254780482

254780482

ribonuclease P

GeneID in NCBI database:8209471Locus tag:CLIBASIA_01835
Protein GI in NCBI database:254780482Protein Accession:YP_003064895.1
Gene range:+(403349, 403720)Protein Length:123aa
Gene description:ribonuclease P
COG prediction:[J] RNase P protein component
KEGG prediction:rnpA; ribonuclease P (EC:3.1.26.5); K03536 ribonuclease P protein component [EC:3.1.26.5]
SEED prediction:Ribonuclease P protein component (EC 3.1.26.5)
Pathway involved in KEGG:not defined
Subsystem involved in SEED:tRNA processing
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120---
MSNICILKKRRQFALVKKGELRKGPFFSLEVLNNNNSNLLPRVGFTVTKKQGCAVERNRMRRRLKEAVRLCAEGVLKHGHDYVLIAKRDALFIPFKELCNHFVERVRRNKRSYYSGKNFSRKS
cccccccccHHHHHHHHHHHHcccccEEEEEEcccccccccEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEccccccccHHHHHHHHHHHHHHHHHcccccccccccc
ccccEEEEccHHHHHHHHcccccccEEEEEEEccccccccccEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEccHHHcccHHHHHHHHHHHHHHHcccccccccccccc
MSNICILKKRRQFALVkkgelrkgpffslevlnnnnsnllprvgftvtkkqgcaVERNRMRRRLKEAVRLCAEGVLKHGHDYVLIAKRDALFIPFKELCNHFVERVRrnkrsyysgknfsrks
msnicilkkrrqfalvkkgelrkGPFFSLEVlnnnnsnllprvgftvtkkqgcavernrmrrRLKEAVRLCAEGVLKHGHDYVLIAKRDALFIPFKELCNHFVervrrnkrsyysgknfsrks
MSNICILKKRRQFALVKKGELRKGPFFSLEVlnnnnsnllPRVGFTVTKKQGCAVERNRMRRRLKEAVRLCAEGVLKHGHDYVLIAKRDALFIPFKELCNHFVERVRRNKRSYYSGKNFSRKS
***ICILKKRRQFALVKKGELRKGPFFSLEVLNNNNSNLLPRVGFTVTKKQGCAVERNRMRRRLKEAVRLCAEGVLKHGHDYVLIAKRDALFIPFKELCNHFVER******************
MSNICILKKRRQFALVKKGELRKGPFFSLEVLNNNNSNLLPRVGFTVTKKQGCAVERNRMRRRLKEAVRLCAEGVLKHGHDYVLIAKRDALFIPFKELCNHFVERVRRNKRSYYSGKNFSRKS
*SNICILKKRRQFALVKKGELRKGPFFSLEVLNNNNSNLLPRVGFTVTKKQGCAVERNRMRRRLKEAVRLCAEGVLKHGHDYVLIAKRDALFIPFKELCNHFVERVRRN**************
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSNICILKKRRQFALVKKGELRKGPFFSLEVLNNNNSNLLPRVGFTVTKKQGCAVERNRMRRRLKEAVRLCAEGVLKHGHDYVLIAKRDALFIPFKELCNHFVERVRRNKRSYYSGKNFSRKS
MSNICILKKRRQFALVKKGELRKGPFFSLEVLNNNNSNLLPRVGFTVTKKQGCAVERNRMRRRLKEAVRLCAEGVLKHGHDYVLIAKRDALFIPFKELCNHFVERVRRNKRSYYSGKNFSRKS
MSNICILKKRRQFALVKKGELRKGPFFSLEVLNNNNSNLLPRVGFTVTKKQGCAVERNRMRRRLKEAVRLCAEGVLKHGHDYVLIAKRDALFIPFKELCNHFVERVRRNKRSYYSGKNFSRKS

