254780483

254780483

putative inner membrane protein translocase component YidC

GeneID in NCBI database:8209472Locus tag:CLIBASIA_01840
Protein GI in NCBI database:254780483Protein Accession:YP_003064896.1
Gene range:+(403720, 405465)Protein Length:581aa
Gene description:putative inner membrane protein translocase component YidC
COG prediction:[U] Preprotein translocase subunit YidC
KEGG prediction:putative inner membrane protein translocase component YidC; K03217 preprotein translocase subunit YidC
SEED prediction:Inner membrane protein translocase component YidC, long form
Pathway involved in KEGG:Protein export [PATH:las03060]
Bacterial secretion system [PATH:las03070]
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM5 TM-Helix
TOPPRED6 TM-Helix
HMMTOP7 TM-Helix
MEMSAT6 TM-Helix
MEMSAT_SVM6 TM-Helix
PHOBIUS6 TM-Helix
SignalP_HMMno
SignalP_NNyes
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-
MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKNYNSQ
ccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccHHHHccccEEEEEccEEEEEEEccccEEEEEEEcccccccccccccEEEEcccccccEEEEEEEcccccccccccccccEEEEcccccccccEEEEEEEEccccEEEEEEEEEcccEEEEEEEEEEEcccccEEEEEEEEEEcccccccccccEEEEEEEEEEccccEEEEcHHHHHccccccccccccEEEEEEEEEEEEEEccccccEEEEEEEEcccccEEEEEEcccccccccccccEEEEEEEEcHHHHHHHHHHHHHcccccccHHHHcccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHccHHHcccccccEEcccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHcccccccc
cccHHHHHHHHHHHHHHHHHHHHHcccccccHccccHHHHHHcccccccccccccccccccHHHHHccccEEEEccEEEEEEEcccccHHHHcHHHcccccccccccEEEcccccccccEEEEEccccccccccccccccEEEEEccccccccccEEEEEEccccEEEEEEEEEEccEEEEEEEEEEccccccEEEccHHHHEccccccccccEEEEcccEEEccccccEEEEHHHHHHcccccccccccHHHEEHHEEEEEEcccccccccEEEEEEcccccEEEEEEEcccEEEcccccEEEEEEEEEcHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccHEEEHHHcccccccHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHcccHHHHHHcccccc
MERNWNYFVAIALSVIIVYAWQnfyvyprieemnnerkniqtvkqpnqvdnsYAAVLIDDRaqalsmsprvelknpsligsinlkgaqfddlnlrgyhldvssnspivtllspsntknayFAELDYVSTannielpnsntvwnlisgkiltpttpIKLVFKNANNILFERTISLDEHYLFKIVDTvtnnsidqirfsprgrimrhkpqtatntfgvqEGFIAVLGDKslveqkysdiekssisnfhesnswlgisdkywasvfipsketsfhsQFKYLsdgharyqakfsaneitilpgksitttnflfagakefptihhyekdlaipRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKthninplagcwpillQIPVFFAIYKVISISLemrhapfwgwikdlaaadptniftlfgilpfylpgfmhvgiWPIIMSLSMFIQmkmspppadkgqamilNWMPVVFVFALssfpagliIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKNYNSQ
MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIqtvkqpnqvdNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYLFKIVDtvtnnsidqirfsprgrimrhkpqtatntfgvqEGFIAVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLidrlrstfsknynsq
MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKNYNSQ
**RNWNYFVAIALSVIIVYAWQNFY**********************************************ELKNPSLIGSINLKGAQFDDLNLRGYHLDVS**SPI*TLLSPSNTKNAYFAELDYVSTANNIELPNSNTV*************PIKLVFKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIM**********FGVQEGFIAVLGDKSLVEQKYS**********HESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVST******QP*IDELRE**************IQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQ**************ILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAE******************
MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKNYNSQ
**RNWNYFVAIALSVIIVYAWQNFYVYP**************************************MSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSK*****
iiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooo
xxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooo
iiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooHHHHHHHHHHHHHHHHiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooo
oooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKNYNSQ
MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKNYNSQ
MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKNYNSQ

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target581 putative inner membrane protein translocase component Y
315122061578 putative inner membrane protein translocase component Y 1 0.0
86356094597 putative inner membrane protein translocase component Y 1 1e-180
150395307597 putative inner membrane protein translocase component Y 1 1e-177
209547692597 inner membrane protein translocase component YidC [Rhiz 1 1e-177
116250222598 inner membrane protein translocase component YidC [Rhiz 1 1e-177
222084728600 preprotein translocase 60 kD membrane subunit [Agrobact 1 1e-176
241202849597 inner membrane protein translocase component YidC [Rhiz 1 1e-175
15964197595 putative inner membrane protein translocase component Y 1 1e-174
307301342594 YidC/Oxa1 family domain containing membrane protein ins 1 1e-174
222147367620 putative inner membrane protein translocase component Y 1 1e-174
>gi|315122061|ref|YP_004062550.1| putative inner membrane protein translocase component YidC [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 578 Back     alignment and organism information
 Score =  923 bits (2385), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 443/581 (76%), Positives = 501/581 (86%), Gaps = 3/581 (0%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD 60
           ME+NWNYF AIA+SV IVY WQ  YV PRIE +   +K   T+++   + N+   V ID+
Sbjct: 1   MEKNWNYFAAIAISVAIVYVWQLVYVQPRIEAIKEGKKTPLTIEK-QSIQNT--IVPIDN 57

Query: 61  RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAY 120
           RAQALS SPRVE+ +PSL GSINLKGAQFDDL+L+GY +DVS NSP+V LL+P NT+NAY
Sbjct: 58  RAQALSRSPRVEINSPSLAGSINLKGAQFDDLSLKGYRVDVSRNSPMVALLNPLNTENAY 117

