254780480

254780480

2'-deoxycytidine 5'-triphosphate deaminase

GeneID in NCBI database:8209469Locus tag:CLIBASIA_01825
Protein GI in NCBI database:254780480Protein Accession:YP_003064893.1
Gene range:-(401817, 402920)Protein Length:367aa
Gene description:2'-deoxycytidine 5'-triphosphate deaminase
COG prediction:none
KEGG prediction:2'-deoxycytidine 5'-triphosphate deaminase (EC:3.5.4.13); K01494 dCTP deaminase [EC:3.5.4.13]
SEED prediction:Deoxycytidine triphosphate deaminase (EC 3.5.4.13)
Pathway involved in KEGG:Pyrimidine metabolism [PATH:las00240]
Subsystem involved in SEED:pyrimidine conversions
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOP1 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------
MNKGVLPDKAIATLAERGDIVSEHPLEKNQIQPASIDLRLSSKAYRVRASFLPNIDGLVSDKIKHFKLREIDLSGGTVLDANCVYIVPLMESLNLKNGISAYANPKSSIGRIDVFARVIGDRSQEFDSISPNYSGPLYLEILPRTFPIVVRVGSRLSQIRFVKERKFCSQEELSALHELSPLVQDGLRDFSGKGVALSVDLKGNEIGKKSIIGYRAKRHTAAIDVDSENKYDESDFWDPLFSWDAPEGQFILDPNEFYIFASREFIQIPPSLVAEMIPYDHSIGEFRVHYAGFFDPGFGCVLPQEVGAKAVLEVRSSVPFVLEHGQIIGRLKYESMDGEPERLYGEARGSHYQSQALKLSKHFHQTQ
cccccccHHHHHHHHHcccEEEcccccHHHccccEEEEEEccEEEEEEEEEcccccccccccccccccEEEEccccEEEccccEEEEEEEEEEEcccccEEEEcccccEEEEEEEEEEEccccccccccccccccEEEEEEEccccEEEEccccEEEEEEEEcccccccHHHHHHHHHccccccccccccccccEEEEEEEccccccccccEEEEEEccccEEEccccccccHHHHHHHHHccccccccEEEccccEEEEEEEEEEEcccccEEEEccccccEEEEEEEEccccccccccEEEEcccccEEEEEcccccEEEEcccEEEEEEEEEccccHHHHccccccccccccHHHHHHHHHHcc
cccccccHHHHHHHHHcccccccccccHHHccccEEEEcccccEEEHHHHccccccccHHHHHHHcEEEEEEcccccccccccEEEEEcccEEEcccccEEEEccccccccccEEEEEEccccccccccccccccEEEEEEccccccEEEcccccEEEEEEEEccccccHHHHHHHHHccccccccccccccccEEEEEEcccccccccccEEEEccccccEEEHHHHccccHHHHHHHHHcccccccEEEEccccEEEEEEcEEcEcccHHHHHHccccccccEEEEEEEccccccccccccccccccEEEEEccccccEcccccEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHccccc
MNKGVLPDKAIATLAergdivsehpleknqiqpasidlrlsskaYRVRAsflpnidglvsdkikhfklreidlsggtvldancvYIVPLmeslnlkngisayanpkssigrIDVFARVIgdrsqefdsispnysgplyleilprtFPIVVRVGSRLSQIRFVKERKFCSQEELSALHELSPLVQDGLRDFSGKGVALSVdlkgneigkkSIIGYRAkrhtaaidvdsenkydesdfwdplfswdapegqfildpnefyifasrefiqippslvaemipydhsigefrvhyagffdpgfgcvlpqeVGAKAVLEVRssvpfvlehgqiigrlkyesmdgeperlygeargshYQSQALKLskhfhqtq
MNKGVLPDKAIATLaergdivsehpleknqiqpasIDLRLSSKAYRVRAsflpnidglvsdkIKHFKLReidlsggtvlDANCVYIVPLMESLNLKNGISAYANPKSSIGRIDVFARVIGDRsqefdsispnySGPLYLEILPRTFPIVVRVGSRLSQIRFVKERKFCSQEELSALHELSPLVQDGLRDFSGKGVAlsvdlkgneigkksiigyrakrhtaaidvdsenkYDESDFWDPLFSWDAPEGQFILDPNEFYIFASREFIQIPPSLVAEMIPYDHSIGEFRVHYAGFFDPGFGCVLPQEVGAKAVLEVRssvpfvlehgqiigrlkyesmDGEPERLYGEARGSHYQSQALKLSKHFHQTQ
MNKGVLPDKAIATLAERGDIVSEHPLEKNQIQPASIDLRLSSKAYRVRASFLPNIDGLVSDKIKHFKLREIDLSGGTVLDANCVYIVPLMESLNLKNGISAYANPKSSIGRIDVFARVIGDRSQEFDSISPNYSGPLYLEILPRTFPIVVRVGSRLSQIRFVKERKFCSQEELSALHELSPLVQDGLRDFSGKGVALSVDLKGNEIGKKSIIGYRAKRHTAAIDVDSENKYDESDFWDPLFSWDAPEGQFILDPNEFYIFASREFIQIPPSLVAEMIPYDHSIGEFRVHYAGFFDPGFGCVLPQEVGAKAVLEVRSSVPFVLEHGQIIGRLKYESMDGEPERLYGEARGSHYQSQALKLSKHFHQTQ
*NKGVLPDKAIATLAERGDIVSEHPLEKNQIQPASIDLRLSSKAYRVRASFLPNIDGLVSDKIKHFKLREIDLSGGTVLDANCVYIVPLMESLNLKNGISAYANPKSSIGRIDVFARVIGDRSQEFDSISPNYSGPLYLEILPRTFPIVVRVGSRLSQIRFVKERKFCSQEELSALHELSPLVQDGLRDFSGKGVALSVDLKGNEIGKKSIIGYRAKRHTAAIDVDSENKYDESDFWDPLFSWDAPEGQFILDPNEFYIFASREFIQIPPSLVAEMIPYDHSIGEFRVHYAGFFDPGFGCVLPQEVGAKAVLEVRSSVPFVLEHGQIIGRLKYESMDGEPERLYGEARG**YQ***LK*********
MNKGVLPDKAIATLAERGDIVSEHPLEKNQIQPASIDLRLSSKAYRVRASFLPNIDGLVSDKIKHFKLREIDLSGGTVLDANCVYIVPLMESLNLKNGISAYANPKSSIGRIDVFARVIGDRSQEFDSISPNYSGPLYLEILPRTFPIVVRVGSRLSQIRFVKERKFCSQEELSALHELSPLVQDGLRDFSGKGVALSVDLKGNEIGKKSIIGYRAKRHTAAIDVDSENKYDESDFWDPLFSWDAPEGQFILDPNEFYIFASREFIQIPPSLVAEMIPYDHSIGEFRVHYAGFFDPGFGCVLPQEVGAKAVLEVRSSVPFVLEHGQIIGRLKYESMDGEPERLYGEARGSHYQSQALKLSKHFHQTQ
***GVLPDKAIATLAERGDIVSEHPLEKNQIQPASIDLRLSSKAYRVRASFLPNIDGLVSDKIKHFKLREIDLSGGTVLDANCVYIVPLMESLNLKNGISAYANPKSSIGRIDVFARVIGDRSQEFDSISPNYSGPLYLEILPRTFPIVVRVGSRLSQIRFVKERKFCSQEELSALHELSPLVQDGLRDFSGKGVALSVDLKGNEIGKKSIIGYRAKRHTAAIDVDSENKYDESDFWDPLFSWDAPEGQFILDPNEFYIFASREFIQIPPSLVAEMIPYDHSIGEFRVHYAGFFDPGFGCVLPQEVGAKAVLEVRSSVPFVLEHGQIIGRLKYESMDGEPERLYGEARGSHYQSQALKLSKHF****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNKGVLPDKAIATLAERGDIVSEHPLEKNQIQPASIDLRLSSKAYRVRASFLPNIDGLVSDKIKHFKLREIDLSGGTVLDANCVYIVPLMESLNLKNGISAYANPKSSIGRIDVFARVIGDRSQEFDSISPNYSGPLYLEILPRTFPIVVRVGSRLSQIRFVKERKFCSQEELSALHELSPLVQDGLRDFSGKGVALSVDLKGNEIGKKSIIGYRAKRHTAAIDVDSENKYDESDFWDPLFSWDAPEGQFILDPNEFYIFASREFIQIPPSLVAEMIPYDHSIGEFRVHYAGFFDPGFGCVLPQEVGAKAVLEVRSSVPFVLEHGQIIGRLKYESMDGEPERLYGEARGSHYQSQALKLSKHFHQTQ
MNKGVLPDKAIATLAERGDIVSEHPLEKNQIQPASIDLRLSSKAYRVRASFLPNIDGLVSDKIKHFKLREIDLSGGTVLDANCVYIVPLMESLNLKNGISAYANPKSSIGRIDVFARVIGDRSQEFDSISPNYSGPLYLEILPRTFPIVVRVGSRLSQIRFVKERKFCSQEELSALHELSPLVQDGLRDFSGKGVALSVDLKGNEIGKKSIIGYRAKRHTAAIDVDSENKYDESDFWDPLFSWDAPEGQFILDPNEFYIFASREFIQIPPSLVAEMIPYDHSIGEFRVHYAGFFDPGFGCVLPQEVGAKAVLEVRSSVPFVLEHGQIIGRLKYESMDGEPERLYGEARGSHYQSQALKLSKHFHQTQ
MNKGVLPDKAIATLAERGDIVSEHPLEKNQIQPASIDLRLSSKAYRVRASFLPNIDGLVSDKIKHFKLREIDLSGGTVLDANCVYIVPLMESLNLKNGISAYANPKSSIGRIDVFARVIGDRSQEFDSISPNYSGPLYLEILPRTFPIVVRVGSRLSQIRFVKERKFCSQEELSALHELSPLVQDGLRDFSGKGVALSVDLKGNEIGKKSIIGYRAKRHTAAIDVDSENKYDESDFWDPLFSWDAPEGQFILDPNEFYIFASREFIQIPPSLVAEMIPYDHSIGEFRVHYAGFFDPGFGCVLPQEVGAKAVLEVRSSVPFVLEHGQIIGRLKYESMDGEPERLYGEARGSHYQSQALKLSKHFHQTQ

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target367 2'-deoxycytidine 5'-triphosphate deaminase [Candidatus
315122064362 2'-deoxycytidine 5'-triphosphate deaminase [Candidatus 1 1e-129
255597193363 conserved hypothetical protein [Ricinus communis] Lengt 1 1e-113
222084791363 deoxycytidine triphosphate deaminase [Agrobacterium rad 1 1e-113
227820742365 2'-deoxycytidine 5'-triphosphate deaminase [Sinorhizobi 1 1e-112
307307013365 2-deoxycytidine 5-triphosphate deaminase [Sinorhizobium 1 1e-112
190890225363 deoxycytidine triphosphate deaminase [Rhizobium etli CI 1 1e-112
218675129364 2'-deoxycytidine 5'-triphosphate deaminase [Rhizobium e 1 1e-112
15964276365 2'-deoxycytidine 5'-triphosphate deaminase [Sinorhizobi 1 1e-112
327190084381 deoxycytidine triphosphate deaminase protein [Rhizobium 1 1e-112
256159009363 2'-deoxycytidine 5'-triphosphate deaminase [Brucella ce 1 1e-112
>gi|315122064|ref|YP_004062553.1| 2'-deoxycytidine 5'-triphosphate deaminase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 362 Back     alignment and organism information
 Score =  467 bits (1202), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 236/367 (64%), Positives = 284/367 (77%), Gaps = 5/367 (1%)