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target123 ribonuclease P [Candidatus Liberibacter asiaticus str.
315122062142 ribonuclease P [Candidatus Liberibacter solanacearum CL 1 1e-46
307301343132 ribonuclease P protein component [Sinorhizobium melilot 1 9e-25
15964198128 ribonuclease P [Sinorhizobium meliloti 1021] Length = 1 1 1e-24
227820670128 ribonuclease P [Sinorhizobium fredii NGR234] Length = 1 1 1e-24
150395308132 ribonuclease P [Sinorhizobium medicae WSM419] Length = 1 1e-24
159184284127 ribonuclease P [Agrobacterium tumefaciens str. C58] Len 1 4e-24
325291818139 ribonuclease P protein component [Agrobacterium sp. H13 1 9e-24
222084729137 ribonuclease P protein component [Agrobacterium radioba 1 1e-23
116250223129 ribonuclease P [Rhizobium leguminosarum bv. viciae 3841 1 3e-23
222147366129 ribonuclease P [Agrobacterium vitis S4] Length = 129 1 6e-23
>gi|315122062|ref|YP_004062551.1| ribonuclease P [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 142 Back     alignment and organism information
 Score =  189 bits (480), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 93/123 (75%), Positives = 105/123 (85%)

Query: 1   MSNICILKKRRQFALVKKGELRKGPFFSLEVLNNNNSNLLPRVGFTVTKKQGCAVERNRM 60
           MSNI ILKK RQFALVKKGE RKGP+FSLEVLNNNN   L R+GFTVTK+QGCAV RNR+
Sbjct: 20  MSNISILKKCRQFALVKKGESRKGPYFSLEVLNNNNPKGLSRIGFTVTKRQGCAVVRNRI 79

Query: 61  RRRLKEAVRLCAEGVLKHGHDYVLIAKRDALFIPFKELCNHFVERVRRNKRSYYSGKNFS 120
           RRRLKE VRLC++ +LK GHDYV++AKRD L +PFKELC HFVERVR NKR Y SGK FS
Sbjct: 80  RRRLKEVVRLCSKDILKPGHDYVIVAKRDTLLVPFKELCTHFVERVRYNKRLYRSGKIFS 139