Query: 121 FAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYLF 180
           FAEL+Y+ST N    PN NTVWNL+SG++LTP++PIKL FK+ANNILFER ISLDE+YLF
Sbjct: 118 FAELNYISTTNTTVFPNENTVWNLVSGQVLTPSSPIKLAFKSANNILFERIISLDENYLF 177

Query: 181 KIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKS 240
            IVDT+TNN  + I FSP G+I R+K Q  +N+FGVQEGFIAVLGD+SL+E+KYSDIEKS
Sbjct: 178 TIVDTITNNGTNLISFSPYGKITRYKLQKESNSFGVQEGFIAVLGDQSLIEKKYSDIEKS 237

Query: 241 SISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPGK 300
           S+SNFHESNSWLGISDKYWAS FIP KE SF S+F Y SDG ARYQA F  NEI + PGK
Sbjct: 238 SVSNFHESNSWLGISDKYWASAFIPPKEKSFQSRFDYFSDGRARYQANFKINEIILSPGK 297

Query: 301 SITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNF 360
           S  TTN LF GAKE P I HYEK+L IPRFEMLIDWGWFYFIAKPMF LMSYFYNLVGNF
Sbjct: 298 STKTTNSLFVGAKELPIIQHYEKELEIPRFEMLIDWGWFYFIAKPMFALMSYFYNLVGNF 357

Query: 361 GIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYK 420
           GIAIMLTT+FVK LFFPLAKKQYVSTANMKNIQPKID LREKFKQ+ PQVLQK M+QLYK
Sbjct: 358 GIAIMLTTIFVKALFFPLAKKQYVSTANMKNIQPKIDALREKFKQASPQVLQKEMLQLYK 417

Query: 421 THNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGIL 480
           TH INPLAGCWPILLQIPVFFAIYKVISISLEMRHAPF+GWI+DLAA DPTNIFTLFGIL
Sbjct: 418 THKINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFFGWIQDLAAPDPTNIFTLFGIL 477

Query: 481 PFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLII 540
           PF LP F+HVGIWPIIMSLSMF+Q+KMSPPP DKGQA++LNWMPVVFVFALSSFPAGLII
Sbjct: 478 PFQLPEFIHVGIWPIIMSLSMFLQLKMSPPPTDKGQAIVLNWMPVVFVFALSSFPAGLII 537

Query: 541 YWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKNYNSQ 581
           YWSWSN+ISI+QQ VIMKM+GA+I +IDRLRS F+K+ NS+
Sbjct: 538 YWSWSNIISIIQQTVIMKMYGAKIDIIDRLRSMFAKSSNSK 578