Query: 1   MNKGVLPDKAIATLAERGDIVSEHPLEKNQIQPASIDLRLSSKAYRVRASFLPNIDGLVS 60
           M  GVLPDK I  L   G+I+++ PL ++Q+QP+S+DLRLS+KAYRV ASFLP  +GLV 
Sbjct: 1   MGIGVLPDKFITELVANGEIIADCPLAEDQVQPSSLDLRLSAKAYRVSASFLPKDEGLVL 60

Query: 61  DKIKHFKLREIDLSGGTVLDANCVYIVPLMESLNLKNGISAYANPKSSIGRIDVFARVIG 120
           D+I+ FKL EIDL  G VL+ NCVYIVPLMESL L+ G+ AYANPKSSIGRIDV ARV+ 
Sbjct: 61  DRIERFKLHEIDLLEGAVLEENCVYIVPLMESLKLQGGMYAYANPKSSIGRIDVLARVLV 120

Query: 121 DRSQEFDSISPNYSGPLYLEILPRTFPIVVRVGSRLSQIRFVKERKFCSQEELSALHELS 180
           DR+ +FD I  NY G LYLEIL  +FPI VR GSRLSQ+RF+ +R+  S+E+L  LH+  
Sbjct: 121 DRNSQFDCIPANYCGRLYLEILSLSFPITVRTGSRLSQLRFMYKREVFSKEKLLLLHQEK 180

Query: 181 PLVQDGLRDFSGKGVALSVDLKGNEIGKKSIIGYRAKRHTAAIDVDSENKYDESDFWDPL 240
           PL+Q G+ DFS +G+ALSV+LKG E     IIGYR+KRHTAAIDVDS+  YD +DFWDPL
Sbjct: 181 PLIQGGIVDFSDEGIALSVNLKG-EGNSGQIIGYRSKRHTAAIDVDSKKAYDIADFWDPL 239

Query: 241 FSWDAPEGQFILDPNEFYIFASREFIQIPPSLVAEMIPYDHSIGEFRVHYAGFFDPGFGC 300
           +S +      +L PNEFYI AS+EF+QIPP +VAEM PY+  IGEFRVHYAGFFDPGFG 
Sbjct: 240 YSQEG--NGLVLYPNEFYILASQEFVQIPPLIVAEMCPYNPLIGEFRVHYAGFFDPGFG- 296

Query: 301 VLPQEVGAKAVLEVRSSVPFVLEHGQIIGRLKYESMDGEPERLYGEARGSHYQSQALKLS 360
             P+  GAKAVLEVRS VPF LEH QIIGRL+YESM  EPE LYG+ RGS+YQ+Q LKLS
Sbjct: 297 -YPEGSGAKAVLEVRSYVPFFLEHSQIIGRLRYESMMKEPENLYGDTRGSNYQAQGLKLS 355

Query: 361 KHFHQTQ 367
           KHF   +
Sbjct: 356 KHFRAIE 362


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|255597193|ref|XP_002536717.1| conserved hypothetical protein [Ricinus communis] Length = 363 Back     alignment and organism information
>gi|222084791|ref|YP_002543320.1| deoxycytidine triphosphate deaminase [Agrobacterium radiobacter K84] Length = 363 Back     alignment and organism information
>gi|227820742|ref|YP_002824712.1| 2'-deoxycytidine 5'-triphosphate deaminase [Sinorhizobium fredii NGR234] Length = 365 Back     alignment and organism information
>gi|307307013|ref|ZP_07586752.1| 2-deoxycytidine 5-triphosphate deaminase [Sinorhizobium meliloti BL225C] Length = 365 Back     alignment and organism information
>gi|190890225|ref|YP_001976767.1| deoxycytidine triphosphate deaminase [Rhizobium etli CIAT 652] Length = 363 Back     alignment and organism information
>gi|218675129|ref|ZP_03524798.1| 2'-deoxycytidine 5'-triphosphate deaminase [Rhizobium etli GR56] Length = 364 Back     alignment and organism information
>gi|15964276|ref|NP_384629.1| 2'-deoxycytidine 5'-triphosphate deaminase [Sinorhizobium meliloti 1021] Length = 365 Back     alignment and organism information
>gi|327190084|gb|EGE57200.1| deoxycytidine triphosphate deaminase protein [Rhizobium etli CNPAF512] Length = 381 Back     alignment and organism information
>gi|256159009|ref|ZP_05456846.1| 2'-deoxycytidine 5'-triphosphate deaminase [Brucella ceti M490/95/1] Length = 363 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target367 2'-deoxycytidine 5'-triphosphate deaminase [Candidatus
PRK07559365 PRK07559, PRK07559, 2'-deoxycytidine 5'-triphosphate de 1e-177
pfam06559366 pfam06559, DCD, 2'-deoxycytidine 5'-triphosphate deamin 1e-142
TIGR02274179 TIGR02274, dCTP_deam, deoxycytidine triphosphate deamin 3e-11
COG0717183 COG0717, Dcd, Deoxycytidine deaminase [Nucleotide trans 3e-10
PRK00416177 PRK00416, dcd, deoxycytidine triphosphate deaminase; Re 7e-04
cd0755792 cd07557, trimeric_dUTPase, Trimeric dUTP diphosphatases 6e-08
PRK00416177 PRK00416, dcd, deoxycytidine triphosphate deaminase; Re 1e-04
TIGR02274179 TIGR02274, dCTP_deam, deoxycytidine triphosphate deamin 3e-07
COG0717183 COG0717, Dcd, Deoxycytidine deaminase [Nucleotide trans 2e-24
cd0755792 cd07557, trimeric_dUTPase, Trimeric dUTP diphosphatases 1e-06
>gnl|CDD|181028 PRK07559, PRK07559, 2'-deoxycytidine 5'-triphosphate deaminase; Provisional Back     alignment and domain information
>gnl|CDD|148267 pfam06559, DCD, 2'-deoxycytidine 5'-triphosphate deaminase (DCD) Back     alignment and domain information
>gnl|CDD|162793 TIGR02274, dCTP_deam, deoxycytidine triphosphate deaminase Back     alignment and domain information
>gnl|CDD|31061 COG0717, Dcd, Deoxycytidine deaminase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|179014 PRK00416, dcd, deoxycytidine triphosphate deaminase; Reviewed Back     alignment and domain information
>gnl|CDD|143638 cd07557, trimeric_dUTPase, Trimeric dUTP diphosphatases Back     alignment and domain information
>gnl|CDD|179014 PRK00416, dcd, deoxycytidine triphosphate deaminase; Reviewed Back     alignment and domain information
>gnl|CDD|162793 TIGR02274, dCTP_deam, deoxycytidine triphosphate deaminase Back     alignment and domain information
>gnl|CDD|31061 COG0717, Dcd, Deoxycytidine deaminase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|143638 cd07557, trimeric_dUTPase, Trimeric dUTP diphosphatases Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 367 2'-deoxycytidine 5'-triphosphate deaminase [Candidatus
pfam06559366 DCD 2'-deoxycytidine 5'-triphosphate deaminase (DCD). T 100.0
PRK07559366 2'-deoxycytidine 5'-triphosphate deaminase; Provisional 100.0
TIGR02274198 dCTP_deam deoxycytidine triphosphate deaminase; InterPr 100.0
PHA01707158 dut 2'-deoxyuridine 5'-triphosphatase 100.0
PRK00416174 dcd deoxycytidine triphosphate deaminase; Reviewed 100.0
COG0717183 Dcd Deoxycytidine deaminase [Nucleotide transport and m 100.0
PRK02253159 deoxyuridine 5'-triphosphate nucleotidohydrolase; Provi 99.98
pfam06559366 DCD 2'-deoxycytidine 5'-triphosphate deaminase (DCD). T 98.45
PRK07559366 2'-deoxycytidine 5'-triphosphate deaminase; Provisional 98.33
TIGR02274198 dCTP_deam deoxycytidine triphosphate deaminase; InterPr 100.0
COG0717183 Dcd Deoxycytidine deaminase [Nucleotide transport and m 100.0
PHA01707158 dut 2'-deoxyuridine 5'-triphosphatase 99.96
PRK00416174 dcd deoxycytidine triphosphate deaminase; Reviewed 99.95
PRK02253159 deoxyuridine 5'-triphosphate nucleotidohydrolase; Provi 99.93
cd0755792 trimeric_dUTPase Trimeric dUTP diphosphatases. Trimeric 99.78
pfam00692129 dUTPase dUTPase. dUTPase hydrolyses dUTP to dUMP and py 99.4
PRK00601149 dut deoxyuridine 5'-triphosphate nucleotidohydrolase; P 99.22
PRK13956147 dut deoxyuridine 5'-triphosphate nucleotidohydrolase; P 98.89
TIGR00576151 dut dUTP diphosphatase; InterPro: IPR008181 Synonym(s): 98.88
PTZ00143155 deoxyuridine 5'-triphosphate nucleotidohydrolase; Provi 98.78
COG0756148 Dut dUTPase [Nucleotide transport and metabolism] 98.77
KOG3370140 consensus 94.43
cd0755792 trimeric_dUTPase Trimeric dUTP diphosphatases. Trimeric 99.35
pfam00692129 dUTPase dUTPase. dUTPase hydrolyses dUTP to dUMP and py 98.86
PRK00601149 dut deoxyuridine 5'-triphosphate nucleotidohydrolase; P 98.65
TIGR00576151 dut dUTP diphosphatase; InterPro: IPR008181 Synonym(s): 98.59
COG0756148 Dut dUTPase [Nucleotide transport and metabolism] 98.4
PRK13956147 dut deoxyuridine 5'-triphosphate nucleotidohydrolase; P 98.37
KOG3370140 consensus 93.64
PTZ00143155 deoxyuridine 5'-triphosphate nucleotidohydrolase; Provi 97.47
>pfam06559 DCD 2'-deoxycytidine 5'-triphosphate deaminase (DCD) Back     alignment and domain information
>PRK07559 2'-deoxycytidine 5'-triphosphate deaminase; Provisional Back     alignment and domain information
>TIGR02274 dCTP_deam deoxycytidine triphosphate deaminase; InterPro: IPR011962 Members of this family include the Escherichia coli monofunctional deoxycytidine triphosphate deaminase (dCTP deaminase) and a Methanocaldococcus jannaschii bifunctional dCTP deaminase (3 Back     alignment and domain information
>PHA01707 dut 2'-deoxyuridine 5'-triphosphatase Back     alignment and domain information
>PRK00416 dcd deoxycytidine triphosphate deaminase; Reviewed Back     alignment and domain information
>COG0717 Dcd Deoxycytidine deaminase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK02253 deoxyuridine 5'-triphosphate nucleotidohydrolase; Provisional Back     alignment and domain information
>pfam06559 DCD 2'-deoxycytidine 5'-triphosphate deaminase (DCD) Back     alignment and domain information
>PRK07559 2'-deoxycytidine 5'-triphosphate deaminase; Provisional Back     alignment and domain information
>TIGR02274 dCTP_deam deoxycytidine triphosphate deaminase; InterPro: IPR011962 Members of this family include the Escherichia coli monofunctional deoxycytidine triphosphate deaminase (dCTP deaminase) and a Methanocaldococcus jannaschii bifunctional dCTP deaminase (3 Back     alignment and domain information
>COG0717 Dcd Deoxycytidine deaminase [Nucleotide transport and metabolism] Back     alignment and domain information
>PHA01707 dut 2'-deoxyuridine 5'-triphosphatase Back     alignment and domain information
>PRK00416 dcd deoxycytidine triphosphate deaminase; Reviewed Back     alignment and domain information
>PRK02253 deoxyuridine 5'-triphosphate nucleotidohydrolase; Provisional Back     alignment and domain information
>cd07557 trimeric_dUTPase Trimeric dUTP diphosphatases Back     alignment and domain information
>pfam00692 dUTPase dUTPase Back     alignment and domain information
>PRK00601 dut deoxyuridine 5'-triphosphate nucleotidohydrolase; Provisional Back     alignment and domain information
>PRK13956 dut deoxyuridine 5'-triphosphate nucleotidohydrolase; Provisional Back     alignment and domain information
>TIGR00576 dut dUTP diphosphatase; InterPro: IPR008181 Synonym(s): dUTP diphosphatase, Deoxyuridine-triphosphatase Back     alignment and domain information
>PTZ00143 deoxyuridine 5'-triphosphate nucleotidohydrolase; Provisional Back     alignment and domain information
>COG0756 Dut dUTPase [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG3370 consensus Back     alignment and domain information
>cd07557 trimeric_dUTPase Trimeric dUTP diphosphatases Back     alignment and domain information
>pfam00692 dUTPase dUTPase Back     alignment and domain information
>PRK00601 dut deoxyuridine 5'-triphosphate nucleotidohydrolase; Provisional Back     alignment and domain information
>TIGR00576 dut dUTP diphosphatase; InterPro: IPR008181 Synonym(s): dUTP diphosphatase, Deoxyuridine-triphosphatase Back     alignment and domain information
>COG0756 Dut dUTPase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK13956 dut deoxyuridine 5'-triphosphate nucleotidohydrolase; Provisional Back     alignment and domain information
>KOG3370 consensus Back     alignment and domain information
>PTZ00143 deoxyuridine 5'-triphosphate nucleotidohydrolase; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target367 2'-deoxycytidine 5'-triphosphate deaminase [Candidatus
2r9q_A370 Crystal Structure Of 2'-Deoxycytidine 5'-Triphospha 1e-131
2qxx_A190 Bifunctional Dctp Deaminase: Dutpase From Mycobacte 2e-35
2qlp_A161 Bifunctional Dctp Deaminase:dutpase From Mycobacter 2e-35
1xs1_A193 Dctp Deaminase From Escherichia Coli In Complex Wit 2e-32
2v9x_A193 E138d Variant Of Escherichia Coli Dctp Deaminase In 9e-32
2j4h_A193 Crystal Structure Of A H121a Escherichia Coli Dctp 1e-31
1xs6_A193 Dctp Deaminase From Escherichia Coli. E138a Mutant 1e-31
1xs4_A193 Dctp Deaminase From Escherichia Coli- E138a Mutant 3e-30
1ogh_A204 Structure Of The Bifunctional Dctp Deaminase-Dutpas 3e-25
3gf0_A204 Bifunctional Dctp Deaminase-Dutpase Mutant Enzyme V 1e-24
2hxd_A204 Bifunctional Dctp Deaminase-Dutpase Mutant Enzyme V 1e-24
3km3_A206 Crystal Structure Of Eoxycytidine Triphosphate Deam 2e-14
2zdc_A169 Crystal Structure Of Dutpase From Sulfolobus Tokoda 2e-12
2yzj_A169 Crystal Structure Of Dctp Deaminase From Sulfolobus 7e-11
2qxx_A190 Bifunctional Dctp Deaminase: Dutpase From Mycobacte 1e-30
2qlp_A161 Bifunctional Dctp Deaminase:dutpase From Mycobacter 9e-23
1xs1_A193 Dctp Deaminase From Escherichia Coli In Complex Wit 6e-23
2v9x_A193 E138d Variant Of Escherichia Coli Dctp Deaminase In 1e-22
2j4h_A193 Crystal Structure Of A H121a Escherichia Coli Dctp 2e-22
1xs6_A193 Dctp Deaminase From Escherichia Coli. E138a Mutant 1e-22
1xs4_A193 Dctp Deaminase From Escherichia Coli- E138a Mutant 5e-21
1ogh_A204 Structure Of The Bifunctional Dctp Deaminase-Dutpas 2e-14
3gf0_A204 Bifunctional Dctp Deaminase-Dutpase Mutant Enzyme V 3e-14
2hxd_A204 Bifunctional Dctp Deaminase-Dutpase Mutant Enzyme V 4e-14
3km3_A206 Crystal Structure Of Eoxycytidine Triphosphate Deam 3e-14
2zdc_A169 Crystal Structure Of Dutpase From Sulfolobus Tokoda 4e-06
2yzj_A169 Crystal Structure Of Dctp Deaminase From Sulfolobus 1e-04
gi|158430716|pdb|2R9Q|A Chain A, Crystal Structure Of 2'-Deoxycytidine 5'-Triphosphate Deaminase From Agrobacterium Tumefaciens Length = 370 Back     alignment and structure
 Score =  472 bits (1216), Expect = e-131,   Method: Composition-based stats.
 Identities = 207/361 (57%), Positives = 250/361 (69%), Gaps = 5/361 (1%)