Query: 121 RKS 123
           R++
Sbjct: 140 RET 142


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|307301343|ref|ZP_07581105.1| ribonuclease P protein component [Sinorhizobium meliloti BL225C] Length = 132 Back     alignment and organism information
>gi|15964198|ref|NP_384551.1| ribonuclease P [Sinorhizobium meliloti 1021] Length = 128 Back     alignment and organism information
>gi|227820670|ref|YP_002824640.1| ribonuclease P [Sinorhizobium fredii NGR234] Length = 128 Back     alignment and organism information
>gi|150395308|ref|YP_001325775.1| ribonuclease P [Sinorhizobium medicae WSM419] Length = 132 Back     alignment and organism information
>gi|159184284|ref|NP_353416.2| ribonuclease P [Agrobacterium tumefaciens str. C58] Length = 127 Back     alignment and organism information
>gi|325291818|ref|YP_004277682.1| ribonuclease P protein component [Agrobacterium sp. H13-3] Length = 139 Back     alignment and organism information
>gi|222084729|ref|YP_002543258.1| ribonuclease P protein component [Agrobacterium radiobacter K84] Length = 137 Back     alignment and organism information
>gi|116250223|ref|YP_766061.1| ribonuclease P [Rhizobium leguminosarum bv. viciae 3841] Length = 129 Back     alignment and organism information
>gi|222147366|ref|YP_002548323.1| ribonuclease P [Agrobacterium vitis S4] Length = 129 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target123 ribonuclease P [Candidatus Liberibacter asiaticus str.
PRK01313129 PRK01313, rnpA, ribonuclease P; Reviewed 3e-28
COG0594117 COG0594, RnpA, RNase P protein component [Translation, 1e-10
TIGR00188105 TIGR00188, rnpA, ribonuclease P protein component, euba 3e-08
PRK00499114 PRK00499, rnpA, ribonuclease P; Reviewed 9e-08
PRK00588118 PRK00588, rnpA, ribonuclease P; Reviewed 2e-04
PRK00396130 PRK00396, rnpA, ribonuclease P; Reviewed 0.001
PRK01732114 PRK01732, rnpA, ribonuclease P; Reviewed 0.003
pfam00825107 pfam00825, Ribonuclease_P, Ribonuclease P 1e-14
PRK14865116 PRK14865, rnpA, ribonuclease P; Provisional 7e-05
PRK04820145 PRK04820, rnpA, ribonuclease P; Reviewed 0.004
>gnl|CDD|167209 PRK01313, rnpA, ribonuclease P; Reviewed Back     alignment and domain information
>gnl|CDD|30939 COG0594, RnpA, RNase P protein component [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|129292 TIGR00188, rnpA, ribonuclease P protein component, eubacterial Back     alignment and domain information
>gnl|CDD|179048 PRK00499, rnpA, ribonuclease P; Reviewed Back     alignment and domain information
>gnl|CDD|179073 PRK00588, rnpA, ribonuclease P; Reviewed Back     alignment and domain information
>gnl|CDD|179002 PRK00396, rnpA, ribonuclease P; Reviewed Back     alignment and domain information
>gnl|CDD|179327 PRK01732, rnpA, ribonuclease P; Reviewed Back     alignment and domain information
>gnl|CDD|144425 pfam00825, Ribonuclease_P, Ribonuclease P Back     alignment and domain information
>gnl|CDD|184867 PRK14865, rnpA, ribonuclease P; Provisional Back     alignment and domain information
>gnl|CDD|179882 PRK04820, rnpA, ribonuclease P; Reviewed Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 123 ribonuclease P [Candidatus Liberibacter asiaticus str.
PRK00499116 rnpA ribonuclease P; Reviewed 99.97
PRK01313133 rnpA ribonuclease P; Reviewed 99.97
PRK03031122 rnpA ribonuclease P; Reviewed 99.97
PRK00588116 rnpA ribonuclease P; Reviewed 99.97
PRK03459129 rnpA ribonuclease P; Reviewed 99.96
pfam00825107 Ribonuclease_P Ribonuclease P. 99.96
PRK01732119 rnpA ribonuclease P; Reviewed 99.95
COG0594117 RnpA RNase P protein component [Translation, ribosomal 99.94
PRK04820145 rnpA ribonuclease P; Reviewed 99.93
PRK00396134 rnpA ribonuclease P; Reviewed 99.93
PRK00730138 rnpA ribonuclease P; Reviewed 99.93
PRK04390121 rnpA ribonuclease P; Reviewed 99.92
PRK01492118 rnpA ribonuclease P; Reviewed 99.79
PRK00038123 rnpA ribonuclease P; Reviewed 99.78
PRK01903133 rnpA ribonuclease P; Reviewed 99.71
TIGR00188124 rnpA ribonuclease P protein component; InterPro: IPR000 99.28
pfam10150 271 RNase_E_G Ribonuclease E/G family. Ribonuclease E and R 93.45
>PRK00499 rnpA ribonuclease P; Reviewed Back     alignment and domain information
>PRK01313 rnpA ribonuclease P; Reviewed Back     alignment and domain information
>PRK03031 rnpA ribonuclease P; Reviewed Back     alignment and domain information
>PRK00588 rnpA ribonuclease P; Reviewed Back     alignment and domain information
>PRK03459 rnpA ribonuclease P; Reviewed Back     alignment and domain information
>pfam00825 Ribonuclease_P Ribonuclease P Back     alignment and domain information
>PRK01732 rnpA ribonuclease P; Reviewed Back     alignment and domain information
>COG0594 RnpA RNase P protein component [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK04820 rnpA ribonuclease P; Reviewed Back     alignment and domain information
>PRK00396 rnpA ribonuclease P; Reviewed Back     alignment and domain information
>PRK00730 rnpA ribonuclease P; Reviewed Back     alignment and domain information
>PRK04390 rnpA ribonuclease P; Reviewed Back     alignment and domain information
>PRK01492 rnpA ribonuclease P; Reviewed Back     alignment and domain information
>PRK00038 rnpA ribonuclease P; Reviewed Back     alignment and domain information
>PRK01903 rnpA ribonuclease P; Reviewed Back     alignment and domain information
>TIGR00188 rnpA ribonuclease P protein component; InterPro: IPR000100 Ribonuclease P (3 Back     alignment and domain information
>pfam10150 RNase_E_G Ribonuclease E/G family Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target123 ribonuclease P [Candidatus Liberibacter asiaticus str.
1a6f_A119 Rnase P Protein From Bacillus Subtilis Length = 119 4e-14
1d6t_A117 Rnase P Protein From Staphylococcus Aureus Length = 9e-12
3okb_A118 Crystal Structure Of A Bacterial Rnase P Holoenzyme 8e-09
1nz0_A118 Rnase P Protein From Thermotoga Maritima Length = 1 9e-09
>gi|157829706|pdb|1A6F|A Chain A, Rnase P Protein From Bacillus Subtilis Length = 119 Back     alignment and structure
 Score = 81.3 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 32/108 (29%), Positives = 52/108 (48%), Gaps = 4/108 (3%)