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|86356094|ref|YP_467986.1| putative inner membrane protein translocase component YidC [Rhizobium etli CFN 42] Length = 597 Back     alignment and organism information
>gi|150395307|ref|YP_001325774.1| putative inner membrane protein translocase component YidC [Sinorhizobium medicae WSM419] Length = 597 Back     alignment and organism information
>gi|209547692|ref|YP_002279609.1| inner membrane protein translocase component YidC [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 597 Back     alignment and organism information
>gi|116250222|ref|YP_766060.1| inner membrane protein translocase component YidC [Rhizobium leguminosarum bv. viciae 3841] Length = 598 Back     alignment and organism information
>gi|222084728|ref|YP_002543257.1| preprotein translocase 60 kD membrane subunit [Agrobacterium radiobacter K84] Length = 600 Back     alignment and organism information
>gi|241202849|ref|YP_002973945.1| inner membrane protein translocase component YidC [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 597 Back     alignment and organism information
>gi|15964197|ref|NP_384550.1| putative inner membrane protein translocase component YidC [Sinorhizobium meliloti 1021] Length = 595 Back     alignment and organism information
>gi|307301342|ref|ZP_07581104.1| YidC/Oxa1 family domain containing membrane protein insertase [Sinorhizobium meliloti BL225C] Length = 594 Back     alignment and organism information
>gi|222147367|ref|YP_002548324.1| putative inner membrane protein translocase component YidC [Agrobacterium vitis S4] Length = 620 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target581 putative inner membrane protein translocase component Y
PRK01318521 PRK01318, PRK01318, membrane protein insertase; Provisi 1e-155
TIGR03593366 TIGR03593, yidC_nterm, membrane protein insertase, YidC 3e-65
TIGR03592181 TIGR03592, yidC_oxa1_cterm, membrane protein insertase, 4e-62
pfam02096194 pfam02096, 60KD_IMP, 60Kd inner membrane protein 3e-55
PRK02944255 PRK02944, PRK02944, OxaA-like protein precursor; Valida 6e-34
PRK00145223 PRK00145, PRK00145, putative inner membrane protein tra 4e-29
PRK01622256 PRK01622, PRK01622, OxaA-like protein precursor; Valida 6e-29
PRK01315329 PRK01315, PRK01315, putative inner membrane protein tra 6e-28
PRK02463307 PRK02463, PRK02463, OxaA-like protein precursor; Provis 2e-16
PRK02201357 PRK02201, PRK02201, putative inner membrane protein tra 2e-14
PRK03449304 PRK03449, PRK03449, putative inner membrane protein tra 7e-14
PRK00247 429 PRK00247, PRK00247, putative inner membrane protein tra 2e-11
KOG1239372 KOG1239, KOG1239, KOG1239, Inner membrane protein trans 6e-07
PRK01001795 PRK01001, PRK01001, putative inner membrane protein tra 2e-36
PRK02654 375 PRK02654, PRK02654, putative inner membrane protein tra 5e-16
COG0706314 COG0706, YidC, Preprotein translocase subunit YidC [Int 5e-62
>gnl|CDD|179279 PRK01318, PRK01318, membrane protein insertase; Provisional Back     alignment and domain information
>gnl|CDD|163342 TIGR03593, yidC_nterm, membrane protein insertase, YidC/Oxa1 family, N-terminal domain Back     alignment and domain information
>gnl|CDD|163341 TIGR03592, yidC_oxa1_cterm, membrane protein insertase, YidC/Oxa1 family, C-terminal domain Back     alignment and domain information
>gnl|CDD|145319 pfam02096, 60KD_IMP, 60Kd inner membrane protein Back     alignment and domain information
>gnl|CDD|179508 PRK02944, PRK02944, OxaA-like protein precursor; Validated Back     alignment and domain information
>gnl|CDD|178899 PRK00145, PRK00145, putative inner membrane protein translocase component YidC; Provisional Back     alignment and domain information
>gnl|CDD|179310 PRK01622, PRK01622, OxaA-like protein precursor; Validated Back     alignment and domain information
>gnl|CDD|179278 PRK01315, PRK01315, putative inner membrane protein translocase component YidC; Provisional Back     alignment and domain information
>gnl|CDD|179426 PRK02463, PRK02463, OxaA-like protein precursor; Provisional Back     alignment and domain information
>gnl|CDD|179383 PRK02201, PRK02201, putative inner membrane protein translocase component YidC; Provisional Back     alignment and domain information
>gnl|CDD|179580 PRK03449, PRK03449, putative inner membrane protein translocase component YidC; Provisional Back     alignment and domain information
>gnl|CDD|178945 PRK00247, PRK00247, putative inner membrane protein translocase component YidC; Validated Back     alignment and domain information
>gnl|CDD|36453 KOG1239, KOG1239, KOG1239, Inner membrane protein translocase involved in respiratory chain assembly [Posttranslational modification, protein turnover, chaperones, Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>gnl|CDD|179202 PRK01001, PRK01001, putative inner membrane protein translocase component YidC; Provisional Back     alignment and domain information
>gnl|CDD|179458 PRK02654, PRK02654, putative inner membrane protein translocase component YidC; Provisional Back     alignment and domain information
>gnl|CDD|31050 COG0706, YidC, Preprotein translocase subunit YidC [Intracellular trafficking and secretion] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 581 putative inner membrane protein translocase component Y
PRK01318565 putative inner membrane protein translocase component Y 100.0
PRK01001791 putative inner membrane protein translocase component Y 100.0
COG0706314 YidC Preprotein translocase subunit YidC [Intracellular 100.0
PRK00145225 putative inner membrane protein translocase component Y 100.0
PRK01622266 OxaA-like protein precursor; Validated 100.0
PRK02944255 OxaA-like protein precursor; Validated 100.0
PRK02463307 OxaA-like protein precursor; Provisional 100.0
PRK02654376 putative inner membrane protein translocase component Y 100.0
PRK01315325 putative inner membrane protein translocase component Y 100.0
PRK03449304 putative inner membrane protein translocase component Y 100.0
PRK02201392 putative inner membrane protein translocase component Y 100.0
TIGR03592181 yidC_oxa1_cterm membrane protein insertase, YidC/Oxa1 f 100.0
pfam02096194 60KD_IMP 60Kd inner membrane protein. 100.0
PRK00247 422 putative inner membrane protein translocase component Y 100.0
KOG1239372 consensus 99.82
KOG1239 372 consensus 96.94
TIGR03593366 yidC_nterm membrane protein insertase, YidC/Oxa1 family 100.0
COG1422201 Predicted membrane protein [Function unknown] 96.8
pfam01956168 DUF106 Integral membrane protein DUF106. This archaebac 95.51
pfam0055881 Vpu Vpu protein. The Vpu protein contains an N-terminal 92.3
PRK11055348 galM aldose 1-epimerase; Provisional 93.75
pfam01263301 Aldose_epim Aldose 1-epimerase. 92.44
pfam07423214 DUF1510 Protein of unknown function (DUF1510). This fam 91.34
>PRK01318 putative inner membrane protein translocase component YidC; Provisional Back     alignment and domain information
>PRK01001 putative inner membrane protein translocase component YidC; Provisional Back     alignment and domain information
>COG0706 YidC Preprotein translocase subunit YidC [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK00145 putative inner membrane protein translocase component YidC; Provisional Back     alignment and domain information
>PRK01622 OxaA-like protein precursor; Validated Back     alignment and domain information
>PRK02944 OxaA-like protein precursor; Validated Back     alignment and domain information
>PRK02463 OxaA-like protein precursor; Provisional Back     alignment and domain information
>PRK02654 putative inner membrane protein translocase component YidC; Provisional Back     alignment and domain information
>PRK01315 putative inner membrane protein translocase component YidC; Provisional Back     alignment and domain information
>PRK03449 putative inner membrane protein translocase component YidC; Provisional Back     alignment and domain information
>PRK02201 putative inner membrane protein translocase component YidC; Provisional Back     alignment and domain information
>TIGR03592 yidC_oxa1_cterm membrane protein insertase, YidC/Oxa1 family, C-terminal domain Back     alignment and domain information
>pfam02096 60KD_IMP 60Kd inner membrane protein Back     alignment and domain information
>PRK00247 putative inner membrane protein translocase component YidC; Validated Back     alignment and domain information
>KOG1239 consensus Back     alignment and domain information
>KOG1239 consensus Back     alignment and domain information
>TIGR03593 yidC_nterm membrane protein insertase, YidC/Oxa1 family, N-terminal domain Back     alignment and domain information
>COG1422 Predicted membrane protein [Function unknown] Back     alignment and domain information
>pfam01956 DUF106 Integral membrane protein DUF106 Back     alignment and domain information
>pfam00558 Vpu Vpu protein Back     alignment and domain information
>PRK11055 galM aldose 1-epimerase; Provisional Back     alignment and domain information
>pfam01263 Aldose_epim Aldose 1-epimerase Back     alignment and domain information
>pfam07423 DUF1510 Protein of unknown function (DUF1510) Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target581 putative inner membrane protein translocase component Y
3blc_A330 Crystal Structure Of The Periplasmic Domain Of The 8e-23
3bs6_A280 1.8 Angstrom Crystal Structure Of The Periplasmic D 1e-21
>gi|163931198|pdb|3BLC|A Chain A, Crystal Structure Of The Periplasmic Domain Of The Escherichia Coli Yidc Length = 330 Back     alignment and structure
 Score =  113 bits (282), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 47/304 (15%), Positives = 101/304 (33%), Gaps = 22/304 (7%)