Query: 5   VLPDKAIATLAERGDIVSEHPLEKNQIQPASIDLRLSSKAYRVRASFLPNIDGLVSDKIK 64
           +L D AI  L     + SE  L+ +Q+QPAS+DLRL SKAYRVRASF+P     V DK+ 
Sbjct: 12  ILADGAIRALFAGDKLKSEADLDVDQVQPASLDLRLGSKAYRVRASFMPGPGTRVIDKLN 71

Query: 65  HFKLREIDLSGGTVLDANCVYIVPLMESLNLKNGISAYANPKSSIGRIDVFARVIGDRSQ 124
            F L E+DLS G VL+  CVYIVPLMESL L   +SA ANPKSS GR+D+F RV+ D +Q
Sbjct: 72  RFSLHEVDLSQGAVLETGCVYIVPLMESLALPADMSASANPKSSTGRLDIFTRVMTDNAQ 131

Query: 125 EFDSISPNYSGPLYLEILPRTFPIVVRVGSRLSQIRFVKERKFCSQEELSALHELSPLVQ 184
           EFD I   Y+GPLYLEI PRTFPIVVR GSRLSQIRF       ++ E+  LHE   LV 
Sbjct: 132 EFDKIPAGYTGPLYLEISPRTFPIVVRRGSRLSQIRFRIGHALLNESEVLKLHETETLVA 191

Query: 185 DGLRDFSGKGVALSVDLKGNEIGKKSIIGYRAKRHTAAIDVDSENKYDESDFWDPLFSWD 244
               + +G G+ALS+DLKG   G+  +IGYR K HTA +DVD + ++D  DFW+PLF+  
Sbjct: 192 SENPNVTGGGIALSIDLKG--FGENGLIGYRGKHHTAVVDVDKKAQHDVLDFWEPLFARG 249

Query: 245 APEGQFILDPNEFYIFASREFIQIPPSLVAEMIPYDHSIGEFRVHYAGFFDPGFGCVLPQ 304
             E   ILDP+EFYI  SRE + +PP   AEM P+D  +GEFRVHYAGFFDPGFG     
Sbjct: 250 RAE--LILDPDEFYILVSREAVHVPPLYAAEMTPFDPLVGEFRVHYAGFFDPGFGHAQAG 307

Query: 305 EVGAKAVLEVRS-SVPFVLEHGQIIGRLKYESMDGEPERLYGEARGSHYQSQALKLSKHF 363
             G++AVLEVRS  VPF+LEHGQI+GRL YE M  +PE LYG   GS+YQ+Q LKLSKHF
Sbjct: 308 GTGSRAVLEVRSHEVPFILEHGQIVGRLVYEHMLEKPEGLYGTGLGSNYQAQGLKLSKHF 367

Query: 364 H 364
            
Sbjct: 368 R 368


gi|168177103|pdb|2QXX|A Chain A, Bifunctional Dctp Deaminase: Dutpase From Mycobacterium Tuberculosis In Complex With Dttp Length = 190 Back     alignment and structure
>gi|168177097|pdb|2QLP|A Chain A, Bifunctional Dctp Deaminase:dutpase From Mycobacterium Tuberculosis, Apo Form Length = 161 Back     alignment and structure
gi|58177563|pdb|1XS1|A Chain A, Dctp Deaminase From Escherichia Coli In Complex With Dutp Length = 193 Back     alignment and structure
>gi|160877833|pdb|2V9X|A Chain A, E138d Variant Of Escherichia Coli Dctp Deaminase In Complex With Dutp Length = 193 Back     alignment and structure
>gi|157835238|pdb|2J4H|A Chain A, Crystal Structure Of A H121a Escherichia Coli Dctp Deaminase Mutant Enzyme Length = 193 Back     alignment and structure
>gi|58177575|pdb|1XS6|A Chain A, Dctp Deaminase From Escherichia Coli. E138a Mutant Enzyme In Complex With Dutp Length = 193 Back     alignment and structure
>gi|58177569|pdb|1XS4|A Chain A, Dctp Deaminase From Escherichia Coli- E138a Mutant Enzyme In Complex With Dctp Length = 193 Back     alignment and structure
gi|33357733|pdb|1OGH|A Chain A, Structure Of The Bifunctional Dctp Deaminase-Dutpase From Methanocaldococcus Jannaschii Length = 204 Back     alignment and structure
>gi|224983714|pdb|3GF0|A Chain A, Bifunctional Dctp Deaminase-Dutpase Mutant Enzyme Variant E145q From Methanocaldococcus Jannaschii In Complex With Pyrophosphate And Magnesium Length = 204 Back     alignment and structure
>gi|157835117|pdb|2HXD|A Chain A, Bifunctional Dctp Deaminase-Dutpase Mutant Enzyme Variant E145a From Methanocaldococcus Jannaschii In Complex With Alpha,Beta-Imido Dutp And Magnesium Length = 204 Back     alignment and structure
>gi|269914654|pdb|3KM3|A Chain A, Crystal Structure Of Eoxycytidine Triphosphate Deaminase From Anaplasma Phagocytophilum At 2.1a Resolution Length = 206 Back     alignment and structure
>gi|189096106|pdb|2ZDC|A Chain A, Crystal Structure Of Dutpase From Sulfolobus Tokodaii Length = 169 Back     alignment and structure
>gi|160286246|pdb|2YZJ|A Chain A, Crystal Structure Of Dctp Deaminase From Sulfolobus Tokodaii Length = 169 Back     alignment and structure
gi|168177103|pdb|2QXX|A Chain A, Bifunctional Dctp Deaminase: Dutpase From Mycobacterium Tuberculosis In Complex With Dttp Length = 190 Back     alignment and structure
>gi|168177097|pdb|2QLP|A Chain A, Bifunctional Dctp Deaminase:dutpase From Mycobacterium Tuberculosis, Apo Form Length = 161 Back     alignment and structure
gi|58177563|pdb|1XS1|A Chain A, Dctp Deaminase From Escherichia Coli In Complex With Dutp Length = 193 Back     alignment and structure
>gi|160877833|pdb|2V9X|A Chain A, E138d Variant Of Escherichia Coli Dctp Deaminase In Complex With Dutp Length = 193 Back     alignment and structure
>gi|157835238|pdb|2J4H|A Chain A, Crystal Structure Of A H121a Escherichia Coli Dctp Deaminase Mutant Enzyme Length = 193 Back     alignment and structure
>gi|58177575|pdb|1XS6|A Chain A, Dctp Deaminase From Escherichia Coli. E138a Mutant Enzyme In Complex With Dutp Length = 193 Back     alignment and structure
>gi|58177569|pdb|1XS4|A Chain A, Dctp Deaminase From Escherichia Coli- E138a Mutant Enzyme In Complex With Dctp Length = 193 Back     alignment and structure
gi|33357733|pdb|1OGH|A Chain A, Structure Of The Bifunctional Dctp Deaminase-Dutpase From Methanocaldococcus Jannaschii Length = 204 Back     alignment and structure
>gi|224983714|pdb|3GF0|A Chain A, Bifunctional Dctp Deaminase-Dutpase Mutant Enzyme Variant E145q From Methanocaldococcus Jannaschii In Complex With Pyrophosphate And Magnesium Length = 204 Back     alignment and structure
>gi|157835117|pdb|2HXD|A Chain A, Bifunctional Dctp Deaminase-Dutpase Mutant Enzyme Variant E145a From Methanocaldococcus Jannaschii In Complex With Alpha,Beta-Imido Dutp And Magnesium Length = 204 Back     alignment and structure
>gi|269914654|pdb|3KM3|A Chain A, Crystal Structure Of Eoxycytidine Triphosphate Deaminase From Anaplasma Phagocytophilum At 2.1a Resolution Length = 206 Back     alignment and structure
>gi|189096106|pdb|2ZDC|A Chain A, Crystal Structure Of Dutpase From Sulfolobus Tokodaii Length = 169 Back     alignment and structure
>gi|160286246|pdb|2YZJ|A Chain A, Crystal Structure Of Dctp Deaminase From Sulfolobus Tokodaii Length = 169 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target367 2'-deoxycytidine 5'-triphosphate deaminase [Candidatus
2r9q_A370 AGR_C_764P, 2'-deoxycytidine 5'-triphosphate deaminase; 1e-109
1pkh_A204 Bifunctional deaminase/diphosphatase; DCTP deaminase, d 3e-24
2qxx_A190 DCTP deaminase, deoxycytidine triphosphate deaminase; d 1e-19
1xs1_A193 DCTP deaminase, deoxycytidine triphosphate deaminase; n 3e-19
2yzj_A169 167AA long hypothetical dutpase; all beta proteins, hyp 9e-18
3km3_A206 DCTP deaminase, deoxycytidine triphosphate deaminase; s 3e-08
1pkh_A204 Bifunctional deaminase/diphosphatase; DCTP deaminase, d 3e-14
2qxx_A190 DCTP deaminase, deoxycytidine triphosphate deaminase; d 3e-12
1xs1_A193 DCTP deaminase, deoxycytidine triphosphate deaminase; n 3e-15
3km3_A206 DCTP deaminase, deoxycytidine triphosphate deaminase; s 1e-15
>2r9q_A AGR_C_764P, 2'-deoxycytidine 5'-triphosphate deaminase; structural genomics, MCSG, PSI-2, protein structure initiative; 2.20A {Agrobacterium tumefaciens str} Length = 370 Back     alignment and structure
 Score =  391 bits (1006), Expect = e-109
 Identities = 207/363 (57%), Positives = 251/363 (69%), Gaps = 5/363 (1%)