Query: 1   MSNICILKKRRQFALVKK-GELRKGPFFSLEVLNNNNSNLLPRVGFTVTKKQGCAVERNR 59
           +     LKK   F  V K G       F L  L+   ++   RVG +V+KK G AV RNR
Sbjct: 4   LKKRNRLKKNEDFQKVFKHGTSVANRQFVLYTLDQPENDE-LRVGLSVSKKIGNAVMRNR 62

Query: 60  MRRRLKEAVRLCAEGVLKHGHDYVLIAKRDALFIPFKELCNHFVERVR 107
           ++R +++A     E + +   DY++IA++ A  + ++E         R
Sbjct: 63  IKRLIRQAFLEEKERLKEK--DYIIIARKPASQLTYEETKKSLQHLFR 108


gi|11514257|pdb|1D6T|A Chain A, Rnase P Protein From Staphylococcus Aureus Length = 117 Back     alignment and structure
>gi|33357536|pdb|1NZ0|A Chain A, Rnase P Protein From Thermotoga Maritima Length = 118 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target123 ribonuclease P [Candidatus Liberibacter asiaticus str.
1d6t_A117 Ribonuclease P, RNAse P protein; endonuclease, subunit; 8e-12
1a6f_A119 RNAse P protein, ribonuclease P protein; endonuclease, 2e-11
1nz0_A118 Ribonuclease P protein component; endonuclease, RNAse, 6e-11
>1d6t_A Ribonuclease P, RNAse P protein; endonuclease, subunit; NMR {Staphylococcus aureus} SCOP: d.14.1.2 Length = 117 Back     alignment and structure
 Score = 64.1 bits (156), Expect = 8e-12
 Identities = 28/105 (26%), Positives = 52/105 (49%), Gaps = 4/105 (3%)

Query: 7   LKKRRQFALV-KKGELRKGPFFSLEVLNNNNSNLLPRVGFTVTKKQGCAVERNRMRRRLK 65
           +KK   F  + KKG       F +   NN   +   R+G +V+KK G AV RN+++R ++
Sbjct: 9   IKKNADFQRIYKKGHSVANRQFVVYTCNNKEIDH-FRLGISVSKKLGNAVLRNKIKRAIR 67

Query: 66  EAVRLCAEGVLKHGHDYVLIAKRDALFIPFKELCNHFVERVRRNK 110
           E  ++    +L    D ++IA++ A  +   ++ N     ++  K
Sbjct: 68  ENFKVHKSHIL--AKDIIVIARQPAKDMTTLQIQNSLEHVLKIAK 110


