254780479

254780479

A/G-specific adenine glycosylase

GeneID in NCBI database:8209468Locus tag:CLIBASIA_01820
Protein GI in NCBI database:254780479Protein Accession:YP_003064892.1
Gene range:+(400659, 401729)Protein Length:356aa
Gene description:A/G-specific adenine glycosylase
COG prediction:[L] A/G-specific DNA glycosylase
KEGG prediction:mutY; A/G-specific adenine glycosylase; K03575 A/G-specific adenine glycosylase [EC:3.2.2.-]
SEED prediction:A/G-specific adenine glycosylase (EC 3.2.2.-)
Pathway involved in KEGG:Base excision repair [PATH:las03410]
Subsystem involved in SEED:DNA repair, bacterial
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOP2 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350------
MPQPEHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTITHTFTHFTLTLFVWKTIVPQIVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKVPQ
ccccHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHccHHHHHHHHHHHHHHcccHHHHHHccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccccHHHHHHcccccHHHHHHHHHHHccccEEEcccHHHHHHHHHccccccccccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccccccccccccccHHcccccccccccccccccccEEEEEEEEEEccccEEEEEEccccccccccccccccccccccHHHHHHHHHHHHHccEEEEEEEEEEEEEEEEEEEEEEEccccccccccEEEcHHHHHHccccHHHHHHHHHHcccccc
cccccHHHHHHHHHHHHHHcccccccccHHHHHcccccHHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHHHccHHHHHHHHccccccHHHHHHHHHHHHHHHHccccccccHHHHHccccccHHHHHHHHHHHHccccccccHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHccccccccHHHcccccccHHHHccccccccccccccccccccEEEEEEEEcccEEEEEEccccccccccccccccccHHHHHHHHHHHccccHHHHHHcccEEEEEEEEEEEEEEEEEEccccccccccEEEcHHccccccccHHHHHHHHHHcccccc
mpqpehiiqskildwydtnhrvlpwrtspkteksslpspyKVWISEIMLQQTTVKTVEPYFKKFmqkwptifclssakdEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILkklpgigdyTASAIVAIAFNHFAVVVDTNIERIISRYfdiikpaplyhKTIKNYARKitstsrpgdFVQAMMDLGAlictsnkplcplcpiqkncltfsegkshllgintikkkrpmrtGAVFIAITNDNRILLRKRTNTRLLegmdelpgsawsstkdgnidthsapftaNWILCNTITHTFTHFTLTLFVWKtivpqiviipdstwhdAQNLANAALPTVMKKALsaggikvpq
mpqpehiiqskildwydTNHRVLpwrtspkteksslpsPYKVWISEIMLQQTTVKTVEPYFKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKyegnfphkVEILKKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYfdiikpaplyHKTIKNYARKITSTSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLlgintikkkrpmrtgavfiaitndnrillrKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTITHTFTHFTLTLFVWKTIVPQIVIIPDSTWHDAQNLANAALPTVMKKAlsaggikvpq
MPQPEHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTIthtfthftltlfVWKTIVPQIVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKVPQ
*****HI*QSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLL*******KRPMRTGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTITHTFTHFTLTLFVWKTIVPQIVIIPDSTWHDAQNLANAALPTVMKKALSAGG*****
MPQPEHIIQSKILDWYDTNHRVLPWRTS*********SPYKVWISEIMLQQTTVKTVEPYFKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTITHTFTHFTLTLFVWKTIVPQIVIIPDSTWHDAQNLANAALPTVMKKA**********
****EHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTITHTFTHFTLTLFVWKTIVPQIVIIPDSTWHDAQNLANAALPTVMKKALSAGGIK***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPQPEHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTITHTFTHFTLTLFVWKTIVPQIVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKVPQ
MPQPEHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTITHTFTHFTLTLFVWKTIVPQIVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKVPQ
MPQPEHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTITHTFTHFTLTLFVWKTIVPQIVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKVPQ

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target356 A/G-specific adenine glycosylase [Candidatus Liberibact
254780383227 endonuclease III [Candidatus Liberibacter asiaticu 2e-08
>gi|254780383|ref|YP_003064796.1| endonuclease III [Candidatus Liberibacter asiaticus str. psy62] Length = 227 Back     alignment
 Score = 51.2 bits (121), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 61/125 (48%), Gaps = 3/125 (2%)

Query: 91  YYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGIGDYTASAIVAIAFNHFAVVVDTNI 150
           Y  ++ N+   + I++ +++   P  +E L +LPGIG   A+ I+++AF    + VDT+I
Sbjct: 101 YRKKSENIISLSHILINEFDNKIPQTLEGLTRLPGIGRKGANVILSMAFGIPTIGVDTHI 160

Query: 151 ERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPGDFVQAMMDLGALICTSNKPLCPLCP 210
            RI +R    + P    +K  ++  R I    +       ++  G  +C + KP C  C 
Sbjct: 161 FRISNRIG--LAPGKTPNKVEQSLLRIIPPKHQYNAHYWLVLH-GRYVCKARKPQCQSCI 217

Query: 211 IQKNC 215
           I   C
Sbjct: 218 ISNLC 222

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target356 A/G-specific adenine glycosylase [Candidatus Liberibact
315122065355 A/G-specific adenine glycosylase [Candidatus Liberibact 1 1e-165
306842224358 A/G-specific adenine glycosylase [Brucella sp. BO2] Len 1 4e-99
239831360396 A/G-specific adenine glycosylase [Ochrobactrum intermed 1 6e-99
163842775358 A/G-specific adenine glycosylase [Brucella suis ATCC 23 1 2e-98
261757724382 A/G-specific adenine glycosylase [Brucella sp. F5/99] L 1 2e-98
254712948358 A/G-specific adenine glycosylase [Brucella ceti M644/93 1 2e-98
17987725375 A/G-specific adenine glycosylase [Brucella melitensis b 1 2e-98
265983648375 A/G-specific adenine glycosylase [Brucella sp. 83/13] L 1 2e-98
254718666358 A/G-specific adenine glycosylase [Brucella sp. 83/13] L 1 3e-98
306845121375 A/G-specific adenine glycosylase [Brucella sp. BO1] Len 1 3e-98
>gi|315122065|ref|YP_004062554.1| A/G-specific adenine glycosylase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 355 Back     alignment and organism information
 Score =  584 bits (1506), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 280/356 (78%), Positives = 308/356 (86%), Gaps = 1/356 (0%)

Query: 1   MPQPEHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPY 60
           MPQ E+ IQ  IL+WYD NHR LPWR  PKT KSSLP PY +W+SEIMLQQTTV TVEPY
Sbjct: 1   MPQYENTIQIDILNWYDINHRTLPWRIPPKTNKSSLPDPYTIWLSEIMLQQTTVTTVEPY 60

Query: 61  FKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEIL 120
           FKKFMQKWPTIFCLSSA +EEILSAWAGLGYYTRARNLKKCAD+IV+KYEG+FP+K +IL
Sbjct: 61  FKKFMQKWPTIFCLSSATEEEILSAWAGLGYYTRARNLKKCADVIVQKYEGDFPNKEDIL 120

Query: 121 KKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITS 180
           KKLPGIGDYTASAIVAIAFNHFAVV+DTNIERIISR F I K  PLY KTIK+YAR ITS
Sbjct: 121 KKLPGIGDYTASAIVAIAFNHFAVVIDTNIERIISRCFAITKSLPLYKKTIKSYARTITS 180

Query: 181 TSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTG 240
            SRPGDFVQAMMDLGALICT+ KPLC LCPIQK CLTFS G+SHLLGI T  KK+P R G
Sbjct: 181 ASRPGDFVQAMMDLGALICTAKKPLCHLCPIQKKCLTFSRGESHLLGI-TCPKKKPARVG 239

Query: 241 AVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTIT 300
           A+F+AIT+DNRILLRKRT TRLL+GMDELPGS WS+ KDG ID  +APF ANW LCNTIT
Sbjct: 240 AIFLAITSDNRILLRKRTKTRLLKGMDELPGSDWSAKKDGEIDVGNAPFLANWTLCNTIT 299

Query: 301 HTFTHFTLTLFVWKTIVPQIVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKVPQ 356
           HTFTHF L LF+WKT+VPQI+ IP+S W   Q+L N ALPTVMKKA+SAGGIKVP+
Sbjct: 300 HTFTHFNLKLFIWKTVVPQIISIPESKWCYVQDLTNIALPTVMKKAISAGGIKVPK 355