Query: 2   NKGVLPDKAIATLAERGDIVSEHPLEKNQIQPASIDLRLSSKAYRVRASFLPNIDGLVSD 61
             G+L D AI  L     + SE  L+ +Q+QPAS+DLRL SKAYRVRASF+P     V D
Sbjct: 9   TTGILADGAIRALFAGDKLKSEADLDVDQVQPASLDLRLGSKAYRVRASFMPGPGTRVID 68

Query: 62  KIKHFKLREIDLSGGTVLDANCVYIVPLMESLNLKNGISAYANPKSSIGRIDVFARVIGD 121
           K+  F L E+DLS G VL+  CVYIVPLMESL L   +SA ANPKSS GR+D+F RV+ D
Sbjct: 69  KLNRFSLHEVDLSQGAVLETGCVYIVPLMESLALPADMSASANPKSSTGRLDIFTRVMTD 128

Query: 122 RSQEFDSISPNYSGPLYLEILPRTFPIVVRVGSRLSQIRFVKERKFCSQEELSALHELSP 181
            +QEFD I   Y+GPLYLEI PRTFPIVVR GSRLSQIRF       ++ E+  LHE   
Sbjct: 129 NAQEFDKIPAGYTGPLYLEISPRTFPIVVRRGSRLSQIRFRIGHALLNESEVLKLHETET 188

Query: 182 LVQDGLRDFSGKGVALSVDLKGNEIGKKSIIGYRAKRHTAAIDVDSENKYDESDFWDPLF 241
           LV     + +G G+ALS+DLKG   G+  +IGYR K HTA +DVD + ++D  DFW+PLF
Sbjct: 189 LVASENPNVTGGGIALSIDLKG--FGENGLIGYRGKHHTAVVDVDKKAQHDVLDFWEPLF 246

Query: 242 SWDAPEGQFILDPNEFYIFASREFIQIPPSLVAEMIPYDHSIGEFRVHYAGFFDPGFGCV 301
           +      + ILDP+EFYI  SRE + +PP   AEM P+D  +GEFRVHYAGFFDPGFG  
Sbjct: 247 AR--GRAELILDPDEFYILVSREAVHVPPLYAAEMTPFDPLVGEFRVHYAGFFDPGFGHA 304

Query: 302 LPQEVGAKAVLEVRSS-VPFVLEHGQIIGRLKYESMDGEPERLYGEARGSHYQSQALKLS 360
                G++AVLEVRS  VPF+LEHGQI+GRL YE M  +PE LYG   GS+YQ+Q LKLS
Sbjct: 305 QAGGTGSRAVLEVRSHEVPFILEHGQIVGRLVYEHMLEKPEGLYGTGLGSNYQAQGLKLS 364

Query: 361 KHF 363
           KHF
Sbjct: 365 KHF 367


>1pkh_A Bifunctional deaminase/diphosphatase; DCTP deaminase, dutpase, DCD-DUT, MJ0430, DCTP, DUTP, hydrolase; 1.42A {Methanocaldococcus jannaschii} SCOP: b.85.4.1 PDB: 1ogh_A 1pkj_A* 1pkk_A* 2hxb_A 2hxe_A 3gf0_A 2hxd_A* Length = 204 Back     alignment and structure
>2qxx_A DCTP deaminase, deoxycytidine triphosphate deaminase; distorted beta barrel, hydrolase, nucleotide metabolism; HET: TTP 1PE; 2.00A {Mycobacterium tuberculosis H37RV} PDB: 2qlp_A* Length = 190 Back     alignment and structure
>1xs1_A DCTP deaminase, deoxycytidine triphosphate deaminase; nucleotide metabolism, trimer, hydrolase; HET: DUT; 1.80A {Escherichia coli} SCOP: b.85.4.1 PDB: 2v9x_A* 1xs6_A* 1xs4_A* 2j4q_A* 2j4h_A* Length = 193 Back     alignment and structure
>2yzj_A 167AA long hypothetical dutpase; all beta proteins, hypothetical protein, NPPSFA; HET: DUD; 1.66A {Sulfolobus tokodaii} PDB: 2zdc_A Length = 169 Back     alignment and structure
>3km3_A DCTP deaminase, deoxycytidine triphosphate deaminase; ssgcid, NIH, niaid, SBRI, UW, decode, iodide phasing, hydrolase; 2.10A {Anaplasma phagocytophilum HZ} Length = 206 Back     alignment and structure
>1pkh_A Bifunctional deaminase/diphosphatase; DCTP deaminase, dutpase, DCD-DUT, MJ0430, DCTP, DUTP, hydrolase; 1.42A {Methanocaldococcus jannaschii} SCOP: b.85.4.1 PDB: 1ogh_A 1pkj_A* 1pkk_A* 2hxb_A 2hxe_A 3gf0_A 2hxd_A* Length = 204 Back     alignment and structure
>2qxx_A DCTP deaminase, deoxycytidine triphosphate deaminase; distorted beta barrel, hydrolase, nucleotide metabolism; HET: TTP 1PE; 2.00A {Mycobacterium tuberculosis H37RV} PDB: 2qlp_A* Length = 190 Back     alignment and structure
>1xs1_A DCTP deaminase, deoxycytidine triphosphate deaminase; nucleotide metabolism, trimer, hydrolase; HET: DUT; 1.80A {Escherichia coli} SCOP: b.85.4.1 PDB: 2v9x_A* 1xs6_A* 1xs4_A* 2j4q_A* 2j4h_A* Length = 193 Back     alignment and structure
>3km3_A DCTP deaminase, deoxycytidine triphosphate deaminase; ssgcid, NIH, niaid, SBRI, UW, decode, iodide phasing, hydrolase; 2.10A {Anaplasma phagocytophilum HZ} Length = 206 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target367 2'-deoxycytidine 5'-triphosphate deaminase [Candidatus
2r9q_A370 AGR_C_764P, 2'-deoxycytidine 5'-triphosphate deaminase; 100.0
1pkh_A204 Bifunctional deaminase/diphosphatase; DCTP deaminase, d 100.0
2qxx_A190 DCTP deaminase, deoxycytidine triphosphate deaminase; d 100.0
1xs1_A193 DCTP deaminase, deoxycytidine triphosphate deaminase; n 100.0
3km3_A206 DCTP deaminase, deoxycytidine triphosphate deaminase; s 100.0
2yzj_A169 167AA long hypothetical dutpase; all beta proteins, hyp 100.0
2r9q_A370 AGR_C_764P, 2'-deoxycytidine 5'-triphosphate deaminase; 99.85
2bsy_A278 Deoxyuridine 5'-triphosphate nucleotidohydrolase; dutpa 98.94
1xs1_A193 DCTP deaminase, deoxycytidine triphosphate deaminase; n 100.0
2qxx_A190 DCTP deaminase, deoxycytidine triphosphate deaminase; d 99.98
3km3_A206 DCTP deaminase, deoxycytidine triphosphate deaminase; s 99.97
1pkh_A204 Bifunctional deaminase/diphosphatase; DCTP deaminase, d 99.96
2yzj_A169 167AA long hypothetical dutpase; all beta proteins, hyp 99.91
1dun_A134 Deoxyuridine 5'-triphosphate nucleoditohydrolase; dutpa 99.61
1f7d_A136 POL polyprotein; eight stranded beta-barrel, viral prot 99.49
2ol1_A147 Deoxyuridine 5'-triphosphate nucleotidohydrolase; fold, 99.44
3lqw_A163 Deoxyuridine 5'-triphosphate nucleotidohydrolase; emera 99.4
3c2t_A141 Deoxyuridine triphosphatase; dutpase chlorella virus, h 99.35
3ecy_A160 CG4584-PA, isoform A (bcDNA.LD08534); jelly-roll, dimer 99.3
3ca9_A165 Deoxyuridine triphosphatase; dutpase chlorella virus, h 99.29
3p48_A147 Deoxyuridine 5'-triphosphate nucleotidohydrolase; trime 99.29
3f4f_A167 Deoxyuridine 5'-triphosphate nucleotidohydrolase; trime 99.28
3hza_A174 Deoxyuridine 5'-triphosphate nucleotidohydrolase; jelly 99.26
2d4n_A152 DU; jelly roll, hydrolase; HET: UPR; 1.53A {Mason-pfize 99.26
3mdx_A178 Deoxyuridine 5'-triphosphate nucleotidohydrolase; metal 99.25
3ehw_A164 DUTP pyrophosphatase; jelly-roll, FULL-length C-termina 99.22
2p9o_A169 DUTP pyrophosphatase-like protein; dutpase, magnesium b 99.2
2xcd_A144 Probable deoxyuridine 5'-triphosphate nucleotidoh YNCF; 99.19
3h6x_A148 Dutpase; jelly-roll beta-barrel, hydrolase; 1.70A {Stre 99.18
1euw_A152 Dutpase, deoxyuridine 5'-triphosphate nucleotidohydrola 98.86
2bsy_A278 Deoxyuridine 5'-triphosphate nucleotidohydrolase; dutpa 99.57
1vyq_A173 Deoxyuridine 5'-triphosphate nucleotidohydrolase; drug 99.15
1dun_A134 Deoxyuridine 5'-triphosphate nucleoditohydrolase; dutpa 99.15
1f7d_A136 POL polyprotein; eight stranded beta-barrel, viral prot 98.94
3p48_A147 Deoxyuridine 5'-triphosphate nucleotidohydrolase; trime 98.87
3lqw_A163 Deoxyuridine 5'-triphosphate nucleotidohydrolase; emera 98.84
2ol1_A147 Deoxyuridine 5'-triphosphate nucleotidohydrolase; fold, 98.82
3ecy_A160 CG4584-PA, isoform A (bcDNA.LD08534); jelly-roll, dimer 98.8
3c2t_A141 Deoxyuridine triphosphatase; dutpase chlorella virus, h 98.75
2xcd_A144 Probable deoxyuridine 5'-triphosphate nucleotidoh YNCF; 98.75
3ca9_A165 Deoxyuridine triphosphatase; dutpase chlorella virus, h 98.73
3h6x_A148 Dutpase; jelly-roll beta-barrel, hydrolase; 1.70A {Stre 98.72
3hza_A174 Deoxyuridine 5'-triphosphate nucleotidohydrolase; jelly 98.71
3mdx_A178 Deoxyuridine 5'-triphosphate nucleotidohydrolase; metal 98.67
3ehw_A164 DUTP pyrophosphatase; jelly-roll, FULL-length C-termina 98.66
2d4n_A152 DU; jelly roll, hydrolase; HET: UPR; 1.53A {Mason-pfize 98.46
2p9o_A169 DUTP pyrophosphatase-like protein; dutpase, magnesium b 98.45
1euw_A152 Dutpase, deoxyuridine 5'-triphosphate nucleotidohydrola 98.24
1vyq_A173 Deoxyuridine 5'-triphosphate nucleotidohydrolase; drug 97.87
3f4f_A167 Deoxyuridine 5'-triphosphate nucleotidohydrolase; trime 98.89
>2r9q_A AGR_C_764P, 2'-deoxycytidine 5'-triphosphate deaminase; structural genomics, MCSG, PSI-2, protein structure initiative; 2.20A {Agrobacterium tumefaciens str} Back     alignment and structure
Probab=100.00  E-value=0  Score=911.75  Aligned_cols=360  Identities=58%  Similarity=0.953  Sum_probs=351.8