Query: 56  VLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSN 115
              D    A      + +K   L  +IN +G   +   L  Y  +++S  P   L   ++
Sbjct: 22  SAADQGVPASGQGKLISVKTDVLDLTINTRGGDVEQALLPAYPKELNSTQPFQLL--ETS 79

Query: 116 TKNAYFAELDYVSTANNIELPNSNTVWNLISGKIL-----TPTTPIKLVFKNANNILFER 170
            +  Y A+             N       +               +   + +A    F +
Sbjct: 80  PQFIYQAQSGLTGRDGPDNPANGPRPLYNVEKDAYVLAEGQNELQVPXTYTDAAGNTFTK 139

Query: 171 TISLD-EHYLFKIVDTVTNNSIDQIRFSPRGRIMRH-----KPQTATNTFGVQEGFIAVL 224
           T  L    Y   +   V N     +  S  G++ +         T ++ F +     A  
Sbjct: 140 TFVLKRGDYAVNVNYNVQNAGEKPLEISSFGQLKQSITLPPHLDTGSSNFALHTFRGAAY 199

Query: 225 GDKS--LVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGH 282
                      +  I  +   N      W+    +Y+A+ +IP  + + +  F   + G+
Sbjct: 200 STPDAAYAAYAFDTIADNENLNISSKGGWVAXLQQYFATAWIPHNDGTNN--FYTANLGN 257

Query: 283 ARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFI 342
                 + +  + + PG++    + L+ G +              P  ++ +D+GW +FI
Sbjct: 258 GIAAIGYKSQPVLVQPGQTGAXNSTLWVGPEIQDK-----XAAVAPHLDLTVDYGWLWFI 312

Query: 343 AKPM 346
           ++P+
Sbjct: 313 SQPL 316


>gi|167745103|pdb|3BS6|A Chain A, 1.8 Angstrom Crystal Structure Of The Periplasmic Domain Of The Membrane Insertase Yidc Length = 280 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target581 putative inner membrane protein translocase component Y
3blc_A330 Inner membrane protein OXAA; YIDC, membrane assembly fa 8e-40
3bs6_A280 Inner membrane protein OXAA; YIDC/OXA1/ALB3 family, mem 3e-31
>3blc_A Inner membrane protein OXAA; YIDC, membrane assembly facilitator, chaperone, periplasmic domain, transmembrane, chaperone; 2.50A {Escherichia coli K12} Length = 330 Back     alignment and structure
 Score =  160 bits (405), Expect = 8e-40
 Identities = 49/321 (15%), Positives = 112/321 (34%), Gaps = 22/321 (6%)

Query: 41  QTVKQPNQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLD 100
              +Q  Q   + A    D    A      + +K   L  +IN +G   +   L  Y  +
Sbjct: 7   PQAQQTTQTTTTAAGSAADQGVPASGQGKLISVKTDVLDLTINTRGGDVEQALLPAYPKE 66

Query: 101 VSSNSPIVTLLSPSNTKNAYFAELDYVSTAN-NIELPNSNTVWNLISGKILT----PTTP 155
           ++S  P   L   ++ +  Y A+         +        ++N+     +         
Sbjct: 67  LNSTQPFQLL--ETSPQFIYQAQSGLTGRDGPDNPANGPRPLYNVEKDAYVLAEGQNELQ 124

Query: 156 IKLVFKNANNILFERTISL-DEHYLFKIVDTVTNNSIDQIRFSPRGRIMRH-------KP 207
           + + + +A    F +T  L    Y   +   V N     +  S  G++ +          
Sbjct: 125 VPMTYTDAAGNTFTKTFVLKRGDYAVNVNYNVQNAGEKPLEISSFGQLKQSITLPPHLDT 184

Query: 208 QTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSK 267
            ++        G      D +     +  I  +   N      W+ +  +Y+A+ +IP  
Sbjct: 185 GSSNFALHTFRGAAYSTPDAAYAAYAFDTIADNENLNISSKGGWVAMLQQYFATAWIPHN 244

Query: 268 ETSFHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAI 327
           + + +     L +G       + +  + + PG++    + L+ G +    +         
Sbjct: 245 DGTNNFYTANLGNG--IAAIGYKSQPVLVQPGQTGAMNSTLWVGPEIQDKMAAVA----- 297

Query: 328 PRFEMLIDWGWFYFIAKPMFM 348
           P  ++ +D+GW +FI++P+ +
Sbjct: 298 PHLDLTVDYGWLWFISQPLLV 318


>3bs6_A Inner membrane protein OXAA; YIDC/OXA1/ALB3 family, membrane insertion, chaperone, SEC translocon, periplasmic domain, beta supersandwich fold; HET: PG4 PGE 2PE; 1.80A {Escherichia coli} Length = 280 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target581 putative inner membrane protein translocase component Y
3blc_A330 Inner membrane protein OXAA; YIDC, membrane assembly fa 100.0
3bs6_A280 Inner membrane protein OXAA; YIDC/OXA1/ALB3 family, mem 100.0
3dcd_A307 Galactose mutarotase related enzyme; Q5FKD7 LAR33 NESG 97.31
3nre_A291 Aldose 1-epimerase; structural genomics, joint center f 96.82
2hta_A309 Putative enzyme related to aldose 1-epimerase; carbohyd 95.63
3os7_A341 Galactose mutarotase-like protein; structural genomics, 91.3
1nsx_A347 Galactose mutarotase; epimerase, galactose metabolism, 90.7
1snz_A344 Aldose 1-epimerase; mutarotase, galactosemia, isomerase 94.87
1lur_A339 Aldose 1-epimerase; vitamin B12, methyltransferase, str 94.09
3imh_A338 Galactose-1-epimerase; structural genomics, PSI-2, prot 93.48
3mwx_A326 Aldose 1-epimerase; structural genomics, joint center f 91.67
>3blc_A Inner membrane protein OXAA; YIDC, membrane assembly facilitator, chaperone, periplasmic domain, transmembrane, chaperone; 2.50A {Escherichia coli K12} Back     alignment and structure
Probab=100.00  E-value=2e-41  Score=319.26  Aligned_cols=277  Identities=16%  Similarity=0.306  Sum_probs=213.8