>1a6f_A RNAse P protein, ribonuclease P protein; endonuclease, subunit; 2.60A {Bacillus subtilis} SCOP: d.14.1.2 Length = 119 Back     alignment and structure
>1nz0_A Ribonuclease P protein component; endonuclease, RNAse, ALFA-beta sandwich, dimer, structural genomics, BSGC structure funded by NIH; HET: MSE; 1.20A {Thermotoga maritima} SCOP: d.14.1.2 Length = 118 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target123 ribonuclease P [Candidatus Liberibacter asiaticus str.
1a6f_A119 RNAse P protein, ribonuclease P protein; endonuclease, 99.96
1d6t_A117 Ribonuclease P, RNAse P protein; endonuclease, subunit, 99.96
1nz0_A118 Ribonuclease P protein component; endonuclease, RNAse, 99.95
>1a6f_A RNAse P protein, ribonuclease P protein; endonuclease, subunit; 2.60A {Bacillus subtilis} SCOP: d.14.1.2 Back     alignment and structure
Probab=99.96  E-value=1e-29  Score=183.45  Aligned_cols=112  Identities=29%  Similarity=0.367  Sum_probs=100.7

Q ss_pred             CCCEEECCCHHHHHHHHH-CCCCCCCCEEEEEEECCCCCCCCEEEEEEECCCCCHHHHHHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             986132489899999970-9851368579999966876677379999607877512436689999999999754213488
Q gi|254780482|r    1 MSNICILKKRRQFALVKK-GELRKGPFFSLEVLNNNNSNLLPRVGFTVTKKQGCAVERNRMRRRLKEAVRLCAEGVLKHG   79 (123)
Q Consensus         1 m~~~~rLk~~~dF~~v~k-g~~~~~~~~~i~~~~~~~~~~~~R~G~~vsKKvg~AV~RNriKR~lRe~~R~~~~~~~~~~   79 (123)
                      |++.+||++++||+.|++ |.++.++++++++++++.. +++|+||+||||+|+||+||++||++||++|.+.+.+  ++
T Consensus         4 l~K~~RLk~~~dF~~v~~~G~~~~~~~~~l~~~~~~~~-~~~R~G~~vsKKvg~AV~RNriKR~lRe~~r~~~~~l--~~   80 (119)
T 1a6f_A            4 LKKRNRLKKNEDFQKVFKHGTSVANRQFVLYTLDQPEN-DELRVGLSVSKKIGNAVMRNRIKRLIRQAFLEEKERL--KE   80 (119)
T ss_dssp             CCGGGBCCSHHHHHHHHHHSEEEECSSEEEEECCCTTC-SSCEEEEEECSTTCCHHHHHHHHHHHHHHHHHHTTTB--CS
T ss_pred             CCHHHHCCCHHHHHHHHHCCCEEECCCEEEEEECCCCC-CCCEEEEEEECCCCCHHHHHHHHHHHHHHHHHHHCCC--CC
T ss_conf             85243468989999999859788689789999718989-9847999981434358889999999999999751338--99


Q ss_pred             CEEEEEECCCCCCCCHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             339998572003799899999999999998644104
Q gi|254780482|r   80 HDYVLIAKRDALFIPFKELCNHFVERVRRNKRSYYS  115 (123)
Q Consensus        80 ~d~Viiar~~~~~~~~~~l~~~l~~~l~k~~~~~~~  115 (123)
                      +||||++++++.+++|++|.++|..+|.++.--+.+
T Consensus        81 ~d~Vvi~r~~~~~~~~~~l~~~l~~ll~k~~l~~~~  116 (119)
T 1a6f_A           81 KDYIIIARKPASQLTYEETKKSLQHLFRKSSLYKKS  116 (119)
T ss_dssp             SEEEEEECGGGTTCCHHHHHHHHHHHHHHTTCBC--
T ss_pred             CEEEEEECCCCCCCCHHHHHHHHHHHHHHCCCCCCC
T ss_conf             859999668767699999999999999981242244