Q ss_pred             CCCCCCHHHHHHHHHCCCEEECCCCCHHHCCCCEEEEEECCEEEEEECCCCCCCCCCHHHHCCCCEEEEEECCCCEEECC
Q ss_conf             87615868999999879849817898656571225887589899981231578886211000240478873688648668
Q gi|254780480|r    2 NKGVLPDKAIATLAERGDIVSEHPLEKNQIQPASIDLRLSSKAYRVRASFLPNIDGLVSDKIKHFKLREIDLSGGTVLDA   81 (367)
Q Consensus         2 ~~GILsd~~I~~li~~g~I~i~~p~~~~QIQPaSiDLRLG~~~~rv~asflp~~~~~v~~~l~~~~~~eidl~~g~vLep   81 (367)
                      ++|||||++|++++++|.|.+++|++++||||||+|||||++|||+++||+|+.+.+|.++++++.+++++++++|+|+|
T Consensus         9 ~~GILsd~~I~~li~~g~I~i~p~~~~~QIqPaSvDLrLG~~~~~~~~s~lp~~~~~v~d~~~~~~~~~i~~~~~~vL~P   88 (370)
T 2r9q_A            9 TTGILADGAIRALFAGDKLKSEADLDVDQVQPASLDLRLGSKAYRVRASFMPGPGTRVIDKLNRFSLHEVDLSQGAVLET   88 (370)
T ss_dssp             CSEECCHHHHHHHHHHTSEEESSCCCTTCBCSSCEEEEBCSEEEEESSBCCCCTTCCHHHHHHHC-CEEEECSSCEEECT
T ss_pred             CCEECCHHHHHHHHHCCCCCCCCCCCHHHCCCCEEEEECCCEEEEEECCCCCCCCCCCCCCCCCCEEEEEECCCCCEECC
T ss_conf             68878699999998779917079999777788569832387899996544778997401112254159995799809758


Q ss_pred             CCEEEEEEEEEEECCCCCEEEEECCCCCCCCCCEEEEEECCCCCCCCCCCCCCEEEEEEECCCCCCEEEECCCEEEEEEE
Q ss_conf             73299998889984998279986013431125034232078775542366744389999516865279833980356898
Q gi|254780480|r   82 NCVYIVPLMESLNLKNGISAYANPKSSIGRIDVFARVIGDRSQEFDSISPNYSGPLYLEILPRTFPIVVRVGSRLSQIRF  161 (367)
Q Consensus        82 g~~yLv~t~E~i~LP~di~a~~~pKSS~GRLgif~r~i~~~~~~f~~id~Gy~G~l~lEI~~~sfpI~v~~G~rl~Qi~f  161 (367)
                      ||+||++|+|+|+||+|++|+++||||+||||||||+++|++.+|++|||||+|+|||||+|+||||+||||||||||||
T Consensus        89 g~~yL~~t~E~i~LP~di~a~~~~KSS~gRlgl~~~~~~~~~~~~~~i~~Gy~G~ltLEI~n~s~pI~l~~G~ri~Ql~F  168 (370)
T 2r9q_A           89 GCVYIVPLMESLALPADMSASANPKSSTGRLDIFTRVMTDNAQEFDKIPAGYTGPLYLEISPRTFPIVVRRGSRLSQIRF  168 (370)
T ss_dssp             TCEEEEEEEEEEECCTTEEEEEEECHHHHTTTEEEEEEETTCSSTTEECTTCEEEEEEEEEESSSCEEECTTCEEEEEEE
T ss_pred             CCEEEEEEEEEEECCCCCEEEEECCCHHHHCCEEEEEECCCCCCCCCCCCCEEEEEEEEEECCCCCEEEECCCEEEEEEE
T ss_conf             97899998779966998589998213132153787430357755664576421149999945875779968975788997


Q ss_pred             EECCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEEECCCCCCCCCCEEEEECCCCCEEECCCCCCCCHHHHHHHHC
Q ss_conf             50887689999999875278603665544337316788814554566663045512677513015655558778664311
Q gi|254780480|r  162 VKERKFCSQEELSALHELSPLVQDGLRDFSGKGVALSVDLKGNEIGKKSIIGYRAKRHTAAIDVDSENKYDESDFWDPLF  241 (367)
Q Consensus       162 ~~g~~~LsD~eL~~lh~~~~LV~~~~~~~~~~Gl~~sVdL~~~~~~~~~iiGyrAkkht~~IDl~k~~~y~~~dfwe~i~  241 (367)
                      ++|++++||++|+++|++++||+++.+..+++|+++||||+++  ..+++|||||||||++||++|+++|++++|||||+
T Consensus       169 ~~g~~~lsd~~l~~lh~~~~lv~~~~~~~~~~gl~lsVdL~~~--~~~~iigyrAk~h~~~Id~~k~~~y~~~~fwe~i~  246 (370)
T 2r9q_A          169 RIGHALLNESEVLKLHETETLVASENPNVTGGGIALSIDLKGF--GENGLIGYRGKHHTAVVDVDKKAQHDVLDFWEPLF  246 (370)
T ss_dssp             EESCCBCCHHHHHHHHHHSCSBC---CCCCC--EEEEBCCSCC--TTTTEEEEEECSSCCCEETTCGGGSCGGGTEEEEE
T ss_pred             ECCCCCCCHHHHHHHHHCCCCCCCCCCCCCCCCCEEEEEECCC--CCCCCEEEECCCCCCCEEECCCCCCCHHHHHHEEE
T ss_conf             3377666889999877408732477544147882589983356--77871799614678836605655246878431021


Q ss_pred             CCCCCCCEEEECCCCEEEEEEEEEEECCCCCEEEEEEECCCCCCEEEECCEEECCCCCCCCCCCCCCEEEEEECC-CCCE
Q ss_conf             355777539988997899986334442834016445304333421342160456886654345667504788617-8888
Q gi|254780480|r  242 SWDAPEGQFILDPNEFYIFASREFIQIPPSLVAEMIPYDHSIGEFRVHYAGFFDPGFGCVLPQEVGAKAVLEVRS-SVPF  320 (367)
Q Consensus       242 ~~~~~~~~~~l~p~~F~l~~s~E~v~iP~~~aae~~~~~~~~g~~r~h~AGf~DpGf~~~~~~~~~~~~vLevr~-~~p~  320 (367)
                      ..  +++.|+|+||||||++|+|+|+||+|+||||+++++.+|+||+||||||||||+|+.+++.|+++|||||+ ++||
T Consensus       247 ~~--~~~~~iL~P~ef~l~~T~E~v~iP~~~aa~~~~rs~~~r~g~~~~agf~DpGf~g~~~~~~g~~~vLev~~~~~p~  324 (370)
T 2r9q_A          247 AR--GRAELILDPDEFYILVSREAVHVPPLYAAEMTPFDPLVGEFRVHYAGFFDPGFGHAQAGGTGSRAVLEVRSHEVPF  324 (370)
T ss_dssp             CC--SSSEEEECTTCCEEEEEEEEECCCTTEEEEEEECGGGTTTEEEESCCEECTTTTC-----CCEEEEEEEEECSSCE
T ss_pred             CC--CCCEEEEECCCEEEEEEEEEEEECCCEEEEEEEECHHHCCCEEECCCCCCCCCCCCCCCCCCCEEEEEEECCCCCE
T ss_conf             27--8977999679799999999999789739999704343258267647517699876445566855999992698886


Q ss_pred             EEECCCEEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCHHHHHHH
Q ss_conf             994798889999976376642223754347232666773443430
Q gi|254780480|r  321 VLEHGQIIGRLKYESMDGEPERLYGEARGSHYQSQALKLSKHFHQ  365 (367)
Q Consensus       321 ~l~~g~~i~~l~~~~~~~~p~~~Yg~~~~s~Yq~Qgl~lsk~f~~  365 (367)
                      +|++||+||||+||+|+++|+++||++++||||+||||||||||+
T Consensus       325 ~l~~G~~I~qlvfe~l~~~p~~~Yg~~~~s~Yq~Qg~~lsK~fk~  369 (370)
T 2r9q_A          325 ILEHGQIVGRLVYEHMLEKPEGLYGTGLGSNYQAQGLKLSKHFRA  369 (370)
T ss_dssp             EEETTCEEEEEEEEEBSSCCC------------------------
T ss_pred             EEECCCEEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCHHCCC
T ss_conf             983899999999999878765556887787144888881220357