Q ss_pred             CCCCCEEEEECCEEEEEEECCCCEEEEEEECCCCCCCCCCCCCEEEECCCCCCCCCEEEEECCCCCC-CCCCCCCCCCEE
Q ss_conf             1458728997664999997699559999953571344788772688545666553100000134787-754333432100
Q gi|254780483|r   65 LSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTAN-NIELPNSNTVWN  143 (581)
Q Consensus        65 ~~~~~~I~Iend~l~i~is~~GG~I~~~~LK~Y~~~~~~ds~~v~Ll~~~~~~~~y~~~~G~~~~~~-~~~~p~~~~~~~  143 (581)
                      ..+++.|+||||+++++||++||+|++++||+|+...+++. ++.|++. +..+.|++.+|++.... +...+..++.|+
T Consensus        31 ~~~~~~itiend~~~~~~ss~GG~I~~~~Lk~y~~~~~~~~-~l~l~~~-~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~  108 (330)
T 3blc_A           31 SGQGKLISVKTDVLDLTINTRGGDVEQALLPAYPKELNSTQ-PFQLLET-SPQFIYQAQSGLTGRDGPDNPANGPRPLYN  108 (330)
T ss_dssp             --CCCEEEEECSSCEEEEETBTCCEEEEEEEEEESSTTCSS-EEEEEEE-CSSCEEEEEEEEESTTCTTSGGGCSCCBCB
T ss_pred             CCCCCEEEEECCCEEEEEECCCCEEEEEECCCCCCCCCCCC-CEEECCC-CCCCCEEEECCCCCCCCCCCCCCCCCCEEE
T ss_conf             67767799988849999989998897998778854447998-5375467-765430111253003686656777652044


Q ss_pred             CCCCCC----CCCCCCCEEEEECCCCEEEEEEEEEC-CCCEEEEEEEECCCCCCCCCCCCCEEEECCCCCC-----CCCC
Q ss_conf             156665----66666504774158842699999716-8835899986315766642224210120256865-----4442
Q gi|254780483|r  144 LISGKI----LTPTTPIKLVFKNANNILFERTISLD-EHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQT-----ATNT  213 (581)
Q Consensus       144 ~~~~~~----l~~~~~v~l~~~~~~g~~i~kt~t~~-~~Y~i~i~~~v~N~s~~~i~~~~~~~i~r~~~~~-----~~~~  213 (581)
                      ......    ..+...+++++.+++|+.++|+|+++ ++|+++++.+++|.+..++.+.++..+.+.....     ....
T Consensus       109 ~~~~~~~~~~~~~~~~v~~~~~~~~~~~i~k~y~~~~~~y~i~~~~~~~N~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  188 (330)
T 3blc_A          109 VEKDAYVLAEGQNELQVPMTYTDAAGNTFTKTFVLKRGDYAVNVNYNVQNAGEKPLEISSFGQLKQSITLPPHLDTGSSN  188 (330)
T ss_dssp             CSCSEEECCTTCCEEEEEEEEECTTSCEEEEEEEEETTCCEEEEEEEEECCSSSCEEEEEEEEEEEESSCCCCC------
T ss_pred             ECCCEEEECCCCCCCEEEEEEECCCCEEEEEEEEECCCCEEEEEEEEEECCCCCCCCCCCCCEECCCCCCCCCCCCCCCC
T ss_conf             13653672257877369999746996599999973698637999999851667764334101001346676556555553


Q ss_pred             C--CCCCCEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEECEEEEEEEECCCCCEEEEEEECCCCCCCEEEEEEC
Q ss_conf             0--01100000156543210013333333222332346357873110589996078984158998316766410222202
Q gi|254780483|r  214 F--GVQEGFIAVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSA  291 (581)
Q Consensus       214 ~--~~~~g~~~~~~d~~~~~~~~~d~~~~~~~~~~~~~~Wva~~qkYF~salIP~~~~~~~~~~~~~~~~~~~y~~~~~~  291 (581)
                      +  ..+.+......++..++..+++.++++.....++.+|+|++||||+++++|+++.........  ..+..+.+++..
T Consensus       189 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Wva~~~kYF~s~lip~~~~~~~~~~~~--~~~~~~~~~~~~  266 (330)
T 3blc_A          189 FALHTFRGAAYSTPDAAYAAYAFDTIADNENLNISSKGGWVAMLQQYFATAWIPHNDGTNNFYTAN--LGNGIAAIGYKS  266 (330)
T ss_dssp             ----CCEEEEEECSSCSSCEECHHHHHTTCCCEEEESSCEEEEEESSEEEEEEEESSSCEEEEEEE--EETTEEEEEEEC
T ss_pred             CEEEECCCCEEECCCCCCEEECCCCCCCCCCCCCCCCCCEEEEECCEEEEEEEECCCCCCEEEEEE--CCCCEEEEEEEC
T ss_conf             102321341277157651342244322123211025674587715657999931688741245540--689616999855