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|306842224|ref|ZP_07474888.1| A/G-specific adenine glycosylase [Brucella sp. BO2] Length = 358 Back     alignment and organism information
>gi|239831360|ref|ZP_04679689.1| A/G-specific adenine glycosylase [Ochrobactrum intermedium LMG 3301] Length = 396 Back     alignment and organism information
>gi|163842775|ref|YP_001627179.1| A/G-specific adenine glycosylase [Brucella suis ATCC 23445] Length = 358 Back     alignment and organism information
>gi|261757724|ref|ZP_06001433.1| A/G-specific adenine glycosylase [Brucella sp. F5/99] Length = 382 Back     alignment and organism information
>gi|254712948|ref|ZP_05174759.1| A/G-specific adenine glycosylase [Brucella ceti M644/93/1] Length = 358 Back     alignment and organism information
>gi|17987725|ref|NP_540359.1| A/G-specific adenine glycosylase [Brucella melitensis bv. 1 str. 16M] Length = 375 Back     alignment and organism information
>gi|265983648|ref|ZP_06096383.1| A/G-specific adenine glycosylase [Brucella sp. 83/13] Length = 375 Back     alignment and organism information
>gi|254718666|ref|ZP_05180477.1| A/G-specific adenine glycosylase [Brucella sp. 83/13] Length = 358 Back     alignment and organism information
>gi|306845121|ref|ZP_07477701.1| A/G-specific adenine glycosylase [Brucella sp. BO1] Length = 375 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target356 A/G-specific adenine glycosylase [Candidatus Liberibact
TIGR01084275 TIGR01084, mutY, A/G-specific adenine glycosylase 4e-72
KOG2457555 KOG2457, KOG2457, KOG2457, A/G-specific adenine DNA gly 7e-57
PRK10880350 PRK10880, PRK10880, adenine DNA glycosylase; Provisiona 2e-53
COG1194342 COG1194, MutY, A/G-specific DNA glycosylase [DNA replic 2e-92
cd00056158 cd00056, ENDO3c, endonuclease III; includes endonucleas 3e-36
smart00478149 smart00478, ENDO3c, endonuclease III 4e-32
COG0177211 COG0177, Nth, Predicted EndoIII-related endonuclease [D 1e-26
pfam00730144 pfam00730, HhH-GPD, HhH-GPD superfamily base excision D 2e-24
TIGR01083191 TIGR01083, nth, endonuclease III 3e-17
COG2231215 COG2231, COG2231, Uncharacterized protein related to En 3e-07
PRK10702211 PRK10702, PRK10702, endonuclease III; Provisional 8e-07
PRK13910289 PRK13910, PRK13910, DNA glycosylase MutY; Provisional 2e-35
cd03431118 cd03431, DNA_Glycosylase_C, DNA glycosylase (MutY in ba 3e-18
KOG1921286 KOG1921, KOG1921, KOG1921, Endonuclease III [Replicatio 5e-08
COG0122285 COG0122, AlkA, 3-methyladenine DNA glycosylase/8-oxogua 2e-05
KOG2875323 KOG2875, KOG2875, KOG2875, 8-oxoguanine DNA glycosylase 1e-04
pfam0063330 pfam00633, HHH, Helix-hairpin-helix motif 0.002
>gnl|CDD|130156 TIGR01084, mutY, A/G-specific adenine glycosylase Back     alignment and domain information
>gnl|CDD|37668 KOG2457, KOG2457, KOG2457, A/G-specific adenine DNA glycosylase [Replication, recombination and repair] Back     alignment and domain information
>gnl|CDD|182805 PRK10880, PRK10880, adenine DNA glycosylase; Provisional Back     alignment and domain information
>gnl|CDD|31387 COG1194, MutY, A/G-specific DNA glycosylase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|28938 cd00056, ENDO3c, endonuclease III; includes endonuclease III (DNA-(apurinic or apyrimidinic site) lyase), alkylbase DNA glycosidases (Alka-family) and other DNA glycosidases Back     alignment and domain information
>gnl|CDD|128754 smart00478, ENDO3c, endonuclease III Back     alignment and domain information
>gnl|CDD|30526 COG0177, Nth, Predicted EndoIII-related endonuclease [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|144361 pfam00730, HhH-GPD, HhH-GPD superfamily base excision DNA repair protein Back     alignment and domain information
>gnl|CDD|130155 TIGR01083, nth, endonuclease III Back     alignment and domain information
>gnl|CDD|32412 COG2231, COG2231, Uncharacterized protein related to Endonuclease III [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|182661 PRK10702, PRK10702, endonuclease III; Provisional Back     alignment and domain information
>gnl|CDD|172427 PRK13910, PRK13910, DNA glycosylase MutY; Provisional Back     alignment and domain information
>gnl|CDD|72889 cd03431, DNA_Glycosylase_C, DNA glycosylase (MutY in bacteria and hMYH in humans) is responsible for repairing misread A*oxoG residues to C*G by removing the inappropriately paired adenine base from the DNA backbone Back     alignment and domain information
>gnl|CDD|37132 KOG1921, KOG1921, KOG1921, Endonuclease III [Replication, recombination and repair] Back     alignment and domain information
>gnl|CDD|30471 COG0122, AlkA, 3-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|38086 KOG2875, KOG2875, KOG2875, 8-oxoguanine DNA glycosylase [Replication, recombination and repair] Back     alignment and domain information
>gnl|CDD|109681 pfam00633, HHH, Helix-hairpin-helix motif Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 356 A/G-specific adenine glycosylase [Candidatus Liberibact
PRK10880350 adenine DNA glycosylase; Provisional 100.0
COG1194342 MutY A/G-specific DNA glycosylase [DNA replication, rec 100.0
KOG2457555 consensus 100.0
TIGR01084297 mutY A/G-specific adenine glycosylase; InterPro: IPR005 100.0
PRK13910290 DNA glycosylase MutY; Provisional 100.0
PRK10702211 endonuclease III; Provisional 100.0
COG0177211 Nth Predicted EndoIII-related endonuclease [DNA replica 100.0
TIGR01083192 nth endonuclease III; InterPro: IPR005759 The spectrum 100.0
smart00478149 ENDO3c endonuclease III. includes endonuclease III (DNA 100.0
cd00056158 ENDO3c endonuclease III; includes endonuclease III (DNA 100.0
KOG1921286 consensus 99.92
PRK13913218 3-methyladenine DNA glycosylase; Provisional 99.63
COG2231215 Uncharacterized protein related to Endonuclease III [DN 99.62
PRK10308283 3-methyl-adenine DNA glycosylase II; Provisional 98.63
KOG1918254 consensus 97.34
pfam00730144 HhH-GPD HhH-GPD superfamily base excision DNA repair pr 99.89
TIGR00588379 ogg 8-oxoguanine DNA-glycosylase (ogg); InterPro: IPR00 99.11
KOG2875323 consensus 99.1
PRK01229208 N-glycosylase/DNA lyase; Provisional 96.13
cd03431118 DNA_Glycosylase_C DNA glycosylase (MutY in bacteria and 99.84
PRK08999 312 hypothetical protein; Provisional 99.61
PRK10776129 nucleoside triphosphate pyrophosphohydrolase; Provision 99.58
cd03425124 MutT_pyrophosphohydrolase The MutT pyrophosphohydrolase 99.54
PRK10546135 pyrimidine (deoxy)nucleoside triphosphate pyrophosphohy 99.47
TIGR00586150 mutt mutator mutT protein; InterPro: IPR003561 MutT is 98.8
cd03427137 MTH1 MutT homolog-1 (MTH1) is a member of the Nudix hyd 98.66
cd04691117 Nudix_Hydrolase_32 Members of the Nudix hydrolase super 98.57
cd04696125 Nudix_Hydrolase_37 Members of the Nudix hydrolase super 98.5
cd04699129 Nudix_Hydrolase_39 Members of the Nudix hydrolase super 98.48
cd04667112 Nudix_Hydrolase_10 Members of the Nudix hydrolase super 98.41
cd04681130 Nudix_Hydrolase_22 Members of the Nudix hydrolase super 98.33
cd04683120 Nudix_Hydrolase_24 Members of the Nudix hydrolase super 98.1
cd04664129 Nudix_Hydrolase_7 Members of the Nudix hydrolase superf 98.09
cd04673122 Nudix_Hydrolase_15 Members of the Nudix hydrolase super 98.06
cd04511130 Nudix_Hydrolase_4 Members of the Nudix hydrolase superf 98.05
cd04690118 Nudix_Hydrolase_31 Members of the Nudix hydrolase super 98.03
cd04676129 Nudix_Hydrolase_17 Members of the Nudix hydrolase super 98.02
cd04682122 Nudix_Hydrolase_23 Members of the Nudix hydrolase super 98.01
cd04677132 Nudix_Hydrolase_18 Members of the Nudix hydrolase super 97.98
cd04684128 Nudix_Hydrolase_25 Contains a crystal structure of the 97.94
cd04679125 Nudix_Hydrolase_20 Members of the Nudix hydrolase super 97.91
cd03430144 GDPMH GDP-mannose glycosyl hydrolase (AKA GDP-mannose m 97.85
cd04678129 Nudix_Hydrolase_19 Members of the Nudix hydrolase super 97.85
cd02883123 Nudix_Hydrolase Nudix hydrolase is a superfamily of enz 97.83
cd04670127 Nudix_Hydrolase_12 Members of the Nudix hydrolase super 97.82
cd03674138 Nudix_Hydrolase_1 Members of the Nudix hydrolase superf 97.77
cd04695131 Nudix_Hydrolase_36 Members of the Nudix hydrolase super 97.75