>1pkh_A Bifunctional deaminase/diphosphatase; DCTP deaminase, dutpase, DCD-DUT, MJ0430, DCTP, DUTP, hydrolase; 1.42A {Methanocaldococcus jannaschii} SCOP: b.85.4.1 PDB: 1ogh_A 1pkj_A* 1pkk_A* 2hxb_A 2hxe_A 3gf0_A 2hxd_A* Back     alignment and structure
>2qxx_A DCTP deaminase, deoxycytidine triphosphate deaminase; distorted beta barrel, hydrolase, nucleotide metabolism; HET: TTP 1PE; 2.00A {Mycobacterium tuberculosis H37RV} PDB: 2qlp_A* Back     alignment and structure
>1xs1_A DCTP deaminase, deoxycytidine triphosphate deaminase; nucleotide metabolism, trimer, hydrolase; HET: DUT; 1.80A {Escherichia coli} SCOP: b.85.4.1 PDB: 2v9x_A* 1xs6_A* 1xs4_A* 2j4q_A* 2j4h_A* Back     alignment and structure
>3km3_A DCTP deaminase, deoxycytidine triphosphate deaminase; ssgcid, NIH, niaid, SBRI, UW, decode, iodide phasing, hydrolase; 2.10A {Anaplasma phagocytophilum HZ} Back     alignment and structure
>2yzj_A 167AA long hypothetical dutpase; all beta proteins, hypothetical protein, NPPSFA; HET: DUD; 1.66A {Sulfolobus tokodaii} PDB: 2zdc_A Back     alignment and structure
>2r9q_A AGR_C_764P, 2'-deoxycytidine 5'-triphosphate deaminase; structural genomics, MCSG, PSI-2, protein structure initiative; 2.20A {Agrobacterium tumefaciens str} Back     alignment and structure
>2bsy_A Deoxyuridine 5'-triphosphate nucleotidohydrolase; dutpase, monomer, nucleotide metabolism, structural proteomics in europe, spine; HET: UMP; 1.5A {Human herpesvirus 4} SCOP: b.85.4.1 b.85.4.1 PDB: 2bt1_A* 2we1_A* 2we0_A* 2we2_A* 2we3_A* Back     alignment and structure
>1xs1_A DCTP deaminase, deoxycytidine triphosphate deaminase; nucleotide metabolism, trimer, hydrolase; HET: DUT; 1.80A {Escherichia coli} SCOP: b.85.4.1 PDB: 2v9x_A* 1xs6_A* 1xs4_A* 2j4q_A* 2j4h_A* Back     alignment and structure
>2qxx_A DCTP deaminase, deoxycytidine triphosphate deaminase; distorted beta barrel, hydrolase, nucleotide metabolism; HET: TTP 1PE; 2.00A {Mycobacterium tuberculosis H37RV} PDB: 2qlp_A* Back     alignment and structure
>3km3_A DCTP deaminase, deoxycytidine triphosphate deaminase; ssgcid, NIH, niaid, SBRI, UW, decode, iodide phasing, hydrolase; 2.10A {Anaplasma phagocytophilum HZ} Back     alignment and structure
>1pkh_A Bifunctional deaminase/diphosphatase; DCTP deaminase, dutpase, DCD-DUT, MJ0430, DCTP, DUTP, hydrolase; 1.42A {Methanocaldococcus jannaschii} SCOP: b.85.4.1 PDB: 1ogh_A 1pkj_A* 1pkk_A* 2hxb_A 2hxe_A 3gf0_A 2hxd_A* Back     alignment and structure
>2yzj_A 167AA long hypothetical dutpase; all beta proteins, hypothetical protein, NPPSFA; HET: DUD; 1.66A {Sulfolobus tokodaii} PDB: 2zdc_A Back     alignment and structure
>1dun_A Deoxyuridine 5'-triphosphate nucleoditohydrolase; dutpase, EIAV, trimeric enzyme, aspartyl protease; 1.90A {Equine infectious anemia virus} SCOP: b.85.4.1 PDB: 1duc_A Back     alignment and structure
>1f7d_A POL polyprotein; eight stranded beta-barrel, viral protein, hydrolase; 1.40A {Feline immunodeficiency virus} SCOP: b.85.4.1 PDB: 1f7k_A* 1f7n_A* 1f7o_A 1f7p_A* 1f7q_A* 1f7r_A* 1dut_A Back     alignment and structure
>2ol1_A Deoxyuridine 5'-triphosphate nucleotidohydrolase; fold, jelly-roll, superfamily, dutpase-like; HET: UMP; 1.80A {Vaccinia virus} PDB: 2oke_A* 2okd_A* 2ol0_A* 2okb_A Back     alignment and structure
>3lqw_A Deoxyuridine 5'-triphosphate nucleotidohydrolase; emerald biostructures, ALS collaborative crystallography; 1.30A {Entamoeba histolytica} Back     alignment and structure
>3c2t_A Deoxyuridine triphosphatase; dutpase chlorella virus, hydrolase; HET: DUD; 3.00A {Paramecium bursaria chlorella VIRUSIL3A} PDB: 3c3i_A* Back     alignment and structure
>3ecy_A CG4584-PA, isoform A (bcDNA.LD08534); jelly-roll, dimeric assembly, hydrolase; 1.88A {Drosophila melanogaster} Back     alignment and structure
>3ca9_A Deoxyuridine triphosphatase; dutpase chlorella virus, hydrolase; HET: DUD; 3.00A {Paramecium bursaria chlorella VIRUSIL3A} Back     alignment and structure
>3p48_A Deoxyuridine 5'-triphosphate nucleotidohydrolase; trimer, beta barrel, DUMPPNP pyrophosphatase, phosphoprotein, structural genomics; HET: DUP; 1.67A {Saccharomyces cerevisiae} Back     alignment and structure
>3f4f_A Deoxyuridine 5'-triphosphate nucleotidohydrolase; trimer, beta barrel, UMP, product complex, DUTP pyrophosphatase, DITP; HET: UMP; 2.00A {Saccharomyces cerevisiae} PDB: 3hhq_A Back     alignment and structure
>3hza_A Deoxyuridine 5'-triphosphate nucleotidohydrolase; jelly roll, domain swapping, nucleotide metabolism; HET: DUP; 1.20A {Mycobacterium tuberculosis} PDB: 1six_A* 1slh_A* 1sm8_A* 1smc_A* 1snf_A* 2py4_A* 3h6d_A* 3i93_A* 1mq7_A 1sjn_A* Back     alignment and structure
>2d4n_A DU; jelly roll, hydrolase; HET: UPR; 1.53A {Mason-pfizer monkey virus} PDB: 2d4m_A 2d4l_A* Back     alignment and structure
>3mdx_A Deoxyuridine 5'-triphosphate nucleotidohydrolase; metal-binding, nucleotide metabolism, structural genomics; 1.45A {Brucella melitensis} PDB: 3mbq_A Back     alignment and structure
>3ehw_A DUTP pyrophosphatase; jelly-roll, FULL-length C-terminal ARM, enzyme-ligand complex, hydrolase; HET: DUP; 1.80A {Homo sapiens} SCOP: b.85.4.1 PDB: 2hqu_A* 1q5h_A* 1q5u_X Back     alignment and structure
>2p9o_A DUTP pyrophosphatase-like protein; dutpase, magnesium binding, hydrolase; 2.00A {Arabidopsis thaliana} PDB: 2pc5_A Back     alignment and structure
>2xcd_A Probable deoxyuridine 5'-triphosphate nucleotidoh YNCF; hydrolase; 1.84A {Bacillus subtilis} PDB: 2xce_A* 2baz_A Back     alignment and structure
>3h6x_A Dutpase; jelly-roll beta-barrel, hydrolase; 1.70A {Streptococcus mutans} Back     alignment and structure
>1euw_A Dutpase, deoxyuridine 5'-triphosphate nucleotidohydrolase; jelly roll, mercury derivative; 1.05A {Escherichia coli} SCOP: b.85.4.1 PDB: 1dud_A 1dup_A 1eu5_A 1rn8_A* 1seh_A* 2hr6_A* 2hrm_A* 1rnj_A* 1syl_A* Back     alignment and structure
>2bsy_A Deoxyuridine 5'-triphosphate nucleotidohydrolase; dutpase, monomer, nucleotide metabolism, structural proteomics in europe, spine; HET: UMP; 1.5A {Human herpesvirus 4} SCOP: b.85.4.1 b.85.4.1 PDB: 2bt1_A* 2we1_A* 2we0_A* 2we2_A* 2we3_A* Back     alignment and structure
>1vyq_A Deoxyuridine 5'-triphosphate nucleotidohydrolase; drug design, dutpase, deoxyuridine nucleotidohydrolase, malaria; HET: DUX; 2.4A {Plasmodium falciparum} SCOP: b.85.4.1 Back     alignment and structure
>1dun_A Deoxyuridine 5'-triphosphate nucleoditohydrolase; dutpase, EIAV, trimeric enzyme, aspartyl protease; 1.90A {Equine infectious anemia virus} SCOP: b.85.4.1 PDB: 1duc_A Back     alignment and structure
>1f7d_A POL polyprotein; eight stranded beta-barrel, viral protein, hydrolase; 1.40A {Feline immunodeficiency virus} SCOP: b.85.4.1 PDB: 1f7k_A* 1f7n_A* 1f7o_A 1f7p_A* 1f7q_A* 1f7r_A* 1dut_A Back     alignment and structure
>3p48_A Deoxyuridine 5'-triphosphate nucleotidohydrolase; trimer, beta barrel, DUMPPNP pyrophosphatase, phosphoprotein, structural genomics; HET: DUP; 1.67A {Saccharomyces cerevisiae} Back     alignment and structure
>3lqw_A Deoxyuridine 5'-triphosphate nucleotidohydrolase; emerald biostructures, ALS collaborative crystallography; 1.30A {Entamoeba histolytica} Back     alignment and structure
>2ol1_A Deoxyuridine 5'-triphosphate nucleotidohydrolase; fold, jelly-roll, superfamily, dutpase-like; HET: UMP; 1.80A {Vaccinia virus} PDB: 2oke_A* 2okd_A* 2ol0_A* 2okb_A Back     alignment and structure
>3ecy_A CG4584-PA, isoform A (bcDNA.LD08534); jelly-roll, dimeric assembly, hydrolase; 1.88A {Drosophila melanogaster} Back     alignment and structure
>3c2t_A Deoxyuridine triphosphatase; dutpase chlorella virus, hydrolase; HET: DUD; 3.00A {Paramecium bursaria chlorella VIRUSIL3A} PDB: 3c3i_A* Back     alignment and structure
>2xcd_A Probable deoxyuridine 5'-triphosphate nucleotidoh YNCF; hydrolase; 1.84A {Bacillus subtilis} PDB: 2xce_A* 2baz_A Back     alignment and structure
>3ca9_A Deoxyuridine triphosphatase; dutpase chlorella virus, hydrolase; HET: DUD; 3.00A {Paramecium bursaria chlorella VIRUSIL3A} Back     alignment and structure
>3h6x_A Dutpase; jelly-roll beta-barrel, hydrolase; 1.70A {Streptococcus mutans} Back     alignment and structure
>3hza_A Deoxyuridine 5'-triphosphate nucleotidohydrolase; jelly roll, domain swapping, nucleotide metabolism; HET: DUP; 1.20A {Mycobacterium tuberculosis} PDB: 1six_A* 1slh_A* 1sm8_A* 1smc_A* 1snf_A* 2py4_A* 3h6d_A* 3i93_A* 1mq7_A 1sjn_A* Back     alignment and structure
>3mdx_A Deoxyuridine 5'-triphosphate nucleotidohydrolase; metal-binding, nucleotide metabolism, structural genomics; 1.45A {Brucella melitensis} PDB: 3mbq_A Back     alignment and structure
>3ehw_A DUTP pyrophosphatase; jelly-roll, FULL-length C-terminal ARM, enzyme-ligand complex, hydrolase; HET: DUP; 1.80A {Homo sapiens} SCOP: b.85.4.1 PDB: 2hqu_A* 1q5h_A* 1q5u_X Back     alignment and structure
>2d4n_A DU; jelly roll, hydrolase; HET: UPR; 1.53A {Mason-pfizer monkey virus} PDB: 2d4m_A 2d4l_A* Back     alignment and structure
>2p9o_A DUTP pyrophosphatase-like protein; dutpase, magnesium binding, hydrolase; 2.00A {Arabidopsis thaliana} PDB: 2pc5_A Back     alignment and structure
>1euw_A Dutpase, deoxyuridine 5'-triphosphate nucleotidohydrolase; jelly roll, mercury derivative; 1.05A {Escherichia coli} SCOP: b.85.4.1 PDB: 1dud_A 1dup_A 1eu5_A 1rn8_A* 1seh_A* 2hr6_A* 2hrm_A* 1rnj_A* 1syl_A* Back     alignment and structure
>1vyq_A Deoxyuridine 5'-triphosphate nucleotidohydrolase; drug design, dutpase, deoxyuridine nucleotidohydrolase, malaria; HET: DUX; 2.4A {Plasmodium falciparum} SCOP: b.85.4.1 Back     alignment and structure
>3f4f_A Deoxyuridine 5'-triphosphate nucleotidohydrolase; trimer, beta barrel, UMP, product complex, DUTP pyrophosphatase, DITP; HET: UMP; 2.00A {Saccharomyces cerevisiae} PDB: 3hhq_A Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 367 2'-deoxycytidine 5'-triphosphate deaminase [Candidatus
d1pkha_182 b.85.4.1 (A:) Bifunctional dCTP deaminase/dUTPase {Arch 1e-22
d1xs1a_193 b.85.4.1 (A:) Deoxycytidine triphosphate deaminase (dCT 3e-20
d1pkha_182 b.85.4.1 (A:) Bifunctional dCTP deaminase/dUTPase {Arch 4e-11
d1xs1a_193 b.85.4.1 (A:) Deoxycytidine triphosphate deaminase (dCT 8e-16
>d1pkha_ b.85.4.1 (A:) Bifunctional dCTP deaminase/dUTPase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 182 Back     information, alignment and structure

class: All beta proteins
fold: beta-clip
superfamily: dUTPase-like
family: dUTPase-like
domain: Bifunctional dCTP deaminase/dUTPase
species: Archaeon Methanococcus jannaschii [TaxId: 2190]
 Score =  101 bits (251), Expect = 1e-22
 Identities = 34/174 (19%), Positives = 58/174 (33%), Gaps = 22/174 (12%)