Q ss_pred             CCCCCCCCCEEEEEEEEEEECHHHHHHHHHHCCCCCCHHHHHHHHCCHHHHHHHHHHHH
Q ss_conf             44445788603678998850002788763220146310123332011035689999999
Q gi|254780483|r  292 NEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLM  350 (581)
Q Consensus       292 ~~~~i~pg~~~~~~~~lY~GPk~~~~L~~~~~~l~~~~l~~~vd~Gwf~~i~kplf~~L  350 (581)
                      +..+++||++.+.++++|+|||+|++|++++.+     ||++||||||+||+||||..+
T Consensus       267 ~~~~l~pg~~~~~~~~~Y~GPk~y~~L~~~~~~-----le~~id~GWf~fIakPlf~~~  320 (330)
T 3blc_A          267 QPVLVQPGQTGAMNSTLWVGPEIQDKMAAVAPH-----LDLTVDYGWLWFISQPLLVPR  320 (330)
T ss_dssp             CCEEECTTCEEEEEEEEEEEECCHHHHHHHSTT-----CCCHHHHHHHHHHTSCCCCCC
T ss_pred             CCEEECCCCEEEEEEEEEECCCCHHHHHHHHCC-----HHHEEECCCHHHHHHHHEEEC
T ss_conf             746878997478998999850819999866509-----211683421988543155066



>3bs6_A Inner membrane protein OXAA; YIDC/OXA1/ALB3 family, membrane insertion, chaperone, SEC translocon, periplasmic domain, beta supersandwich fold; HET: PG4 PGE 2PE; 1.80A {Escherichia coli} Back     alignment and structure
>3dcd_A Galactose mutarotase related enzyme; Q5FKD7 LAR33 NESG X-RAY, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.90A {Lactobacillus acidophilus} Back     alignment and structure
>3nre_A Aldose 1-epimerase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, isomerase; HET: MSE; 1.59A {Escherichia coli} Back     alignment and structure
>2hta_A Putative enzyme related to aldose 1-epimerase; carbohydrate, mutarotase, YEAD, GALM, sugar phosphate, isomerase; 1.90A {Salmonella typhimurium} PDB: 2htb_A Back     alignment and structure
>3os7_A Galactose mutarotase-like protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PG4 TLA; 1.80A {Clostridium acetobutylicum} Back     alignment and structure
>1nsx_A Galactose mutarotase; epimerase, galactose metabolism, isomerase; HET: GAL; 1.75A {Lactococcus lactis} SCOP: b.30.5.4 PDB: 1nsz_A* 1mmu_A* 1l7k_A* 1l7j_A* 1mmx_A* 1mmy_A* 1mmz_A* 1mn0_A* 1ns0_A* 1ns4_A* 1ns8_A* 1nsr_A* 1nsu_A* 1nsv_A* 1ns7_A* 1ns2_A* 1nsm_A* 1nss_A* Back     alignment and structure
>1snz_A Aldose 1-epimerase; mutarotase, galactosemia, isomerase; 2.20A {Homo sapiens} SCOP: b.30.5.4 PDB: 1so0_A* Back     alignment and structure
>1lur_A Aldose 1-epimerase; vitamin B12, methyltransferase, structural genomics, structure-based function assignment, decarboxylase, PSI; 1.85A {Caenorhabditis elegans} SCOP: b.30.5.4 Back     alignment and structure
>3imh_A Galactose-1-epimerase; structural genomics, PSI-2, protein structure initiative; 1.76A {Lactobacillus acidophilus ncfm} Back     alignment and structure
>3mwx_A Aldose 1-epimerase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, isomerase; HET: MSE; 1.45A {Bacillus subtilis} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target581 putative inner membrane protein translocase component Y
d1so0a_344 Galactose mutarotase {Human (Homo sapiens) [TaxId: 9606 92.96
>d1so0a_ b.30.5.4 (A:) Galactose mutarotase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: Supersandwich
superfamily: Galactose mutarotase-like
family: Aldose 1-epimerase (mutarotase)
domain: Galactose mutarotase
species: Human (Homo sapiens) [TaxId: 9606]
Probab=92.96  E-value=0.24  Score=24.89  Aligned_cols=28  Identities=18%  Similarity=0.232  Sum_probs=25.8

Q ss_pred             CEEEEECCEEEEEEECCCCEEEEEEECC
Q ss_conf             7289976649999976995599999535
Q gi|254780483|r   69 PRVELKNPSLIGSINLKGAQFDDLNLRG   96 (581)
Q Consensus        69 ~~I~Iend~l~i~is~~GG~I~~~~LK~   96 (581)
                      .+++|+|+.++++|.+.||.|.++.+++
T Consensus        22 ~~~tl~n~~l~v~i~~~GA~i~~l~~~d   49 (344)
T d1so0a_          22 EKFQLQSDLLRVDIISWGCTITALEVKD   49 (344)
T ss_dssp             EEEEEECSSCEEEEETBTTEEEEEEEEC
T ss_pred             EEEEEECCCEEEEEECCCCEEEEEEEEC
T ss_conf             9999986999999978690999999888



Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 581 putative inner membrane protein translocase compon
3blc_A_330 (A:) Inner membrane protein OXAA; YIDC, membrane a 6e-53
3bs6_A_280 (A:) Inner membrane protein OXAA; YIDC/OXA1/ALB3 f 1e-44
>3blc_A (A:) Inner membrane protein OXAA; YIDC, membrane assembly facilitator, chaperone, periplasmic domain, transmembrane, chaperone; 2.50A {Escherichia coli K12}Length = 330 Back     alignment and structure
 Score =  203 bits (517), Expect = 6e-53
 Identities = 54/337 (16%), Positives = 114/337 (33%), Gaps = 23/337 (6%)

Query: 38  KNIQTVKQPN-QVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRG 96
           KN Q   Q   Q   + A    D    A      + +K   L  +IN +G   +   L  
Sbjct: 3   KNPQPQAQQTTQTTTTAAGSAADQGVPASGQGKLISVKTDVLDLTINTRGGDVEQALLPA 62

Query: 97  YHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTA-NNIELPNSNTVWNLISGKILT---- 151
           Y  +++S  P   L +       Y A+         +        ++N+     +     
Sbjct: 63  YPKELNSTQPFQLLETSPQ--FIYQAQSGLTGRDGPDNPANGPRPLYNVEKDAYVLAEGQ 120