cd04672123 Nudix_Hydrolase_14 Members of the Nudix hydrolase super 97.72
cd04669121 Nudix_Hydrolase_11 Members of the Nudix hydrolase super 97.7
cd04700142 DR1025_like DR1025 from Deinococcus radiodurans, a memb 97.7
cd04671123 Nudix_Hydrolase_13 Members of the Nudix hydrolase super 97.65
pfam00293133 NUDIX NUDIX domain. 97.6
cd03673131 Ap6A_hydrolase Diadenosine hexaphosphate (Ap6A) hydrola 97.56
cd04697126 Nudix_Hydrolase_38 Members of the Nudix hydrolase super 97.54
cd04680120 Nudix_Hydrolase_21 Members of the Nudix hydrolase super 97.53
cd04687128 Nudix_Hydrolase_28 Members of the Nudix hydrolase super 97.53
cd04688126 Nudix_Hydrolase_29 Members of the Nudix hydrolase super 97.51
cd04689125 Nudix_Hydrolase_30 Members of the Nudix hydrolase super 97.51
cd04693127 Nudix_Hydrolase_34 Members of the Nudix hydrolase super 97.41
PRK09438148 ntpA dATP pyrophosphohydrolase; Provisional 97.09
cd03675134 Nudix_Hydrolase_2 Contains a crystal structure of the N 97.06
cd03429131 NADH_pyrophosphatase NADH pyrophosphatase, a member of 96.78
cd03428130 Ap4A_hydrolase_human_like Diadenosine tetraphosphate (A 96.59
cd03426157 CoAse Coenzyme A pyrophosphatase (CoAse), a member of t 96.48
PRK03759184 isopentenyl-diphosphate delta-isomerase; Provisional 96.25
cd02885165 IPP_Isomerase Isopentenyl diphosphate (IPP) isomerase, 96.17
cd04692144 Nudix_Hydrolase_33 Members of the Nudix hydrolase super 96.12
PRK00714156 dinucleoside polyphosphate hydrolase; Reviewed 95.94
cd04686131 Nudix_Hydrolase_27 Members of the Nudix hydrolase super 95.46
PRK10707190 hypothetical protein; Provisional 95.16
cd04685133 Nudix_Hydrolase_26 Members of the Nudix hydrolase super 95.12
PRK05379340 bifunctional nicotinamide mononucleotide adenylyltransf 95.0
COG1051145 ADP-ribose pyrophosphatase [Nucleotide transport and me 94.97
cd03672145 Dcp2p mRNA decapping enzyme 2 (Dcp2p), the catalytic su 94.2
PRK00241257 nudC NADH pyrophosphatase; Reviewed 92.99
cd04661132 MRP_L46 Mitochondrial ribosomal protein L46 (MRP L46) i 92.99
cd03424137 ADPRase_NUDT5 ADP-ribose pyrophosphatase (ADPRase) cata 90.49
KOG3069246 consensus 90.31
COG0122285 AlkA 3-methyladenine DNA glycosylase/8-oxoguanine DNA g 99.07
pfam0063330 HHH Helix-hairpin-helix motif. The helix-hairpin-helix 97.5
pfam05559319 DUF763 Protein of unknown function (DUF763). This famil 94.47
COG1555149 ComEA DNA uptake protein and related DNA-binding protei 91.02
TIGR00575706 dnlj DNA ligase, NAD-dependent; InterPro: IPR001679 DNA 90.2
cd04694143 Nudix_Hydrolase_35 Members of the Nudix hydrolase super 97.17
cd03671147 Ap4A_hydrolase_plant_like Diadenosine tetraphosphate (A 96.67
cd04674118 Nudix_Hydrolase_16 Members of the Nudix hydrolase super 94.74
cd04665118 Nudix_Hydrolase_8 Members of the Nudix hydrolase superf 94.51
TIGR03252177 uncharacterized HhH-GPD family protein. This model desc 96.03
smart0052526 FES FES domain. iron-sulpphur binding domain in DNA-(ap 95.74
pfam1057626 EndIII_4Fe-2S Iron-sulfur binding domain of endonucleas 93.38
COG1059210 Thermostable 8-oxoguanine DNA glycosylase [DNA replicat 92.42
COG2816279 NPY1 NTP pyrophosphohydrolases containing a Zn-finger, 92.26
PRK13901196 ruvA Holliday junction DNA helicase motor protein; Prov 91.64
TIGR02705158 nudix_YtkD nucleoside triphosphatase YtkD; InterPro: IP 90.94
>PRK10880 adenine DNA glycosylase; Provisional Back     alignment and domain information
>COG1194 MutY A/G-specific DNA glycosylase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG2457 consensus Back     alignment and domain information
>TIGR01084 mutY A/G-specific adenine glycosylase; InterPro: IPR005760 The DNA repair enzyme MutY plays an important role in the prevention of DNA mutations resulting from the presence of the oxidatively damaged lesion 7,8-dihydro-8-oxo-2'-deoxyguanosine (8-OxoG) Back     alignment and domain information
>PRK13910 DNA glycosylase MutY; Provisional Back     alignment and domain information
>PRK10702 endonuclease III; Provisional Back     alignment and domain information
>COG0177 Nth Predicted EndoIII-related endonuclease [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01083 nth endonuclease III; InterPro: IPR005759 The spectrum of DNA damage caused by reactive oxygen species includes a wide variety of modifications of purine and pyrimidine bases Back     alignment and domain information
>smart00478 ENDO3c endonuclease III Back     alignment and domain information
>cd00056 ENDO3c endonuclease III; includes endonuclease III (DNA-(apurinic or apyrimidinic site) lyase), alkylbase DNA glycosidases (Alka-family) and other DNA glycosidases Back     alignment and domain information
>KOG1921 consensus Back     alignment and domain information
>PRK13913 3-methyladenine DNA glycosylase; Provisional Back     alignment and domain information
>COG2231 Uncharacterized protein related to Endonuclease III [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK10308 3-methyl-adenine DNA glycosylase II; Provisional Back     alignment and domain information
>KOG1918 consensus Back     alignment and domain information
>pfam00730 HhH-GPD HhH-GPD superfamily base excision DNA repair protein Back     alignment and domain information
>TIGR00588 ogg 8-oxoguanine DNA-glycosylase (ogg); InterPro: IPR004577 All proteins in this family for which functions are known are 8-oxo-guanaine DNA glycosylases that function in base excision repair Back     alignment and domain information
>KOG2875 consensus Back     alignment and domain information
>PRK01229 N-glycosylase/DNA lyase; Provisional Back     alignment and domain information
>cd03431 DNA_Glycosylase_C DNA glycosylase (MutY in bacteria and hMYH in humans) is responsible for repairing misread A*oxoG residues to C*G by removing the inappropriately paired adenine base from the DNA backbone Back     alignment and domain information
>PRK08999 hypothetical protein; Provisional Back     alignment and domain information
>PRK10776 nucleoside triphosphate pyrophosphohydrolase; Provisional Back     alignment and domain information
>cd03425 MutT_pyrophosphohydrolase The MutT pyrophosphohydrolase is a prototypical Nudix hydrolase that catalyzes the hydrolysis of nucleoside and deoxynucleoside triphosphates (NTPs and dNTPs) by substitution at a beta-phosphorus to yield a nucleotide monophosphate (NMP) and inorganic pyrophosphate (PPi) Back     alignment and domain information
>PRK10546 pyrimidine (deoxy)nucleoside triphosphate pyrophosphohydrolase; Provisional Back     alignment and domain information
>TIGR00586 mutt mutator mutT protein; InterPro: IPR003561 MutT is a small bacterial protein (~12-15kDa) involved in the GO system responsible for removing an oxidatively damaged form of guanine (8-hydroxy- guanine or 7,8-dihydro-8-oxoguanine) from DNA and the nucleotide pool Back     alignment and domain information
>cd03427 MTH1 MutT homolog-1 (MTH1) is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>cd04691 Nudix_Hydrolase_32 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04696 Nudix_Hydrolase_37 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04699 Nudix_Hydrolase_39 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04667 Nudix_Hydrolase_10 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04681 Nudix_Hydrolase_22 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04683 Nudix_Hydrolase_24 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04664 Nudix_Hydrolase_7 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04673 Nudix_Hydrolase_15 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04511 Nudix_Hydrolase_4 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04690 Nudix_Hydrolase_31 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04676 Nudix_Hydrolase_17 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04682 Nudix_Hydrolase_23 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04677 Nudix_Hydrolase_18 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04684 Nudix_Hydrolase_25 Contains a crystal structure of the Nudix hydrolase from Enterococcus faecalis, which has an unknown function Back     alignment and domain information