Query: 5   VLPDKAIATLAERGDIVSEHPLEKNQIQPASIDLRLSSKAYRVRASFLPNIDGLVSDKIK 64
           +L DK I        I+ + P  K+ + P S D+ L  +              L   +IK
Sbjct: 2   ILSDKDIIDYVTSKRIIIK-PFNKDFVGPCSYDVTLGDEFIIYDDEVYDLSKELNYKRIK 60

Query: 65  HFK---------------LREIDLSGGTVLDANCVYIVPLMESLNLKNGISAYANPKSSI 109
                             +                 +    E + L N ISA    +SS+
Sbjct: 61  IKNSILVCPLNYNLTEEKINYFKEKYNVDYVVEGGVLGTTNEYIELPNDISAQYQGRSSL 120

Query: 110 GRIDVFARVIGDRSQEFDSISPNYSGPLYLEILPRTFPIVVRVGSRLSQIRFVK 163
           GR+ + +            I   + G + LEI+    P+++    R+ Q+ F K
Sbjct: 121 GRVFLTSHQTAGW------IDAGFKGKITLEIVAFDKPVILYKNQRIGQLIFSK 168


>d1xs1a_ b.85.4.1 (A:) Deoxycytidine triphosphate deaminase (dCTP deaminase) {Escherichia coli [TaxId: 562]} Length = 193 Back     information, alignment and structure
>d1pkha_ b.85.4.1 (A:) Bifunctional dCTP deaminase/dUTPase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 182 Back     information, alignment and structure
>d1xs1a_ b.85.4.1 (A:) Deoxycytidine triphosphate deaminase (dCTP deaminase) {Escherichia coli [TaxId: 562]} Length = 193 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target367 2'-deoxycytidine 5'-triphosphate deaminase [Candidatus
d1xs1a_193 Deoxycytidine triphosphate deaminase (dCTP deaminase) { 100.0
d1pkha_182 Bifunctional dCTP deaminase/dUTPase {Archaeon Methanoco 100.0
d1xs1a_193 Deoxycytidine triphosphate deaminase (dCTP deaminase) { 100.0
d1pkha_182 Bifunctional dCTP deaminase/dUTPase {Archaeon Methanoco 99.91
d1duna_120 Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPa 99.57
d1f7da_118 Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPa 99.46
d2bsya2136 Monomeric viral dUTPase {Epstein-barr virus [TaxId: 103 99.31
d2bsya1113 Monomeric viral dUTPase {Epstein-barr virus [TaxId: 103 99.28
d3ehwa1136 Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPa 99.2
d1euwa_136 Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPa 99.06
d1sixa_153 Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPa 99.0
d1duna_120 Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPa 99.21
d1f7da_118 Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPa 98.95
d2bsya1113 Monomeric viral dUTPase {Epstein-barr virus [TaxId: 103 98.82
d3ehwa1136 Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPa 98.62
d1sixa_153 Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPa 98.46
d2bsya2136 Monomeric viral dUTPase {Epstein-barr virus [TaxId: 103 98.4
d1euwa_136 Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPa 98.4
d1vyqa1159 Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPa 97.94
d1vyqa1159 Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPa 99.09
>d1xs1a_ b.85.4.1 (A:) Deoxycytidine triphosphate deaminase (dCTP deaminase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All beta proteins
fold: beta-clip
superfamily: dUTPase-like
family: dUTPase-like
domain: Deoxycytidine triphosphate deaminase (dCTP deaminase)
species: Escherichia coli [TaxId: 562]
Probab=100.00  E-value=9.7e-41  Score=282.81  Aligned_cols=156  Identities=22%  Similarity=0.343  Sum_probs=132.8

Q ss_pred             CCCCHHHHHHHHHCCCEEECCCCCH-HHCCCCEEEEEECCEEEEEECCCCCCCC-----CCHHHHCCCC--EEEEEECCC
Q ss_conf             6158689999998798498178986-5657122588758989998123157888-----6211000240--478873688
Q gi|254780480|r    4 GVLPDKAIATLAERGDIVSEHPLEK-NQIQPASIDLRLSSKAYRVRASFLPNID-----GLVSDKIKHF--KLREIDLSG   75 (367)
Q Consensus         4 GILsd~~I~~li~~g~I~i~~p~~~-~QIQPaSiDLRLG~~~~rv~asflp~~~-----~~v~~~l~~~--~~~eidl~~   75 (367)
                      |||||++|++++++|.|.++ |+++ +||||||+|||||+++++++.+.-+..+     ..+.+.++..  ....++.++
T Consensus         1 MiLSd~~I~~~i~~g~I~i~-P~~~~~qiqp~s~DLrLg~~~~v~~~~~~~~id~~~~~~~~~~~~~~~~~~~~~~~~~~   79 (193)
T d1xs1a_           1 MRLCDRDIEAWLDEGRLSIN-PRPPVERINGATVDVRLGNKFRTFRGHTAAFIDLSGPKDEVSAALDRVMSDEIVLDEGE   79 (193)
T ss_dssp             CBCCHHHHHHHHHHTSSEEE-SCCCGGGEETTEEEEEBCSEEBCBCGGGCSCEETTSCHHHHHHHHHHHBCCCEECCTTC
T ss_pred             CCCCHHHHHHHHHCCCEEEC-CCCHHHCCCCCEEEEECCCEEEEEECCCCCCCCCCCCCCHHHHHHHHCCCCEEEECCCC
T ss_conf             95788999999986995871-68721015784599873667999954465203567775023333221034215505786


Q ss_pred             CEEECCCCEEEEEEEEEEECCCCCEEEEECCCCCCCCCCEEEEEECCCCCCCCCCCCCCEEEEEEECCCC-CCEEEECCC
Q ss_conf             6486687329999888998499827998601343112503423207877554236674438999951686-527983398
Q gi|254780480|r   76 GTVLDANCVYIVPLMESLNLKNGISAYANPKSSIGRIDVFARVIGDRSQEFDSISPNYSGPLYLEILPRT-FPIVVRVGS  154 (367)
Q Consensus        76 g~vLepg~~yLv~t~E~i~LP~di~a~~~pKSS~GRLgif~r~i~~~~~~f~~id~Gy~G~l~lEI~~~s-fpI~v~~G~  154 (367)
                      +|+|+||++||++|+|+|+||+|++|.++||||+||+||++|++++      +|||||+|++||||.|.+ +||++++||
T Consensus        80 ~~~L~Pg~~~L~~T~E~v~lP~~~~a~~~~rSS~~R~Gl~~~~~ag------~~dpG~~G~ltlel~n~~~~pi~i~~g~  153 (193)
T d1xs1a_          80 AFYLHPGELALAVTLESVTLPADLVGWLDGRSSLARLGLMVHVTAH------RIDPGWSGCIVLEFYNSGKLPLALRPGM  153 (193)
T ss_dssp             CEEECTTCCEEEEEEEEEECCTTEEEEEECCHHHHTTTEESCSSCC------EECTTCEEEEEEEEEECSSSCEEECTTS
T ss_pred             EEEEECCCEEEEEEEEEEECCCCEEEEEEECCCCEEEEEEEECCCC------EECCCCCEEEEEEEEECCCCEEEECCCC
T ss_conf             1998189899999777886483548999814660005778851354------8779976069999996774269975899


Q ss_pred             EEEEEEEEECCC
Q ss_conf             035689850887
Q gi|254780480|r  155 RLSQIRFVKERK  166 (367)
Q Consensus       155 rl~Qi~f~~g~~  166 (367)
                      |||||+|++...
T Consensus       154 ~i~Qlvf~~~~~  165 (193)
T d1xs1a_         154 LIGALSFEPLSG  165 (193)
T ss_dssp             EEEEEEEEECSS
T ss_pred             EEEEEEEEECCC
T ss_conf             899999998878