Query: 152 PTTPIKLVFKNANNILFERTISLDE-HYLFKIVDTVTNNSIDQIRFSPRGRIMRH----- 205
               +   + +A    F +T  L    Y   +   V N     +  S  G++ +      
Sbjct: 121 NELQVPXTYTDAAGNTFTKTFVLKRGDYAVNVNYNVQNAGEKPLEISSFGQLKQSITLPP 180

Query: 206 KPQTATNTFGVQEGFIAVLG--DKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVF 263
              T ++ F +     A     D +     +  I  +   N      W+    +Y+A+ +
Sbjct: 181 HLDTGSSNFALHTFRGAAYSTPDAAYAAYAFDTIADNENLNISSKGGWVAXLQQYFATAW 240

Query: 264 IPSKETSFHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEK 323
           IP  + + +     L +G       + +  + + PG++    + L+ G +          
Sbjct: 241 IPHNDGTNNFYTANLGNG--IAAIGYKSQPVLVQPGQTGAXNSTLWVGPEIQDKXAAVA- 297

Query: 324 DLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNF 360
               P  ++ +D+GW +FI++P+ +      +   + 
Sbjct: 298 ----PHLDLTVDYGWLWFISQPLLVPRGSLEHHHHHH 330


>3bs6_A (A:) Inner membrane protein OXAA; YIDC/OXA1/ALB3 family, membrane insertion, chaperone, SEC translocon, periplasmic domain, beta supersandwich fold; HET: PG4 PGE 2PE; 1.80A {Escherichia coli}Length = 280 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target581 putative inner membrane protein translocase component Y
3blc_A_330 Inner membrane protein OXAA; YIDC, membrane assemb 100.0
3bs6_A_280 Inner membrane protein OXAA; YIDC/OXA1/ALB3 family 100.0
3dcd_A_307 Galactose mutarotase related enzyme; Q5FKD7 LAR33 97.08
1snz_A_1-80_115-344310 Aldose 1-epimerase; mutarotase, galactosemia, isom 96.86
1lur_A_1-72_107-339305 Aldose 1-epimerase; vitamin B12, methyltransferase 96.24
1yga_A_1-65_100-342308 Hypothetical 37.9 kDa protein in BIO3-HXT17 interg 95.34
3imh_A_1-74_108-338305 Galactose-1-epimerase; structural genomics, PSI-2, 95.0
1z45_A_355-699345 GAL10 bifunctional protein; epimerase, mutarotase, 94.6
1jov_A_270 HI1317; hypothetical protein, structure 2 function 96.66
2hta_A_309 Putative enzyme related to aldose 1-epimerase; car 96.15
2cir_A_297 Hexose-6-phosphate mutarotase; mannose-6-phosphate 95.5
>3blc_A (A:) Inner membrane protein OXAA; YIDC, membrane assembly facilitator, chaperone, periplasmic domain, transmembrane, chaperone; 2.50A {Escherichia coli K12} Back     alignment and structure
Probab=100.00  E-value=0  Score=379.88  Aligned_cols=297  Identities=15%  Similarity=0.292  Sum_probs=245.3

Q ss_pred             CCCCCCCHHCCCCCCEEEEECCEEEEEEECCCCEEEEEEECCCCCCCCCCCCCEEEECCCCCCCCCEEEEECCCCCC-CC
Q ss_conf             66667610001458728997664999997699559999953571344788772688545666553100000134787-75
Q gi|254780483|r   55 AVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTAN-NI  133 (581)
Q Consensus        55 ~~~~~~~~~~~~~~~~I~Iend~l~i~is~~GG~I~~~~LK~Y~~~~~~ds~~v~Ll~~~~~~~~y~~~~G~~~~~~-~~  133 (581)
                      ............++++|+||||+++++||++||+|+++.||+|+.+.+++++++.+..  .....|++.+|++..++ +.
T Consensus        21 ~~~~~~~~~~~~~~~~i~v~nd~~~~~~s~~Gg~I~~~~Lk~yk~~~~~~~~~~l~~~--~~~~~~~~~~~~~~~~~~~~   98 (330)
T 3blc_A           21 GSAADQGVPASGQGKLISVKTDVLDLTINTRGGDVEQALLPAYPKELNSTQPFQLLET--SPQFIYQAQSGLTGRDGPDN   98 (330)
T ss_dssp             ------------CCCEEEEECSSCEEEEETBTCCEEEEEEEEEESSTTCSSEEEEEEE--CSSCEEEEEEEEESTTCTTS
T ss_pred             CCCCCCCCCCCCCCCEEEEECCCEEEEEECCCCEEEEEECCCCCCCCCCCCCEEECCC--CCCCCCEEEEEEECCCCCCC
T ss_conf             6654455666777668999888299999899988989884788654357885364257--77654125653311457665


Q ss_pred             CCCCCCCCEECCCCCCC----CCCCCCEEEEECCCCEEEEEEEEEC-CCCEEEEEEEECCCCCCCCCCCCCEEEECCCCC
Q ss_conf             43334321001566656----6666504774158842699999716-883589998631576664222421012025686
Q gi|254780483|r  134 ELPNSNTVWNLISGKIL----TPTTPIKLVFKNANNILFERTISLD-EHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQ  208 (581)
Q Consensus       134 ~~p~~~~~~~~~~~~~l----~~~~~v~l~~~~~~g~~i~kt~t~~-~~Y~i~i~~~v~N~s~~~i~~~~~~~i~r~~~~  208 (581)
                      ..+..++.|.+......    .++..++|+|.+++|++|+|+|+|+ ++|+++++++|+|.|..++.+.++..+.++..+
T Consensus        99 ~~~~~~~~~~~~~~~~~~~~~~~~~~vt~~~~~~~g~~i~k~yt~~~~~Y~i~~~~~v~n~s~~~~~~~~~~~~~~~~~~  178 (330)
T 3blc_A           99 PANGPRPLYNVEKDAYVLAEGQNELQVPXTYTDAAGNTFTKTFVLKRGDYAVNVNYNVQNAGEKPLEISSFGQLKQSITL  178 (330)
T ss_dssp             GGGCSCCBCBCSCSEEECCTTCCEEEEEEEEECTTSCEEEEEEEEETTCCEEEEEEEEECCSSSCEEEEEEEEEEEESSC
T ss_pred             CCCCCCCCEEECCCEEEECCCCCCCEEEEEEECCCCEEEEEEEEECCCCCEEEEEEEEECCCCCCCCCCCCEEEECCCCC
T ss_conf             57776520341376057304676517999994575389999999627862389999997156776433431143114667