>cd04679 Nudix_Hydrolase_20 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03430 GDPMH GDP-mannose glycosyl hydrolase (AKA GDP-mannose mannosyl hydrolase (GDPMH)) is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>cd04678 Nudix_Hydrolase_19 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd02883 Nudix_Hydrolase Nudix hydrolase is a superfamily of enzymes found in all three kingdoms of life, and it catalyzes the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04670 Nudix_Hydrolase_12 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03674 Nudix_Hydrolase_1 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04695 Nudix_Hydrolase_36 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04672 Nudix_Hydrolase_14 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04669 Nudix_Hydrolase_11 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04700 DR1025_like DR1025 from Deinococcus radiodurans, a member of the Nudix hydrolase superfamily, show nucleoside triphosphatase and dinucleoside polyphosphate pyrophosphatase activities Back     alignment and domain information
>cd04671 Nudix_Hydrolase_13 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>pfam00293 NUDIX NUDIX domain Back     alignment and domain information
>cd03673 Ap6A_hydrolase Diadenosine hexaphosphate (Ap6A) hydrolase is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>cd04697 Nudix_Hydrolase_38 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04680 Nudix_Hydrolase_21 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04687 Nudix_Hydrolase_28 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04688 Nudix_Hydrolase_29 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04689 Nudix_Hydrolase_30 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04693 Nudix_Hydrolase_34 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PRK09438 ntpA dATP pyrophosphohydrolase; Provisional Back     alignment and domain information
>cd03675 Nudix_Hydrolase_2 Contains a crystal structure of the Nudix hydrolase from Nitrosomonas europaea, which has an unknown function Back     alignment and domain information
>cd03429 NADH_pyrophosphatase NADH pyrophosphatase, a member of the Nudix hydrolase superfamily, catalyzes the cleavage of NADH into reduced nicotinamide mononucleotide (NMNH) and AMP Back     alignment and domain information
>cd03428 Ap4A_hydrolase_human_like Diadenosine tetraphosphate (Ap4A) hydrolase is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>cd03426 CoAse Coenzyme A pyrophosphatase (CoAse), a member of the Nudix hydrolase superfamily, functions to catalyze the elimination of oxidized inactive CoA, which can inhibit CoA-utilizing enzymes Back     alignment and domain information
>PRK03759 isopentenyl-diphosphate delta-isomerase; Provisional Back     alignment and domain information
>cd02885 IPP_Isomerase Isopentenyl diphosphate (IPP) isomerase, a member of the Nudix hydrolase superfamily, is a key enzyme in the isoprenoid biosynthetic pathway Back     alignment and domain information
>cd04692 Nudix_Hydrolase_33 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PRK00714 dinucleoside polyphosphate hydrolase; Reviewed Back     alignment and domain information
>cd04686 Nudix_Hydrolase_27 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PRK10707 hypothetical protein; Provisional Back     alignment and domain information
>cd04685 Nudix_Hydrolase_26 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PRK05379 bifunctional nicotinamide mononucleotide adenylyltransferase/ADP-ribose pyrophosphatase; Provisional Back     alignment and domain information
>COG1051 ADP-ribose pyrophosphatase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd03672 Dcp2p mRNA decapping enzyme 2 (Dcp2p), the catalytic subunit, and Dcp1p are the two components of the decapping enzyme complex Back     alignment and domain information
>PRK00241 nudC NADH pyrophosphatase; Reviewed Back     alignment and domain information
>cd04661 MRP_L46 Mitochondrial ribosomal protein L46 (MRP L46) is a component of the large subunit (39S) of the mammalian mitochondrial ribosome and a member of the Nudix hydrolase superfamily Back     alignment and domain information
>cd03424 ADPRase_NUDT5 ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose and a variety of additional ADP-sugar conjugates to AMP and ribose-5-phosphate Back     alignment and domain information
>KOG3069 consensus Back     alignment and domain information
>COG0122 AlkA 3-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylase [DNA replication, recombination, and repair] Back     alignment and domain information
>pfam00633 HHH Helix-hairpin-helix motif Back     alignment and domain information
>pfam05559 DUF763 Protein of unknown function (DUF763) Back     alignment and domain information
>COG1555 ComEA DNA uptake protein and related DNA-binding proteins [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00575 dnlj DNA ligase, NAD-dependent; InterPro: IPR001679 DNA ligase (polydeoxyribonucleotide synthase) is the enzyme that joins two DNA fragments by catalyzing the formation of an internucleotide ester bond between phosphate and deoxyribose Back     alignment and domain information
>cd04694 Nudix_Hydrolase_35 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03671 Ap4A_hydrolase_plant_like Diadenosine tetraphosphate (Ap4A) hydrolase is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>cd04674 Nudix_Hydrolase_16 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04665 Nudix_Hydrolase_8 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>TIGR03252 uncharacterized HhH-GPD family protein Back     alignment and domain information
>smart00525 FES FES domain Back     alignment and domain information
>pfam10576 EndIII_4Fe-2S Iron-sulfur binding domain of endonuclease III Back     alignment and domain information
>COG1059 Thermostable 8-oxoguanine DNA glycosylase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG2816 NPY1 NTP pyrophosphohydrolases containing a Zn-finger, probably nucleic-acid-binding [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13901 ruvA Holliday junction DNA helicase motor protein; Provisional Back     alignment and domain information
>TIGR02705 nudix_YtkD nucleoside triphosphatase YtkD; InterPro: IPR014078 The proteins in this entry belong to the nudix family and share some sequence identity with Escherichia coli MutT but appear not to be functionally interchangeable with it Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target356 A/G-specific adenine glycosylase [Candidatus Liberibact
3g0q_A352 Crystal Structure Of Muty Bound To Its Inhibitor Dn 6e-62
3fsp_A369 Muty Adenine Glycosylase Bound To A Transition Stat 9e-62
1rrq_A369 Muty Adenine Glycosylase In Complex With Dna Contai 2e-61
1rrs_A369 Muty Adenine Glycosylase In Complex With Dna Contai 3e-61
1kg4_A225 Crystal Structure Of The K142a Mutant Of E. Coli Mu 1e-46
1wef_A225 Catalytic Domain Of Muty From Escherichia Coli K20a 1e-46
1kg5_A225 Crystal Structure Of The K142q Mutant Of E.Coli Mut 1e-46
1kg6_A225 Crystal Structure Of The K142r Mutant Of E.Coli Mut 1e-46
1muy_A225 Catalytic Domain Of Muty From Escherichia Coli Leng 1e-46
1kg7_A225 Crystal Structure Of The E161a Mutant Of E.Coli Mut 2e-46
3n5n_X287 Crystal Structure Analysis Of The Catalytic Domain 2e-46
1kqj_A225 Crystal Structure Of A Mutant Of Muty Catalytic Dom 3e-46
1mud_A225 Catalytic Domain Of Muty From Escherichia Coli, D13 5e-46
1kea_A221 Structure Of A Thermostable Thymine-Dna Glycosylase 1e-22
1p59_A226 Structure Of A Non-Covalent Endonuclease Iii-Dna Co 3e-09
1orn_A226 Structure Of A Trapped Endonuclease Iii-Dna Covalen 3e-09
1x51_A155 Solution Structure Of The Nudix Domain From Human A 7e-11
3hhj_A158 Crystal Structure Of Mutator Mutt From Bartonella H 3e-07
3ees_A153 Structure Of The Rna Pyrophosphohydrolase Bdrpph Le 0.004
>gi|268612274|pdb|3G0Q|A Chain A, Crystal Structure Of Muty Bound To Its Inhibitor Dna Length = 352 Back     alignment and structure
 Score =  242 bits (617), Expect = 6e-62,   Method: Composition-based stats.
 Identities = 108/351 (30%), Positives = 168/351 (47%), Gaps = 16/351 (4%)