>1d6t_A Ribonuclease P, RNAse P protein; endonuclease, subunit, hydrolase; NMR {Staphylococcus aureus} SCOP: d.14.1.2 Back     alignment and structure
>1nz0_A Ribonuclease P protein component; endonuclease, RNAse, ALFA-beta sandwich, dimer, structural genomics, BSGC structure funded by NIH; HET: MSE; 1.20A {Thermotoga maritima} SCOP: d.14.1.2 Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 123 ribonuclease P [Candidatus Liberibacter asiaticus str.
d1d6ta_117 d.14.1.2 (A:) RNase P protein {Staphylococcus aureus [T 3e-12
d1a6fa_113 d.14.1.2 (A:) RNase P protein {Bacillus subtilis [TaxId 1e-11
d1nz0a_109 d.14.1.2 (A:) RNase P protein {Thermotoga maritima [Tax 2e-11
>d1d6ta_ d.14.1.2 (A:) RNase P protein {Staphylococcus aureus [TaxId: 1280]} Length = 117 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ribosomal protein S5 domain 2-like
superfamily: Ribosomal protein S5 domain 2-like
family: RNase P protein
domain: RNase P protein
species: Staphylococcus aureus [TaxId: 1280]
 Score = 64.1 bits (156), Expect = 3e-12
 Identities = 28/112 (25%), Positives = 53/112 (47%), Gaps = 4/112 (3%)

Query: 1   MSNICILKKRRQFALV-KKGELRKGPFFSLEVLNNNNSNLLPRVGFTVTKKQGCAVERNR 59
           +     +KK   F  + KKG       F +   NN   +   R+G +V+KK G AV RN+
Sbjct: 3   LEKAYRIKKNADFQRIYKKGHSVANRQFVVYTCNNKEIDH-FRLGISVSKKLGNAVLRNK 61

Query: 60  MRRRLKEAVRLCAEGVLKHGHDYVLIAKRDALFIPFKELCNHFVERVRRNKR 111
           ++R ++E  ++    +L    D ++IA++ A  +   ++ N     ++  K 
Sbjct: 62  IKRAIRENFKVHKSHIL--AKDIIVIARQPAKDMTTLQIQNSLEHVLKIAKV 111


>d1a6fa_ d.14.1.2 (A:) RNase P protein {Bacillus subtilis [TaxId: 1423]} Length = 113 Back     information, alignment and structure
>d1nz0a_ d.14.1.2 (A:) RNase P protein {Thermotoga maritima [TaxId: 2336]} Length = 109 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target123 ribonuclease P [Candidatus Liberibacter asiaticus str.
d1a6fa_113 RNase P protein {Bacillus subtilis [TaxId: 1423]} 99.96
d1d6ta_117 RNase P protein {Staphylococcus aureus [TaxId: 1280]} 99.96
d1nz0a_109 RNase P protein {Thermotoga maritima [TaxId: 2336]} 99.94
>d1a6fa_ d.14.1.2 (A:) RNase P protein {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ribosomal protein S5 domain 2-like
superfamily: Ribosomal protein S5 domain 2-like
family: RNase P protein
domain: RNase P protein
species: Bacillus subtilis [TaxId: 1423]
Probab=99.96  E-value=2.5e-29  Score=179.94  Aligned_cols=107  Identities=31%  Similarity=0.412  Sum_probs=97.8

