBASIA_01815 [Candidatus Liberib
315122066171 hypothetical protein CKC_01580 [Candidatus Liberibacter 1 4e-63
241203454163 hypothetical protein Rleg_0708 [Rhizobium leguminosarum 1 8e-29
150395768168 hypothetical protein Smed_0544 [Sinorhizobium medicae W 1 2e-28
190890709164 hypothetical protein RHECIAT_CH0001088 [Rhizobium etli 1 2e-28
15888142175 hypothetical protein Atu8137 [Agrobacterium tumefaciens 1 2e-28
222147828182 hypothetical protein Avi_1091 [Agrobacterium vitis S4] 1 3e-28
86356644183 hypothetical protein RHE_CH00998 [Rhizobium etli CFN 42 1 3e-28
116250852165 hypothetical protein RL1079 [Rhizobium leguminosarum bv 1 4e-28
227821136168 hypothetical protein NGR_c05570 [Sinorhizobium fredii N 1 6e-28
222085161165 hypothetical protein Arad_1281 [Agrobacterium radiobact 1 8e-28
>gi|315122066|ref|YP_004062555.1| hypothetical protein CKC_01580 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 171 Back     alignment and organism information
 Score =  244 bits (622), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 109/161 (67%), Positives = 138/161 (85%)

Query: 1   MIHFSQVIDDLLDPFLRRRAGISMSLVSAWSEIVGSNIARCCRPEKIIWPNRTSIERQDI 60
           M+HFS++IDDLLDPFLRRRAGIS+SL+  WSE+VG ++A+ C+PEKIIWP R   + +D 
Sbjct: 11  MMHFSEIIDDLLDPFLRRRAGISISLIGVWSELVGDDVAKHCKPEKIIWPRRDYADERDF 70

Query: 61  SSDVSGTLIIACEGSHALFLMHDQSKIIRNVNIFFGFCAIKRIRFLQRSMSIVNQAPSVS 120
           SS++ G L+IACEG +ALFLMHDQSKIIRNVN+FFGFCAIK+IRFLQ+ + I NQ    +
Sbjct: 71  SSNIGGILVIACEGPYALFLMHDQSKIIRNVNVFFGFCAIKKIRFLQKPVGITNQDSPCA 130

Query: 121 IPALEKDDCEKIDKMTEGIKDEQLKRALIRFGHAVVGCSYL 161
           IP+L ++DC+KI+KMTEGIKDE LK+AL+RFGHAV+G SYL
Sbjct: 131 IPSLRENDCKKIEKMTEGIKDEPLKKALVRFGHAVIGFSYL 171


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|241203454|ref|YP_002974550.1| hypothetical protein Rleg_0708 [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 163 Back     alignment and organism information
>gi|150395768|ref|YP_001326235.1| hypothetical protein Smed_0544 [Sinorhizobium medicae WSM419] Length = 168 Back     alignment and organism information
>gi|190890709|ref|YP_001977251.1| hypothetical protein RHECIAT_CH0001088 [Rhizobium etli CIAT 652] Length = 164 Back     alignment and organism information
>gi|15888142|ref|NP_353823.1| hypothetical protein Atu8137 [Agrobacterium tumefaciens str. C58] Length = 175 Back     alignment and organism information
>gi|222147828|ref|YP_002548785.1| hypothetical protein Avi_1091 [Agrobacterium vitis S4] Length = 182 Back     alignment and organism information
>gi|86356644|ref|YP_468536.1| hypothetical protein RHE_CH00998 [Rhizobium etli CFN 42] Length = 183 Back     alignment and organism information
>gi|116250852|ref|YP_766690.1| hypothetical protein RL1079 [Rhizobium leguminosarum bv. viciae 3841] Length = 165 Back     alignment and organism information
>gi|227821136|ref|YP_002825106.1| hypothetical protein NGR_c05570 [Sinorhizobium fredii NGR234] Length = 168 Back     alignment and organism information
>gi|222085161|ref|YP_002543691.1| hypothetical protein Arad_1281 [Agrobacterium radiobacter K84] Length = 165 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target161 hypothetical protein CLIBASIA_01815 [Candidatus Liberib
pfam0525888 pfam05258, DUF721, Protein of unknown function (DUF721) 2e-11
COG5389181 COG5389, COG5389, Uncharacterized protein conserved in 7e-35
>gnl|CDD|147452 pfam05258, DUF721, Protein of unknown function (DUF721) Back     alignment and domain information
>gnl|CDD|34951 COG5389, COG5389, Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 161 hypothetical protein CLIBASIA_01815 [Candidatus Liberib
COG5389181 Uncharacterized protein conserved in bacteria [Function 99.98
PRK00111178 hypothetical protein; Provisional 99.68
pfam0525888 DUF721 Protein of unknown function (DUF721). This famil 99.67
PRK03195187 hypothetical protein; Provisional 99.65
COG5512194 Zn-ribbon-containing, possibly RNA-binding protein and 98.24
COG4701162 Uncharacterized protein conserved in bacteria [Function 96.74
PRK08770663 DNA polymerase III subunits gamma and tau; Validated 90.97
>COG5389 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK00111 hypothetical protein; Provisional Back     alignment and domain information
>pfam05258 DUF721 Protein of unknown function (DUF721) Back     alignment and domain information
>PRK03195 hypothetical protein; Provisional Back     alignment and domain information
>COG5512 Zn-ribbon-containing, possibly RNA-binding protein and truncated derivatives [General function prediction only] Back     alignment and domain information
>COG4701 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK08770 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target161 hypothetical protein CLIBASIA_01815 [Candidatus Liberib
1qzv_F154 Plant photosystem I: subunit PSAF; photosynthesis,plant 8e-05
>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Back     alignment and structure
 Score = 41.5 bits (96), Expect = 8e-05
 Identities = 10/30 (33%), Positives = 19/30 (63%), Gaps = 6/30 (20%)

Query: 99  AIKRIRFLQRSMSIV--NQAPSVSIPA-LE 125
           A+K+   LQ S+ +   + AP+++I A +E
Sbjct: 21  ALKK---LQASLKLYADDSAPALAIKATME 47


Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00