Query: 4   PEHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKK 63
           P    Q  +LDW+    R LPWR            PYKVW+SE+MLQQT V+TV PYF++
Sbjct: 1   PAREFQRDLLDWFARERRDLPWRKD--------RDPYKVWVSEVMLQQTRVETVIPYFEQ 52

Query: 64  FMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKL 123
           F+ ++PT+  L+ A ++E+L AW GLGYY+R RNL      +  +Y G  P   +   +L
Sbjct: 53  FIDRFPTLEALADADEDEVLKAWEGLGYYSRVRNLHAAVKEVKTRYGGKVPDDPDEFSRL 112

Query: 124 PGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLY--HKTIKNYARKITST 181
            G+G YT  A++++A+      VD N+ R++SR F +          K  +   R+I + 
Sbjct: 113 KGVGPYTVGAVLSLAYGVPEPAVDGNVMRVLSRLFLVTDDIAKCSTRKRFEQIVREIMAY 172

Query: 182 SRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGA 241
             PG F +A+++LGAL+CT  +P C LCP+Q  C  F+EG +  L +   K        A
Sbjct: 173 ENPGAFNEALIELGALVCTPRRPSCLLCPVQAYCQAFAEGVAEELPVKMKKTAVKQVPLA 232

Query: 242 VFIAITNDNRILLRKRTNTRLLEGMDELPGSAWS-----STKDGNIDTHSAPFTANWILC 296
           V +   ++ R+L+RKR +T LL  + E P             +  +              
Sbjct: 233 VAVLADDEGRVLIRKRDSTGLLANLWEFPSCETDGADGKEKLEQMVGEQYGLQVELTEPI 292

Query: 297 NTITHTFTHFTLTLFVWKTIVPQIVIIPD-STWHDAQNLANAALPTVMKKA 346
            +  H F+H    L V+   +     + +         L   A P   ++ 
Sbjct: 293 VSFEHAFSHLVWQLTVFPGRLVHGGPVEEPYRLAPEDELKAYAFPVSHQRV 343


>gi|284055514|pdb|3FSP|A Chain A, Muty Adenine Glycosylase Bound To A Transition State Analog (1n) Paired With Dg In Duplexed Dna Length = 369 Back     alignment and structure
>gi|46015544|pdb|1RRQ|A Chain A, Muty Adenine Glycosylase In Complex With Dna Containing An A:oxog Pair Length = 369 Back     alignment and structure
>gi|46015547|pdb|1RRS|A Chain A, Muty Adenine Glycosylase In Complex With Dna Containing An Abasic Site Length = 369 Back     alignment and structure
>gi|27065209|pdb|1KG4|A Chain A, Crystal Structure Of The K142a Mutant Of E. Coli Muty (Core Fragment) Length = 225 Back     alignment and structure
>gi|55670670|pdb|1WEF|A Chain A, Catalytic Domain Of Muty From Escherichia Coli K20a Mutant Length = 225 Back     alignment and structure
>gi|27065210|pdb|1KG5|A Chain A, Crystal Structure Of The K142q Mutant Of E.Coli Muty (Core Fragment) Length = 225 Back     alignment and structure
>gi|27065214|pdb|1KG6|A Chain A, Crystal Structure Of The K142r Mutant Of E.Coli Muty (Core Fragment) Length = 225 Back     alignment and structure
>gi|5822134|pdb|1MUY|A Chain A, Catalytic Domain Of Muty From Escherichia Coli Length = 225 Back     alignment and structure
>gi|27065216|pdb|1KG7|A Chain A, Crystal Structure Of The E161a Mutant Of E.Coli Muty (Core Fragment) Length = 225 Back     alignment and structure
>gi|311772157|pdb|3N5N|X Chain X, Crystal Structure Analysis Of The Catalytic Domain And Interdomain Connector Of Human Muty Homologue Length = 287 Back     alignment and structure
>gi|20664167|pdb|1KQJ|A Chain A, Crystal Structure Of A Mutant Of Muty Catalytic Domain Length = 225 Back     alignment and structure
>gi|6137464|pdb|1MUD|A Chain A, Catalytic Domain Of Muty From Escherichia Coli, D138n Mutant Complexed To Adenine Length = 225 Back     alignment and structure
gi|18655713|pdb|1KEA|A Chain A, Structure Of A Thermostable Thymine-Dna Glycosylase Length = 221 Back     alignment and structure
>gi|34811270|pdb|1P59|A Chain A, Structure Of A Non-Covalent Endonuclease Iii-Dna Complex Length = 226 Back     alignment and structure
>gi|34811453|pdb|1ORN|A Chain A, Structure Of A Trapped Endonuclease Iii-Dna Covalent Intermediate: Estranged-Guanine Complex Length = 226 Back     alignment and structure
>gi|159163552|pdb|1X51|A Chain A, Solution Structure Of The Nudix Domain From Human AG- Specific Adenine Dna Glycosylase Alpha-3 Splice Isoform Length = 155 Back     alignment and structure
>gi|238538034|pdb|3HHJ|A Chain A, Crystal Structure Of Mutator Mutt From Bartonella Henselae Length = 158 Back     alignment and structure
gi|225734088|pdb|3EES|A Chain A, Structure Of The Rna Pyrophosphohydrolase Bdrpph Length = 153 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target356 A/G-specific adenine glycosylase [Candidatus Liberibact
3fsp_A369 A/G-specific adenine glycosylase; protein-DNA complex, 5e-73
3n5n_X287 A/G-specific adenine DNA glycosylase; alpha-helices, he 5e-68
1kg2_A225 A/G-specific adenine glycosylase; DNA repair, hydrolase 3e-56
1kea_A221 Possible G-T mismatches repair enzyme; DNA repair, DNA 2e-52
1orn_A226 Endonuclease III; DNA repair, DNA glycosylase, [4Fe-4S] 9e-44
1pu6_A218 3-methyladenine DNA glycosylase; helix-hairpin-helix, b 4e-34
2abk_A211 Endonuclease III; DNA-repair, DNA glycosylase; 1.85A {E 3e-26
1ngn_A155 Methyl-CPG binding protein MBD4; mismacth repair in met 5e-28
1m3q_A317 8-oxoguanine DNA glycosylase; DNA repair, END product, 3e-12
3i0w_A290 8-oxoguanine-DNA-glycosylase; OGG, cacogg, DNA, 8-OXOG, 5e-11
2jhn_A295 ALKA, 3-methyladenine DNA-glycosylase; DNA repair, N1-m 0.001
3fhf_A214 Mjogg, N-glycosylase/DNA lyase, DNA-; helix-hairpin-hel 7e-25
3fhg_A207 Mjogg, N-glycosylase/DNA lyase, DNA-; helix-hairpin-hel 1e-20
1x51_A155 A/G-specific adenine DNA glycosylase; nudix domain, DNA 2e-09
1mut_A129 MUTT, nucleoside triphosphate pyrophosphohydrolase; DNA 4e-04
>3fsp_A A/G-specific adenine glycosylase; protein-DNA complex, DNA glycosylase, transition state analog, DNA repair; HET: NRI; 2.20A {Geobacillus stearothermophilus} PDB: 3fsq_A* 1rrs_A* 1vrl_A* 1rrq_A* 3g0q_A* Length = 369 Back     alignment and structure
 Score =  270 bits (690), Expect = 5e-73
 Identities = 107/348 (30%), Positives = 166/348 (47%), Gaps = 16/348 (4%)

Query: 8   IQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQK 67
            Q  +LDW+    R LPWR            PYKVW+SE+MLQQT V+TV PYF++F+ +
Sbjct: 16  FQRDLLDWFARERRDLPWRKDR--------DPYKVWVSEVMLQQTRVETVIPYFEQFIDR 67

Query: 68  WPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGIG 127
           +PT+  L+ A ++E+L AW GLGYY+R RNL      +  +Y G  P   +   +L G+G
Sbjct: 68  FPTLEALADADEDEVLKAWEGLGYYSRVRNLHAAVKEVKTRYGGKVPDDPDEFSRLKGVG 127

Query: 128 DYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLY--HKTIKNYARKITSTSRPG 185
            YT  A++++A+      VD N+ R++SR F +          K  +   R+I +   PG
Sbjct: 128 PYTVGAVLSLAYGVPEPAVDGNVMRVLSRLFLVTDDIAKPSTRKRFEQIVREIMAYENPG 187

Query: 186 DFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIA 245
            F +A+++LGAL+CT  +P C LCP+Q  C  F+EG +  L +   K        AV + 
Sbjct: 188 AFNEALIELGALVCTPRRPSCLLCPVQAYCQAFAEGVAEELPVKMKKTAVKQVPLAVAVL 247

Query: 246 ITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDG----NIDTHSAPFTANWI-LCNTIT 300
             ++ R+L+RKR +T LL  + E P               +                +  
Sbjct: 248 ADDEGRVLIRKRDSTGLLANLWEFPSCETDGADGKEKLEQMVGEQYGLQVELTEPIVSFE 307

Query: 301 HTFTHFTLTLFVWKTIVPQIVIIPDST-WHDAQNLANAALPTVMKKAL 347
           H F+H    L V+   +     + +         L   A P   ++  
Sbjct: 308 HAFSHLVWQLTVFPGRLVHGGPVEEPYRLAPEDELKAYAFPVSHQRVW 355