Q ss_pred             CCCEEECCCHHHHHHHHH-CCCCCCCCEEEEEEECCCCCCCCEEEEEEECCCCCHHHHHHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             986132489899999970-9851368579999966876677379999607877512436689999999999754213488
Q gi|254780482|r    1 MSNICILKKRRQFALVKK-GELRKGPFFSLEVLNNNNSNLLPRVGFTVTKKQGCAVERNRMRRRLKEAVRLCAEGVLKHG   79 (123)
Q Consensus         1 m~~~~rLk~~~dF~~v~k-g~~~~~~~~~i~~~~~~~~~~~~R~G~~vsKKvg~AV~RNriKR~lRe~~R~~~~~~~~~~   79 (123)
                      |++.+||+++.||+.|++ |.++.+++++++++++++ .+++|+||+||||+|+||+||++||+|||+||.+.+.+  ++
T Consensus         3 l~k~~RL~~~~dF~~v~k~g~~~~~~~~~l~~~~~~~-~~~~R~G~~vsKKvg~AV~RNriKR~lRe~~r~~~~~~--~~   79 (113)
T d1a6fa_           3 LKKRNRLKKNEDFQKVFKHGTSVANRQFVLYTLDQPE-NDELRVGLSVSKKIGNAVMRNRIKRLIRQAFLEEKERL--KE   79 (113)
T ss_dssp             CCGGGBCCSHHHHHHHHHHSEEEECSSEEEEECCCTT-CSSCEEEEEECSTTCCHHHHHHHHHHHHHHHHHHTTTB--CS
T ss_pred             CCCCCCCCCHHHHHHHHHCCCEEECCCEEEEEECCCC-CCCCEEEEEEECCCCCHHHHHHHHHHHHHHHHHHHCCC--CC
T ss_conf             9741427998999999986958748978999972898-98836999992222446888999999999999752338--99


Q ss_pred             CEEEEEECCCCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             3399985720037998999999999999986
Q gi|254780482|r   80 HDYVLIAKRDALFIPFKELCNHFVERVRRNK  110 (123)
Q Consensus        80 ~d~Viiar~~~~~~~~~~l~~~l~~~l~k~~  110 (123)
                      +||||++++++.+.+|++|+++|..+|+++.
T Consensus        80 ~d~Vvi~~~~~~~~~~~~l~~~l~~ll~k~~  110 (113)
T d1a6fa_          80 KDYIIIARKPASQLTYEETKKSLQHLFRKSS  110 (113)
T ss_dssp             SEEEEEECGGGTTCCHHHHHHHHHHHHHHTT
T ss_pred             CEEEEEEECCCCCCCHHHHHHHHHHHHHHHC
T ss_conf             8699997077675999999999999999816



>d1d6ta_ d.14.1.2 (A:) RNase P protein {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1nz0a_ d.14.1.2 (A:) RNase P protein {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 123 ribonuclease P [Candidatus Liberibacter asiaticus
1a6f_A_119 (A:) RNAse P protein, ribonuclease P protein; endo 6e-13
1nz0_A_118 (A:) Ribonuclease P protein component; endonucleas 1e-12
1d6t_A_117 (A:) Ribonuclease P, RNAse P protein; endonuclease 2e-12
>1a6f_A (A:) RNAse P protein, ribonuclease P protein; endonuclease, subunit; 2.60A {Bacillus subtilis}Length = 119 Back     alignment and structure
 Score = 67.5 bits (165), Expect = 6e-13
 Identities = 31/112 (27%), Positives = 53/112 (47%), Gaps = 4/112 (3%)

Query: 1   MSNICILKKRRQF-ALVKKGELRKGPFFSLEVLNNNNSNLLPRVGFTVTKKQGCAVERNR 59
           +     LKK   F  + K G       F L  L+   ++   RVG +V+KK G AV RNR
Sbjct: 4   LKKRNRLKKNEDFQKVFKHGTSVANRQFVLYTLDQPENDE-LRVGLSVSKKIGNAVMRNR 62

Query: 60  MRRRLKEAVRLCAEGVLKHGHDYVLIAKRDALFIPFKELCNHFVERVRRNKR 111
           ++R +++A     E +     DY++IA++ A  + ++E         R++  
Sbjct: 63  IKRLIRQAFLEEKERL--KEKDYIIIARKPASQLTYEETKKSLQHLFRKSSL 112