Q ss_pred             CC-----CCC--CCCCCCEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEECEEEEEEEECCCCCEEEEEEECCCC
Q ss_conf             54-----442--00110000015654321001333333322233234635787311058999607898415899831676
Q gi|254780483|r  209 TA-----TNT--FGVQEGFIAVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDG  281 (581)
Q Consensus       209 ~~-----~~~--~~~~~g~~~~~~d~~~~~~~~~d~~~~~~~~~~~~~~Wva~~qkYF~salIP~~~~~~~~~~~~~~~~  281 (581)
                      ..     .+.  ...+.|++....++.+++.+++|++++......+..+|+|++||||++|+||+++..........  .
T Consensus       179 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~W~g~~~~YF~sa~ip~~~~~~~~~~~~~--~  256 (330)
T 3blc_A          179 PPHLDTGSSNFALHTFRGAAYSTPDAAYAAYAFDTIADNENLNISSKGGWVAXLQQYFATAWIPHNDGTNNFYTANL--G  256 (330)
T ss_dssp             CCCC----------CCEEEEEECSSCSSCEECHHHHHTTCCCEEEESSCEEEEEESSEEEEEEEESSSCEEEEEEEE--E
T ss_pred             CCCCCCCCCCCEEEECCCCEEECCCCCCEEECCCCCCCCCCCCCCCCCCHHHHHHCCHHEEEECCCCCCCEEEEEEC--C
T ss_conf             64444455541012113412772576512313232100133121234322123203203046037775411455406--8


Q ss_pred             CCCEEEEEECCCCCCCCCCEEEEEEEEEEECHHHHHHHHHHCCCCCCHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             6410222202444457886036789988500027887632201463101233320110356899999999887632016
Q gi|254780483|r  282 HARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNF  360 (581)
Q Consensus       282 ~~~y~~~~~~~~~~i~pg~~~~~~~~lY~GPk~~~~L~~~~~~l~~~~l~~~vd~Gwf~~i~kplf~~L~~l~~~i~Ny  360 (581)
                      .+.|.+++..+..+++||++.+.++++|+|||+|++|++++++|     |++||||||+||+|||||+|+|||++||||
T Consensus       257 ~~~~~~~~~~~~~~i~pg~~~~~~~~~Y~GPk~~~~L~~~~~~l-----~~~id~Gwf~~iakpl~~lL~~l~~~vgNw  330 (330)
T 3blc_A          257 NGIAAIGYKSQPVLVQPGQTGAXNSTLWVGPEIQDKXAAVAPHL-----DLTVDYGWLWFISQPLLVPRGSLEHHHHHH  330 (330)
T ss_dssp             TTEEEEEEECCCEEECTTCEEEEEEEEEEEECCHHHHHHHSTTC-----CCHHHHHHHHHHTSCCCCCCCC--------
T ss_pred             CCEEEEEEECCCEEECCCCEEEEEEEEEECCCCHHHHHHHHCCH-----HEEEECCCHHHHHCCCEEECCHHCCCCCCC
T ss_conf             96269998657468789974789989997608199998665192-----007854308874200140552001444579



>3bs6_A (A:) Inner membrane protein OXAA; YIDC/OXA1/ALB3 family, membrane insertion, chaperone, SEC translocon, periplasmic domain, beta supersandwich fold; HET: PG4 PGE 2PE; 1.80A {Escherichia coli} Back     alignment and structure
>3dcd_A (A:) Galactose mutarotase related enzyme; Q5FKD7 LAR33 NESG X-RAY, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.90A {Lactobacillus acidophilus} Back     alignment and structure
>1snz_A (A:1-80,A:115-344) Aldose 1-epimerase; mutarotase, galactosemia, isomerase; 2.20A {Homo sapiens} Back     alignment and structure
>1lur_A (A:1-72,A:107-339) Aldose 1-epimerase; vitamin B12, methyltransferase, structural genomics, structure-based function assignment, decarboxylase, PSI; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>1yga_A (A:1-65,A:100-342) Hypothetical 37.9 kDa protein in BIO3-HXT17 intergenic region; aldose_1_epimerase, sugar metabolism, predicted, structural genomics; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3imh_A (A:1-74,A:108-338) Galactose-1-epimerase; structural genomics, PSI-2, protein structure initiative; 1.76A {Lactobacillus acidophilus ncfm} Back     alignment and structure
>1z45_A (A:355-699) GAL10 bifunctional protein; epimerase, mutarotase, metabolism, , isomerase; HET: GAL NAD GUD; 1.85A {Saccharomyces cerevisiae} Back     alignment and structure
>1jov_A (A:) HI1317; hypothetical protein, structure 2 function project, S2F, structural genomics, unknown function; 1.57A {Haemophilus influenzae} Back     alignment and structure
>2hta_A (A:) Putative enzyme related to aldose 1-epimerase; carbohydrate, mutarotase, YEAD, GALM, sugar phosphate, isomerase; 1.90A {Salmonella typhimurium} PDB: 2htb_A Back     alignment and structure
>2cir_A (A:) Hexose-6-phosphate mutarotase; mannose-6-phosphate-1-epimerase, galactose-6-phosphate-1- epimerase, hypothetical protein, isomerase; HET: BG6; 1.6A {Saccharomyces cerevisiae} PDB: 2ciq_A* 2cis_A* Back     alignment and structure