>1kg2_A A/G-specific adenine glycosylase; DNA repair, hydrolase; 1.20A {Escherichia coli} SCOP: a.96.1.2 PDB: 1kg3_A 1muy_A 1kg6_A 1kg5_A 1mun_A 1mud_A 1kg4_A 1weg_A 1wei_A* 1wef_A* 1kg7_A 1kqj_A Length = 225 Back     alignment and structure
>1kea_A Possible G-T mismatches repair enzyme; DNA repair, DNA glycosylase, DNA mismatch, methylation, base twisting, hydrolase; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.96.1.2 Length = 221 Back     alignment and structure
>1orn_A Endonuclease III; DNA repair, DNA glycosylase, [4Fe-4S] cluster, iron-sulfur cluster, hydrolase/DNA complex; HET: PED; 1.70A {Geobacillus stearothermophilus} SCOP: a.96.1.1 PDB: 1orp_A* 1p59_A* Length = 226 Back     alignment and structure
>1pu6_A 3-methyladenine DNA glycosylase; helix-hairpin-helix, base excision repair, hydrolase; HET: KCX; 1.64A {Helicobacter pylori} SCOP: a.96.1.5 PDB: 1pu7_A* 1pu8_A* Length = 218 Back     alignment and structure
>2abk_A Endonuclease III; DNA-repair, DNA glycosylase; 1.85A {Escherichia coli} SCOP: a.96.1.1 Length = 211 Back     alignment and structure
>1ngn_A Methyl-CPG binding protein MBD4; mismacth repair in methylated DNA, DNA binding protein; 2.10A {Mus musculus} SCOP: a.96.1.2 PDB: 3iho_A Length = 155 Back     alignment and structure
>1m3q_A 8-oxoguanine DNA glycosylase; DNA repair, END product, HOGG, 8-aminoguanine, RE-ligation, hydrolase/DNA complex; HET: DRZ ANG; 1.90A {Homo sapiens} SCOP: a.96.1.3 d.129.1.2 PDB: 1m3h_A* 1n39_A* 1lwy_A* 1hu0_A* 1lwv_A* 1lww_A* 1fn7_A* 1n3a_A* 1n3c_A* 1ebm_A* 1ko9_A 2noe_A* 2noh_A* 2nol_A* 1yqk_A 2noz_A* 2nof_A* 1yqr_A* 1yql_A* 1yqm_A* ... Length = 317 Back     alignment and structure
>3i0w_A 8-oxoguanine-DNA-glycosylase; OGG, cacogg, DNA, 8-OXOG, 8OXOG, glycosylase, cytosine, hydrolase,lyase/DNA complex; HET: 8OG; 1.73A {Clostridium acetobutylicum} PDB: 3i0x_A* 3f10_A* 3f0z_A Length = 290 Back     alignment and structure
>2jhn_A ALKA, 3-methyladenine DNA-glycosylase; DNA repair, N1-methyladenine, N3-methylcytosine, hyperthermophiles, hydrolase; HET: MBO MES; 1.8A {Archaeoglobus fulgidus} PDB: 2jhj_A Length = 295 Back     alignment and structure
>3fhf_A Mjogg, N-glycosylase/DNA lyase, DNA-; helix-hairpin-helix, 8-oxoguanine, 8-OXOG, DNA damage, DNA repair, glycosidase, hydrolase; 2.00A {Methanocaldococcus jannaschii} Length = 214 Back     alignment and structure
>3fhg_A Mjogg, N-glycosylase/DNA lyase, DNA-; helix-hairpin-helix, 8-oxoguanine, 8-OXOG, ssogg, DNA damage, DNA repair, glycosidase, hydrolase; 1.90A {Sulfolobus solfataricus} Length = 207 Back     alignment and structure
>1x51_A A/G-specific adenine DNA glycosylase; nudix domain, DNA repair, alpha-3 isoform, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.113.1.3 Length = 155 Back     alignment and structure
>1mut_A MUTT, nucleoside triphosphate pyrophosphohydrolase; DNA repair; NMR {Escherichia coli} SCOP: d.113.1.1 PDB: 1ppx_A* 1pun_A* 1puq_A* 1pus_A* 1tum_A* 3a6s_A* 3a6t_A* 3a6u_A* 3a6v_A* Length = 129 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target356 A/G-specific adenine glycosylase [Candidatus Liberibact
3fsp_A369 A/G-specific adenine glycosylase; protein-DNA complex, 100.0
3n5n_X287 A/G-specific adenine DNA glycosylase; alpha-helices, he 100.0
1kg2_A225 A/G-specific adenine glycosylase; DNA repair, hydrolase 100.0
1kea_A221 Possible G-T mismatches repair enzyme; DNA repair, DNA 100.0
1orn_A226 Endonuclease III; DNA repair, DNA glycosylase, [4Fe-4S] 100.0
2abk_A211 Endonuclease III; DNA-repair, DNA glycosylase; 1.85A {E 100.0
1pu6_A218 3-methyladenine DNA glycosylase; helix-hairpin-helix, b 100.0
3fhf_A214 Mjogg, N-glycosylase/DNA lyase, DNA-; helix-hairpin-hel 99.94
3fhg_A207 Mjogg, N-glycosylase/DNA lyase, DNA-; helix-hairpin-hel 99.83
2jhn_A295 ALKA, 3-methyladenine DNA-glycosylase; DNA repair, N1-m 99.6
2h56_A233 DNA-3-methyladenine glycosidase; 10174367, EC 3.2.2.-, 99.35
1mpg_A282 ALKA, 3-methyladenine DNA glycosylase II; DNA repair, b 99.14
1ngn_A155 Methyl-CPG binding protein MBD4; mismacth repair in met 99.95
1m3q_A317 8-oxoguanine DNA glycosylase; DNA repair, END product, 99.7
3i0w_A290 8-oxoguanine-DNA-glycosylase; OGG, cacogg, DNA, 8-OXOG, 99.61
1x51_A155 A/G-specific adenine DNA glycosylase; nudix domain, DNA 99.87
3ees_A153 Probable pyrophosphohydrolase; nudix, RNA pyrophosphohy 99.45
3hhj_A158 Mutator MUTT protein; niaid, ssgcid, decode, UW, SBRI, 99.26
1mut_A129 MUTT, nucleoside triphosphate pyrophosphohydrolase; DNA 99.15
3gwy_A140 Putative CTP pyrophosphohydrolase; structural genomics, 99.07
3grn_A153 MUTT related protein; structural genomics, hydrolase, P 98.77
3oga_A165 Nucleoside triphosphatase NUDI; salmonella enterica sub 98.7
3fk9_A188 Mutator MUTT protein; structural genomics, hydrolase, P 98.13
1iry_A156 HMTH1; nudix motif(G37-L59), hydrolase; NMR {Homo sapie 98.09
2pbt_A134 AP4A hydrolase; nudix protein, diadenosine polyphosphat 98.07
3exq_A161 Nudix family hydrolase; protein structure initiative II 97.98
3gg6_A156 Nudix motif 18, nucleoside diphosphate-linked moiety X 97.93
1vcd_A126 NDX1; nudix protein, diadenosine polyphosphate, AP6A, h 97.91
2kdv_A164 RNA pyrophosphohydrolase; nudix family, magnesium, mang 97.89
2b06_A155 MUTT/nudix family protein; structural genomics, PSI, pr 97.87
3id9_A171 MUTT/nudix family protein; hydrolase, protein structure 97.85
2pqv_A154 MUTT/nudix family protein; structural genomics, PSI-2, 97.66
1nqz_A194 COA pyrophosphatase (MUTT/nudix family protein); D.radi 97.66
1f3y_A165 Diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase; enz 97.64
2fkb_A180 Putative nudix hydrolase YFCD; putative protein, MAD, s 97.63
3cng_A189 Nudix hydrolase; structural genomics, APC7497, PSI-2, p 97.63
1vk6_A269 NADH pyrophosphatase; 1790429, structural genomics, JCS 97.61
2o1c_A150 DATP pyrophosphohydrolase; nudix NTP hydrolase NTP pyro 97.59
2b0v_A153 Nudix hydrolase; structural genomics, PSI, protein stru 97.59
3dku_A153 Putative phosphohydrolase; nudix hydrolase, ORF153, YMF 97.59
1k2e_A156 Nudix homolog; nudix/MUTT-like fold, mixed alpha/beta, 97.55
3f13_A163 Putative nudix hydrolase family member; structural geno 97.52
2azw_A148 MUTT/nudix family protein; MUTT/nudix ,enterococcus fae 97.47
2qjo_A341 Bifunctional NMN adenylyltransferase/nudix hydrolase; t 97.46
1hzt_A190 Isopentenyl diphosphate delta-isomerase; dimethylallyl, 97.4
3h95_A199 Nucleoside diphosphate-linked moiety X motif 6; NUDT6, 97.33
1rya_A160 GDP-mannose mannosyl hydrolase; GDP-glucose, nudix, nud 97.32
1sjy_A159 MUTT/nudix family protein; nudix fold, alpha-beta-alpha 97.31
3eds_A153 MUTT/nudix family protein; MUT/nudix protein, protein s 97.27
3o8s_A206 Nudix hydrolase, ADP-ribose pyrophosphatase; structural 97.27
1q27_A171 Putative nudix hydrolase DR0079; radiation resistance; 97.08
3fcm_A197 Hydrolase, nudix family; protein structure initiative I 97.06
2jvb_A146 Protein PSU1, mRNA-decapping enzyme subunit 2; DCP2, mR 96.9
2qjt_B352 Nicotinamide-nucleotide adenylyltransferase; two indivi 96.81
3f6a_A159 Hydrolase, nudix family; protein structure initiative I 96.64
3gz5_A240 MUTT/nudix family protein; DNA binding protein, nudix d 96.59
2a6t_A271 SPAC19A8.12; alpha/beta/alpha, RNA binding protein,hydr 96.58
2fvv_A194 Diphosphoinositol polyphosphate phosphohydrolase 1; nud 96.54
1v8y_A170 ADP-ribose pyrophosphatase; nudix motif, loop-helix-loo 96.52
1xsa_A153 BIS(5'-nucleosyl)-tetraphosphatase; nudix enzyme, human 96.2
2fb1_A226 Conserved hypothetical protein; structural genomics, PS 95.97
3e57_A211 Uncharacterized protein TM1382; structural genomics, nu 95.67
2w4e_A145 MUTT/nudix family protein; ADP-ribose pyrophosphatase, 95.14
3fjy_A 364 Probable MUTT1 protein; dimer, protein structure initia 95.13
2fml_A273 MUTT/nudix family protein; structural genomics, PSI, pr 95.08
2yvp_A182 NDX2, MUTT/nudix family protein; nudix protein, ADP-rib 94.98
1mk1_A207 ADPR pyrophosphatase; nudix hydrolase, adprase, adenosi 94.77
1vhz_A198 ADP compounds hydrolase NUDE; structural genomics; HET: 94.58
1u20_A212 U8 snoRNA-binding protein X29; modified nudix hydrolase 94.38
3i9x_A187 MUTT/nudix family protein; structural genomics, hydrola 97.43
1ktg_A138 Diadenosine tetraphosphate hydrolase; nudix, AMP, magne 96.86
2yyh_A139 MUTT domain, 8-OXO-DGTPase domain; nudix family protein 96.52
2xsq_A217 U8 snoRNA-decapping enzyme; hydrolase, mRNA decapping, 94.67
2dho_A235 Isopentenyl-diphosphate delta-isomerase 1; alpha/beta p 96.12
2pny_A246 Isopentenyl-diphosphate delta-isomerase 2; carotenoid b 95.04
2edu_A98 Kinesin-like protein KIF22; kinesin-like DNA binding do 92.37
>3fsp_A A/G-specific adenine glycosylase; protein-DNA complex, DNA glycosylase, transition state analog, DNA repair; HET: NRI; 2.20A {Geobacillus stearothermophilus} PDB: 3fsq_A* 1rrs_A* 1vrl_A* 1rrq_A* 3g0q_A* Back     alignment and structure
Probab=100.00  E-value=0  Score=757.78  Aligned_cols=339  Identities=32%  Similarity=0.597  Sum_probs=309.3