>1nz0_A (A:) Ribonuclease P protein component; endonuclease, RNAse, ALFA-beta sandwich, dimer, structural genomics, BSGC structure funded by NIH; HET: MSE; 1.20A {Thermotoga maritima}Length = 118 Back     alignment and structure
>1d6t_A (A:) Ribonuclease P, RNAse P protein; endonuclease, subunit; NMR {Staphylococcus aureus}Length = 117 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target123 ribonuclease P [Candidatus Liberibacter asiaticus str.
1a6f_A_119 RNAse P protein, ribonuclease P protein; endonucle 99.97
1d6t_A_117 Ribonuclease P, RNAse P protein; endonuclease, sub 99.96
1nz0_A_118 Ribonuclease P protein component; endonuclease, RN 99.96
>1a6f_A (A:) RNAse P protein, ribonuclease P protein; endonuclease, subunit; 2.60A {Bacillus subtilis} Back     alignment and structure
Probab=99.97  E-value=6.4e-30  Score=185.39  Aligned_cols=113  Identities=29%  Similarity=0.365  Sum_probs=102.8

Q ss_pred             CCCEEECCCHHHHHHHHH-CCCCCCCCEEEEEEECCCCCCCCEEEEEEECCCCCHHHHHHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             986132489899999970-9851368579999966876677379999607877512436689999999999754213488
Q gi|254780482|r    1 MSNICILKKRRQFALVKK-GELRKGPFFSLEVLNNNNSNLLPRVGFTVTKKQGCAVERNRMRRRLKEAVRLCAEGVLKHG   79 (123)
Q Consensus         1 m~~~~rLk~~~dF~~v~k-g~~~~~~~~~i~~~~~~~~~~~~R~G~~vsKKvg~AV~RNriKR~lRe~~R~~~~~~~~~~   79 (123)
                      |++.+||+++.||+.|++ |+++.+++++++++++++. +++|+||+||||+|+||+||++||++||++|++.+.+  +|
T Consensus         4 ~~k~~rLk~~~eF~~v~~~g~~~~~~~~~l~~~~~~~~-~~~R~gi~vsKKvg~AV~RNriKR~lRe~~R~~~~~l--~~   80 (119)
T 1a6f_A            4 LKKRNRLKKNEDFQKVFKHGTSVANRQFVLYTLDQPEN-DELRVGLSVSKKIGNAVMRNRIKRLIRQAFLEEKERL--KE   80 (119)
T ss_dssp             CCGGGBCCSHHHHHHHHHHSEEEECSSEEEEECCCTTC-SSCEEEEEECSTTCCHHHHHHHHHHHHHHHHHHTTTB--CS
T ss_pred             CCHHHHCCCHHHHHHHHHCCCEEECCCEEEEEECCCCC-CCCEEEEEEEEECCCHHHHHHHHHHHHHHHHHHHCCC--CC
T ss_conf             85110179989999999859687489789999738989-9826999993102556888999999999999864128--99


Q ss_pred             CEEEEEECCCCCCCCHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             3399985720037998999999999999986441043
Q gi|254780482|r   80 HDYVLIAKRDALFIPFKELCNHFVERVRRNKRSYYSG  116 (123)
Q Consensus        80 ~d~Viiar~~~~~~~~~~l~~~l~~~l~k~~~~~~~~  116 (123)
                      +||||++++++.+++|+++.++|..+|.++.....+.
T Consensus        81 ~d~v~i~r~~~~~~~~~~l~~~l~~ll~k~~~~~~~~  117 (119)
T 1a6f_A           81 KDYIIIARKPASQLTYEETKKSLQHLFRKSSLYKKSS  117 (119)
T ss_dssp             SEEEEEECGGGTTCCHHHHHHHHHHHHHHTTCBC---
T ss_pred             CEEEEEECCCCCCCCHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             7499996687676999999999999999824231157



>1d6t_A (A:) Ribonuclease P, RNAse P protein; endonuclease, subunit; NMR {Staphylococcus aureus} Back     alignment and structure
>1nz0_A (A:) Ribonuclease P protein component; endonuclease, RNAse, ALFA-beta sandwich, dimer, structural genomics, BSGC structure funded by NIH; HET: MSE; 1.20A {Thermotoga maritima} Back     alignment and structure