>d1pkha_ b.85.4.1 (A:) Bifunctional dCTP deaminase/dUTPase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1xs1a_ b.85.4.1 (A:) Deoxycytidine triphosphate deaminase (dCTP deaminase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pkha_ b.85.4.1 (A:) Bifunctional dCTP deaminase/dUTPase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1duna_ b.85.4.1 (A:) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Equine infectious anemia virus [TaxId: 11665]} Back     information, alignment and structure
>d1f7da_ b.85.4.1 (A:) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Feline immunodeficiency virus [TaxId: 11673]} Back     information, alignment and structure
>d2bsya2 b.85.4.1 (A:121-256) Monomeric viral dUTPase {Epstein-barr virus [TaxId: 10376]} Back     information, alignment and structure
>d2bsya1 b.85.4.1 (A:4-116) Monomeric viral dUTPase {Epstein-barr virus [TaxId: 10376]} Back     information, alignment and structure
>d3ehwa1 b.85.4.1 (A:24-159) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1euwa_ b.85.4.1 (A:) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sixa_ b.85.4.1 (A:) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Mycobacterium tuberculosis, rv2697c [TaxId: 1773]} Back     information, alignment and structure
>d1duna_ b.85.4.1 (A:) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Equine infectious anemia virus [TaxId: 11665]} Back     information, alignment and structure
>d1f7da_ b.85.4.1 (A:) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Feline immunodeficiency virus [TaxId: 11673]} Back     information, alignment and structure
>d2bsya1 b.85.4.1 (A:4-116) Monomeric viral dUTPase {Epstein-barr virus [TaxId: 10376]} Back     information, alignment and structure
>d3ehwa1 b.85.4.1 (A:24-159) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sixa_ b.85.4.1 (A:) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Mycobacterium tuberculosis, rv2697c [TaxId: 1773]} Back     information, alignment and structure
>d2bsya2 b.85.4.1 (A:121-256) Monomeric viral dUTPase {Epstein-barr virus [TaxId: 10376]} Back     information, alignment and structure
>d1euwa_ b.85.4.1 (A:) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vyqa1 b.85.4.1 (A:1-159) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1vyqa1 b.85.4.1 (A:1-159) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 367 2'-deoxycytidine 5'-triphosphate deaminase [Candid
2r9q_A_1-174174 (A:1-174) AGR_C_764P, 2'-deoxycytidine 5'-triphosp 7e-30
2r9q_A_175-370196 (A:175-370) AGR_C_764P, 2'-deoxycytidine 5'-tripho 8e-21
1pkh_A_204 (A:) Bifunctional deaminase/diphosphatase; DCTP de 4e-23
3km3_A_206 (A:) DCTP deaminase, deoxycytidine triphosphate de 1e-13
1xs1_A_193 (A:) DCTP deaminase, deoxycytidine triphosphate de 6e-21
2qxx_A_190 (A:) DCTP deaminase, deoxycytidine triphosphate de 6e-20
2yzj_A_169 (A:) 167AA long hypothetical dutpase; all beta pro 1e-16
1vyq_A_173 (A:) Deoxyuridine 5'-triphosphate nucleotidohydrol 1e-16
2p9o_A_169 (A:) DUTP pyrophosphatase-like protein; dutpase, m 1e-15
3hza_A_174 (A:) Deoxyuridine 5'-triphosphate nucleotidohydrol 6e-15
3ehw_A_164 (A:) DUTP pyrophosphatase; jelly-roll, FULL-length 1e-14
2d4n_A_152 (A:) DU; jelly roll, hydrolase; HET: UPR; 1.53A {M 3e-11
3ecy_A_160 (A:) CG4584-PA, isoform A (bcDNA.LD08534); jelly-r 3e-14
3f4f_A_167 (A:) Deoxyuridine 5'-triphosphate nucleotidohydrol 8e-10
3ca9_A_165 (A:) Deoxyuridine triphosphatase; dutpase chlorell 5e-08
2ol1_A_147 (A:) Deoxyuridine 5'-triphosphate nucleotidohydrol 0.002
2r9q_A_1-174174 (A:1-174) AGR_C_764P, 2'-deoxycytidine 5'-triphosp 4e-05
2r9q_A_175-370196 (A:175-370) AGR_C_764P, 2'-deoxycytidine 5'-tripho 1e-26
1pkh_A_204 (A:) Bifunctional deaminase/diphosphatase; DCTP de 1e-14
1xs1_A_193 (A:) DCTP deaminase, deoxycytidine triphosphate de 4e-16
2qxx_A_190 (A:) DCTP deaminase, deoxycytidine triphosphate de 1e-11
3ehw_A_164 (A:) DUTP pyrophosphatase; jelly-roll, FULL-length 1e-04
2d4n_A_152 (A:) DU; jelly roll, hydrolase; HET: UPR; 1.53A {M 2e-14
3f4f_A_167 (A:) Deoxyuridine 5'-triphosphate nucleotidohydrol 6e-10
2ol1_A_147 (A:) Deoxyuridine 5'-triphosphate nucleotidohydrol 4e-04
3km3_A_206 (A:) DCTP deaminase, deoxycytidine triphosphate de 1e-21
2yzj_A_169 (A:) 167AA long hypothetical dutpase; all beta pro 6e-07
1vyq_A_173 (A:) Deoxyuridine 5'-triphosphate nucleotidohydrol 2e-04
2p9o_A_169 (A:) DUTP pyrophosphatase-like protein; dutpase, m 0.002
3hza_A_174 (A:) Deoxyuridine 5'-triphosphate nucleotidohydrol 0.001
1f7d_A_136 (A:) POL polyprotein; eight stranded beta-barrel, 3e-09
3ca9_A_165 (A:) Deoxyuridine triphosphatase; dutpase chlorell 0.004
1dun_A_134 (A:) Deoxyuridine 5'-triphosphate nucleoditohydrol 7e-06
2bsy_A_117-244128 (A:117-244) Deoxyuridine 5'-triphosphate nucleotid 5e-05
2baz_A_142 (A:) YOSS, hypothetical protein BSU20020; homotrim 1e-04
1f7d_A_136 (A:) POL polyprotein; eight stranded beta-barrel, 0.001
2baz_A_142 (A:) YOSS, hypothetical protein BSU20020; homotrim 4e-04
>2r9q_A (A:1-174) AGR_C_764P, 2'-deoxycytidine 5'-triphosphate deaminase; structural genomics, MCSG, PSI-2, protein structure initiative; 2.20A {Agrobacterium tumefaciens str}Length = 174 Back     alignment and structure
 Score =  125 bits (316), Expect = 7e-30
 Identities = 99/160 (61%), Positives = 115/160 (71%)

Query: 4   GVLPDKAIATLAERGDIVSEHPLEKNQIQPASIDLRLSSKAYRVRASFLPNIDGLVSDKI 63
           G+L D AI  L     + SE  L+ +Q+QPAS+DLRL SKAYRVRASF+P     V DK+
Sbjct: 11  GILADGAIRALFAGDKLKSEADLDVDQVQPASLDLRLGSKAYRVRASFMPGPGTRVIDKL 70

Query: 64  KHFKLREIDLSGGTVLDANCVYIVPLMESLNLKNGISAYANPKSSIGRIDVFARVIGDRS 123
             F L E+DLS G VL+  CVYIVPLMESL L   +SA ANPKSS GR+D+F RV+ D +
Sbjct: 71  NRFSLHEVDLSQGAVLETGCVYIVPLMESLALPADMSASANPKSSTGRLDIFTRVMTDNA 130

Query: 124 QEFDSISPNYSGPLYLEILPRTFPIVVRVGSRLSQIRFVK 163
           QEFD I   Y+GPLYLEI PRTFPIVVR GSRLSQIRF  
Sbjct: 131 QEFDKIPAGYTGPLYLEISPRTFPIVVRRGSRLSQIRFRI 170


>2r9q_A (A:175-370) AGR_C_764P, 2'-deoxycytidine 5'-triphosphate deaminase; structural genomics, MCSG, PSI-2, protein structure initiative; 2.20A {Agrobacterium tumefaciens str}Length = 196 Back     alignment and structure
>1pkh_A (A:) Bifunctional deaminase/diphosphatase; DCTP deaminase, dutpase, DCD-DUT, MJ0430, DCTP, DUTP, hydrolase; 1.42A {Methanocaldococcus jannaschii}Length = 204 Back     alignment and structure
>3km3_A (A:) DCTP deaminase, deoxycytidine triphosphate deaminase; ssgcid, NIH, niaid, SBRI, UW, decode, iodide phasing, hydrolase; 2.10A {Anaplasma phagocytophilum HZ}Length = 206 Back     alignment and structure
>1xs1_A (A:) DCTP deaminase, deoxycytidine triphosphate deaminase; nucleotide metabolism, trimer, hydrolase; HET: DUT; 1.80A {Escherichia coli}Length = 193 Back     alignment and structure
>2qxx_A (A:) DCTP deaminase, deoxycytidine triphosphate deaminase; distorted beta barrel, hydrolase, nucleotide metabolism; HET: TTP 1PE; 2.00A {Mycobacterium tuberculosis H37RV} PDB: 2qlp_A*Length = 190 Back     alignment and structure
>2yzj_A (A:) 167AA long hypothetical dutpase; all beta proteins, hypothetical protein, NPPSFA; HET: DUD; 1.66A {Sulfolobus tokodaii} PDB: 2zdc_ALength = 169 Back     alignment and structure
>1vyq_A (A:) Deoxyuridine 5'-triphosphate nucleotidohydrolase; drug design, dutpase, deoxyuridine nucleotidohydrolase, malaria; HET: DUX; 2.4A {Plasmodium falciparum}Length = 173 Back     alignment and structure
>2p9o_A (A:) DUTP pyrophosphatase-like protein; dutpase, magnesium binding, hydrolase; 2.00A {Arabidopsis thaliana} PDB: 2pc5_ALength = 169 Back     alignment and structure
>3hza_A (A:) Deoxyuridine 5'-triphosphate nucleotidohydrolase; jelly roll, domain swapping, nucleotide metabolism; HET: DUP; 1.20A {Mycobacterium tuberculosis} PDB: 1six_A* 1slh_A* 1sm8_A* 1smc_A* 1snf_A* 2py4_A* 3h6d_A* 3i93_A* 1mq7_A 1sjn_A*Length = 174 Back     alignment and structure
>3ehw_A (A:) DUTP pyrophosphatase; jelly-roll, FULL-length C-terminal ARM, enzyme-ligand complex, hydrolase; HET: DUP; 1.80A {Homo sapiens}Length = 164 Back     alignment and structure
>2d4n_A (A:) DU; jelly roll, hydrolase; HET: UPR; 1.53A {Mason-pfizer monkey virus} PDB: 2d4m_A 2d4l_A*Length = 152 Back     alignment and structure
>3ecy_A (A:) CG4584-PA, isoform A (bcDNA.LD08534); jelly-roll, dimeric assembly, hydrolase; 1.88A {Drosophila melanogaster}Length = 160 Back     alignment and structure
>3f4f_A (A:) Deoxyuridine 5'-triphosphate nucleotidohydrolase; trimer, beta barrel, UMP, product complex, DUTP pyrophosphatase, DITP; HET: UMP; 2.00A {Saccharomyces cerevisiae} PDB: 3hhq_ALength = 167 Back     alignment and structure
>3ca9_A (A:) Deoxyuridine triphosphatase; dutpase chlorella virus, hydrolase; HET: DUD; 3.00A {Paramecium bursaria chlorella VIRUSIL3A}Length = 165 Back     alignment and structure
>2ol1_A (A:) Deoxyuridine 5'-triphosphate nucleotidohydrolase; fold, jelly-roll, superfamily, dutpase-like; HET: UMP; 1.80A {Vaccinia virus} PDB: 2oke_A* 2okd_A* 2ol0_A* 2okb_ALength = 147 Back     alignment and structure
>2r9q_A (A:1-174) AGR_C_764P, 2'-deoxycytidine 5'-triphosphate deaminase; structural genomics, MCSG, PSI-2, protein structure initiative; 2.20A {Agrobacterium tumefaciens str}Length = 174 Back     alignment and structure
>2r9q_A (A:175-370) AGR_C_764P, 2'-deoxycytidine 5'-triphosphate deaminase; structural genomics, MCSG, PSI-2, protein structure initiative; 2.20A {Agrobacterium tumefaciens str}Length = 196 Back     alignment and structure
>1pkh_A (A:) Bifunctional deaminase/diphosphatase; DCTP deaminase, dutpase, DCD-DUT, MJ0430, DCTP, DUTP, hydrolase; 1.42A {Methanocaldococcus jannaschii}Length = 204 Back     alignment and structure
>1xs1_A (A:) DCTP deaminase, deoxycytidine triphosphate deaminase; nucleotide metabolism, trimer, hydrolase; HET: DUT; 1.80A {Escherichia coli}Length = 193 Back     alignment and structure
>2qxx_A (A:) DCTP deaminase, deoxycytidine triphosphate deaminase; distorted beta barrel, hydrolase, nucleotide metabolism; HET: TTP 1PE; 2.00A {Mycobacterium tuberculosis H37RV} PDB: 2qlp_A*Length = 190 Back     alignment and structure
>3ehw_A (A:) DUTP pyrophosphatase; jelly-roll, FULL-length C-terminal ARM, enzyme-ligand complex, hydrolase; HET: DUP; 1.80A {Homo sapiens}Length = 164 Back     alignment and structure
>2d4n_A (A:) DU; jelly roll, hydrolase; HET: UPR; 1.53A {Mason-pfizer monkey virus} PDB: 2d4m_A 2d4l_A*Length = 152 Back     alignment and structure
>3f4f_A (A:) Deoxyuridine 5'-triphosphate nucleotidohydrolase; trimer, beta barrel, UMP, product complex, DUTP pyrophosphatase, DITP; HET: UMP; 2.00A {Saccharomyces cerevisiae} PDB: 3hhq_ALength = 167 Back     alignment and structure
>2ol1_A (A:) Deoxyuridine 5'-triphosphate nucleotidohydrolase; fold, jelly-roll, superfamily, dutpase-like; HET: UMP; 1.80A {Vaccinia virus} PDB: 2oke_A* 2okd_A* 2ol0_A* 2okb_ALength = 147 Back     alignment and structure
>3km3_A (A:) DCTP deaminase, deoxycytidine triphosphate deaminase; ssgcid, NIH, niaid, SBRI, UW, decode, iodide phasing, hydrolase; 2.10A {Anaplasma phagocytophilum HZ}Length = 206 Back     alignment and structure