Q ss_pred             CHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCHHHCCHHHHHHHHHCCCHHHHHCCCHHHHH
Q ss_conf             16899999999999628998875485544456787046766446731161203326589987748997898729989999
Q gi|254780479|r    4 PEHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQKWPTIFCLSSAKDEEIL   83 (356)
Q Consensus         4 ~~~~~~~~ll~w~~~~~R~lpwr~~~~~~~~~~~~py~v~vseimlqqT~v~~v~~~~~~~~~~~P~~~~la~a~~~~vl   83 (356)
                      +++.|++.||+||+.|+|+||||++        +|||+|||||||||||||++|++||++|+++|||+++||+|+++||+
T Consensus        12 ~~~~~~~~ll~wy~~~~r~lpWr~~--------~~py~vlvseil~qqT~~~~v~~~~~~~~~~~pt~~~la~a~~~ev~   83 (369)
T 3fsp_A           12 PAREFQRDLLDWFARERRDLPWRKD--------RDPYKVWVSEVMLQQTRVETVIPYFEQFIDRFPTLEALADADEDEVL   83 (369)
T ss_dssp             CHHHHHHHHHHHHHHHCCCCGGGSC--------CCHHHHHHHHHHTTTSCHHHHHHHHHHHHHHCCSHHHHHTSCHHHHH
T ss_pred             CHHHHHHHHHHHHHHCCCCCCCCCC--------CCHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCHHHHHCCCHHHHH
T ss_conf             5999999999999846988998989--------98799999999861087889999999999977899999778999999


Q ss_pred             HHHHCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCEEEECCCCHHHHHHHHHCCCCC
Q ss_conf             99740463458899987767543005786873145688888777877667766434963131243146665765197545
Q gi|254780479|r   84 SAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKP  163 (356)
Q Consensus        84 ~~w~gLGyy~Rar~l~~~a~~i~~~~~g~~P~~~~~l~~LpGiG~yta~ai~s~a~~~~~~~vD~Nv~RVl~R~~~~~~~  163 (356)
                      ++|+|||||+||+|||++|++|+++|+|.+|.+.++|++|||||+|||+||+|||||+++++|||||.||++|++++..+
T Consensus        84 ~~~~~lGyy~ra~~l~~~a~~i~~~~~g~~P~~~~~L~~LpGVG~~TA~ail~~a~~~~~~~vD~nv~Rv~~R~~~~~~~  163 (369)
T 3fsp_A           84 KAWEGLGYYSRVRNLHAAVKEVKTRYGGKVPDDPDEFSRLKGVGPYTVGAVLSLAYGVPEPAVDGNVMRVLSRLFLVTDD  163 (369)
T ss_dssp             HTTTTSSCTHHHHHHHHHHHHHHHHHTTCCCCSHHHHHTSTTCCHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHTTCCSC
T ss_pred             HHHHHCCHHHHHHHHHHCCCCEEECCCCCCCCCHHHHHHCCCHHHHHHHHHHHHHCCCCCCEECCCHHHHHHHHCCCCCC
T ss_conf             99874688999999985212276004899998799985242258899999999861488612248513567543044688


Q ss_pred             C--CHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHCCCCCCCCCCCCCCCCCCEEEE
Q ss_conf             7--35689998741025785226789999999986320412356431100000134310110012344322222211232
Q gi|254780479|r  164 A--PLYHKTIKNYARKITSTSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGA  241 (356)
Q Consensus       164 ~--~~~~k~l~~~~~~~~~~~~~~~~nQAlMdlGa~iC~p~~P~C~~Cpl~~~C~~~~~~~~~~~P~kk~KKkk~~r~~~  241 (356)
                      .  +...+.++.+++.++|..++++||||||||||+||+|++|+|..|||++.|.||+.|.++.||+|++|++++.+...
T Consensus       164 ~~~~~~~~~~~~~~~~~~~~~~~~~~nqalmdlG~~iC~~~~P~C~~CPl~~~C~~~~~~~~~~~P~k~kK~~~~~~~~~  243 (369)
T 3fsp_A          164 IAKPSTRKRFEQIVREIMAYENPGAFNEALIELGALVCTPRRPSCLLCPVQAYCQAFAEGVAEELPVKMKKTAVKQVPLA  243 (369)
T ss_dssp             TTSHHHHHHHHHHHHHHCCSSSHHHHHHHHHHHHHHTSCSSSCCTTTCTTGGGCHHHHHTCGGGCSCCCCCCCCEEEEEE
T ss_pred             CCCCHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHCHHHCCCCHHHCCCCCCCCCCCCCCHH
T ss_conf             87511467788753035876775688999999756415689998988985332776527997656788778876532046


Q ss_pred             EEEEEECCCEEEEEECCCCHHHHCCCCCCCCCCCCCCCHHHHH-----HCCCCCCCCEECCCEEEEEEEEEEEEEEEEEE
Q ss_conf             0003413760577645720132047442111134672158886-----30101000021373589983159999999998
Q gi|254780479|r  242 VFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDT-----HSAPFTANWILCNTITHTFTHFTLTLFVWKTI  316 (356)
Q Consensus       242 ~~vii~~~~kiLL~KRp~~gll~GLwEFP~~e~~~~~~~~~~~-----~~~~~~~~~~~l~~ikH~fTH~~L~i~v~~~~  316 (356)
                      ++++++.+|++||+||+++|+|+||||||+++++..+......     ...........+++|+|+||||++++++|.+.
T Consensus       244 ~~i~~~~~~~iLl~kR~~~gll~GLweFP~~~~e~~~~~~~l~r~l~ee~~i~~~~~~~l~~v~H~fSH~~l~l~vy~~~  323 (369)
T 3fsp_A          244 VAVLADDEGRVLIRKRDSTGLLANLWEFPSCETDGADGKEKLEQMVGEQYGLQVELTEPIVSFEHAFSHLVWQLTVFPGR  323 (369)
T ss_dssp             EEEEECSSSEEEEEECCSSSTTTTCEECCEEECSSSCTHHHHHHHHTTSSSCCEEECCCCCEEEEECSSEEEEEEEEEEE
T ss_pred             HHHHHCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCHHCCCCCEEEEECCCEEEEEEEEEEE
T ss_conf             76641217888998625544457876288566576430778998889870886011140451589658968999999999


Q ss_pred             CCCCC-CCCCCEEECHHHHHHCCCCHHHHHHHHHC
Q ss_conf             07767-66781332278887479987899999844
Q gi|254780479|r  317 VPQIV-IIPDSTWHDAQNLANAALPTVMKKALSAG  350 (356)
Q Consensus       317 ~~~~~-~~~~~~Wv~~~el~~~~LPs~~kKIL~al  350 (356)
                      +.+.. ..++++|++.+++++++||++++|||+.+
T Consensus       324 ~~~~~~~~~~~~Wv~~~el~~~~lp~~~kKIl~~~  358 (369)
T 3fsp_A          324 LVHGGPVEEPYRLAPEDELKAYAFPVSHQRVWREY  358 (369)
T ss_dssp             ECCSSCCCTTEEEEEGGGGGGSCCCHHHHHHHHHH
T ss_pred             ECCCCCCCCCCEEEEHHHHHHCCCCHHHHHHHHHH
T ss_conf             67898788787884389876689998999999999



>1kg2_A A/G-specific adenine glycosylase; DNA repair, hydrolase; 1.20A {Escherichia coli} SCOP: a.96.1.2 PDB: 1kg3_A 1muy_A 1kg6_A 1kg5_A 1mun_A 1mud_A 1kg4_A 1weg_A 1wei_A* 1wef_A* 1kg7_A 1kqj_A Back     alignment and structure
>1kea_A Possible G-T mismatches repair enzyme; DNA repair, DNA glycosylase, DNA mismatch, methylation, base twisting, hydrolase; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.96.1.2 Back     alignment and structure
>1orn_A Endonuclease III; DNA repair, DNA glycosylase, [4Fe-4S] cluster, iron-sulfur cluster, hydrolase/DNA complex; HET: PED; 1.70A {Geobacillus stearothermophilus} SCOP: a.96.1.1 PDB: 1orp_A* 1p59_A* Back     alignment and structure
>2abk_A Endonuclease III; DNA-repair, DNA glycosylase; 1.85A {Escherichia coli} SCOP: a.96.1.1 Back     alignment and structure
>1pu6_A 3-methyladenine DNA glycosylase; helix-hairpin-helix, base excision repair, hydrolase; HET: KCX; 1.64A {Helicobacter pylori} SCOP: a.96.1.5 PDB: 1pu7_A* 1pu8_A* Back     alignment and structure
>3fhf_A Mjogg, N-glycosylase/DNA lyase, DNA-; helix-hairpin-helix, 8-oxoguanine, 8-OXOG, DNA damage, DNA repair, glycosidase, hydrolase; 2.00A {Methanocaldococcus jannaschii} PDB: 3knt_A* Back     alignment and structure
>3fhg_A Mjogg, N-glycosylase/DNA lyase, DNA-; helix-hairpin-helix, 8-oxoguanine, 8-OXOG, ssogg, DNA damage, DNA repair, glycosidase, hydrolase; 1.90A {Sulfolobus solfataricus} Back     alignment and structure
>2jhn_A ALKA, 3-methyladenine DNA-glycosylase; DNA repair, N1-methyladenine, N3-methylcytosine, hyperthermophiles, hydrolase; HET: MBO MES; 1.8A {Archaeoglobus fulgidus} PDB: 2jhj_A Back     alignment and structure
>2h56_A DNA-3-methyladenine glycosidase; 10174367, EC 3.2.2.-, structural genomics, PSI-2, protein structure initiative; 2.55A {Bacillus halodurans} Back     alignment and structure
>1mpg_A ALKA, 3-methyladenine DNA glycosylase II; DNA repair, base excision, methylation, hydrolase; 1.80A {Escherichia coli} SCOP: a.96.1.3 d.129.1.2 PDB: 1diz_A 1pvs_A* 3cvs_A* 3cvt_A* 3cw7_A* 3cwa_A* 3cws_A* 3cwt_A* 3cwu_A* 3d4v_A* Back     alignment and structure
>1ngn_A Methyl-CPG binding protein MBD4; mismacth repair in methylated DNA, DNA binding protein; 2.10A {Mus musculus} SCOP: a.96.1.2 PDB: 3iho_A Back     alignment and structure
>1m3q_A 8-oxoguanine DNA glycosylase; DNA repair, END product, HOGG, 8-aminoguanine, RE-ligation, hydrolase/DNA complex; HET: DRZ ANG; 1.90A {Homo sapiens} SCOP: a.96.1.3 d.129.1.2 PDB: 1m3h_A* 1n39_A* 1lwy_A* 1hu0_A* 1lwv_A* 1lww_A* 1fn7_A* 1n3a_A* 1n3c_A* 1ebm_A* 1ko9_A 2noe_A* 2noh_A* 2nol_A* 3ktu_A* 1yqk_A 2noz_A* 2nof_A* 1yqr_A* 1yql_A* ... Back     alignment and structure
>3i0w_A 8-oxoguanine-DNA-glycosylase; OGG, cacogg, DNA, 8-OXOG, 8OXOG, glycosylase, cytosine, hydrolase,lyase/DNA complex; HET: 8OG; 1.73A {Clostridium acetobutylicum} PDB: 3i0x_A* 3f10_A* 3f0z_A Back     alignment and structure
>1x51_A A/G-specific adenine DNA glycosylase; nudix domain, DNA repair, alpha-3 isoform, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.113.1.3 Back     alignment and structure
>3ees_A Probable pyrophosphohydrolase; nudix, RNA pyrophosphohydrolase; 1.90A {Bdellovibrio bacteriovorus} PDB: 3eeu_A 3ef5_A* 3ffu_A* Back     alignment and structure
>3hhj_A Mutator MUTT protein; niaid, ssgcid, decode, UW, SBRI, infectious diseases, hydrolase, structural genomics; 2.10A {Bartonella henselae str} Back     alignment and structure
>1mut_A MUTT, nucleoside triphosphate pyrophosphohydrolase; DNA repair; NMR {Escherichia coli} SCOP: d.113.1.1 PDB: 1ppx_A* 1pun_A* 1puq_A* 1pus_A* 1tum_A* 3a6s_A* 3a6t_A* 3a6u_A* 3a6v_A* Back     alignment and structure
>3gwy_A Putative CTP pyrophosphohydrolase; structural genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>3grn_A MUTT related protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 1.70A {Methanosarcina mazei} Back     alignment and structure
>3oga_A Nucleoside triphosphatase NUDI; salmonella enterica subsp. enterica serovar typhimurium STR. unknown function; HET: PO4; 1.75A {Salmonella enterica subsp} PDB: 3n77_A Back     alignment and structure
>3fk9_A Mutator MUTT protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.50A {Bacillus halodurans} Back     alignment and structure
>1iry_A HMTH1; nudix motif(G37-L59), hydrolase; NMR {Homo sapiens} SCOP: d.113.1.1 Back     alignment and structure
>3exq_A Nudix family hydrolase; protein structure initiative II(PSI II), NYSGXRC, 11180K, structural genomics; 2.00A {Lactobacillus brevis atcc 367} Back     alignment and structure
>3gg6_A Nudix motif 18, nucleoside diphosphate-linked moiety X motif 18; NUDT18, NXR1, nucleotide hydrolase, hydrolase, structural genomics; 2.10A {Homo sapiens} Back     alignment and structure
>1vcd_A NDX1; nudix protein, diadenosine polyphosphate, AP6A, hydrolase, riken structural genomics/proteomics initiative, RSGI; 1.70A {Thermus thermophilus HB8} SCOP: d.113.1.1 PDB: 1vc8_A 1vc9_A* Back     alignment and structure
>2kdv_A RNA pyrophosphohydrolase; nudix family, magnesium, manganese, zinc; NMR {Escherichia coli} PDB: 2kdw_A Back     alignment and structure
>2b06_A MUTT/nudix family protein; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.40A {Streptococcus pneumoniae} SCOP: d.113.1.1 Back     alignment and structure
>3id9_A MUTT/nudix family protein; hydrolase, protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.55A {Bacillus thuringiensis str} Back     alignment and structure
>2pqv_A MUTT/nudix family protein; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 1.63A {Streptococcus pneumoniae TIGR4} Back     alignment and structure
>1nqz_A COA pyrophosphatase (MUTT/nudix family protein); D.radiodurans, hydrolase; 1.70A {Deinococcus radiodurans} SCOP: d.113.1.1 PDB: 1nqy_A Back     alignment and structure
>1f3y_A Diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase; enzyme,mixed 4-stranded beta sheet, 2-stranded antiparallel sheet; NMR {Lupinus angustifolius} SCOP: d.113.1.1 PDB: 1jkn_A* Back     alignment and structure