254780485

254780485

biotin synthase

GeneID in NCBI database:8209474Locus tag:CLIBASIA_01860
Protein GI in NCBI database:254780485Protein Accession:YP_003064898.1
Gene range:+(407548, 408534)Protein Length:328aa
Gene description:biotin synthase
COG prediction:[H] Biotin synthase and related enzymes
KEGG prediction:biotin synthase; K01012 biotin synthetase [EC:2.8.1.6]
SEED prediction:Biotin synthase (EC 2.8.1.6)
Pathway involved in KEGG:Biotin metabolism [PATH:las00780]
Subsystem involved in SEED:Biotin biosynthesis
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------33
MSRSTVVPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILFNRLGLIPDLSA
ccHHHHHHHHHHHcccccccHHHHHHHHcccHHHHHHHHHHHHHHcccccEEEEEEEEEEcccccccccccccccccccccccccccccHHHHHHHHHHHHHccccEEEEEcccccccccHHHHHHHHHHHHHHcccEEEEEcccccHHHHHHHHHccccEEEEEcccHHHHHHHHcccccHHHHHHHHHHHHHcccccEEEEEEcccccHHHHHHHHHHHHHcccccEEEEEEEEcccccccccccccccHHHHHHHHHHHHHHccccccEEcccHHHccHHHHHHHHHHcccEEEEcccccccccccHHHHHHHHHHccccHHHcc
ccEEEEccccccccccccccHHHHHHHHHccHHHHHHHHHHHHHHccccccEEEEEEEEEcccccHHHcccccccHHccccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHccccHHHHcccccHHHHHHHHHcccccccccccccHHHcccEEEcccHHHHHHHHHHHHHcccEEccccEEcccccHHHHHHHHHHHHccccccccccHHHEEEcccccccccccccHHHHHHHHHHHHHHccccHHHHHccHHHHHHHHHHHHHHHccccEEEccEcccccccccHHHHHHHHHHcccccccc
msrstvvpeenptkkpkvwtsKEVFQiynmpfndllFWSHtvhrknfepnhiQLSKLlniktggcpencgycnqsvhnksklkasklINVDQVLKEAKNAkengatrycmgaawrepkerDLSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLdyynhnidtserfyphvttthTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLanlstppesipinllipipgskfeenkkvdpiehVRIISVARILMPKSRLRLAAGRAMMSDELQALCFfsgansifvgdtlltaknpsynkdtilfnrlglipdlsa
msrstvvpeenptkkpkvwtsKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEaknakengatrycmgaawrepkerdLSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSkfeenkkvdpiehvriisvarilmpKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAknpsynkdtilfnrlglipdlsa
MSRSTVVPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILFNRLGLIPDLSA
*****************VWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVH****L****LINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILFNRLGLIPD***
****************KVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILFNRLGLIPDLSA
*SRSTVVPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILFNRLGLI*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSRSTVVPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILFNRLGLIPDLSA
MSRSTVVPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILFNRLGLIPDLSA
MSRSTVVPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILFNRLGLIPDLSA

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target328 biotin synthase [Candidatus Liberibacter asiaticus str.
315122058328 biotin synthase [Candidatus Liberibacter solanacearum C 1 1e-169
153010147336 biotin synthase [Ochrobactrum anthropi ATCC 49188] Leng 1 1e-128
239833335336 biotin synthase [Ochrobactrum intermedium LMG 3301] Len 1 1e-127
306845848346 biotin synthase [Brucella sp. BO1] Length = 346 1 1e-126
306840591346 biotin synthase [Brucella sp. BO2] Length = 346 1 1e-125
254720489346 biotin synthase [Brucella sp. 83/13] Length = 346 1 1e-125
227823052339 biotin synthase BioB [Sinorhizobium fredii NGR234] Leng 1 1e-125
260544874342 BioB protein [Brucella abortus NCTC 8038] Length = 342 1 1e-124
17989120346 biotin synthase [Brucella melitensis bv. 1 str. 16M] Le 1 1e-124
148558280346 biotin synthase [Brucella ovis ATCC 25840] Length = 346 1 1e-124
>gi|315122058|ref|YP_004062547.1| biotin synthase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 328 Back     alignment and organism information
 Score =  598 bits (1542), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 282/327 (86%), Positives = 306/327 (93%)

Query: 1   MSRSTVVPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNI 60
           M +S    ++    KPK WT KEV QIY MPFNDLLFWSHTVHRKNFEPNHIQLSKLLNI
Sbjct: 1   MCKSNATSKKECDNKPKTWTFKEVLQIYQMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNI 60

Query: 61  KTGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKER 120
           KTGGCPE+CGYCNQSVHNK+KLKASKL++VDQVLKEA+ AKENGATRYCMGAAWREPK+R
Sbjct: 61  KTGGCPEDCGYCNQSVHNKTKLKASKLLDVDQVLKEAQLAKENGATRYCMGAAWREPKKR 120

Query: 121 DLSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTH 180
           D+++IVDMI+GVKSLGLETCMTLGMLS EQAQ LS+AGLDYYNHNIDTSERFYP+V TTH
Sbjct: 121 DIAVIVDMIRGVKSLGLETCMTLGMLSSEQAQELSEAGLDYYNHNIDTSERFYPNVITTH 180

Query: 181 TFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIP 240
           TFE+RLQTLENVRKSGIKVCCGGILGLGE  DDRIDML+TLANL+TPPESIPINLLIPIP
Sbjct: 181 TFENRLQTLENVRKSGIKVCCGGILGLGETTDDRIDMLITLANLATPPESIPINLLIPIP 240

Query: 241 GSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGD 300
           GSKF ENKKVDPIE+VRII+VARILMPKSRLRLAAGR MMSDELQALCFFSGANSIFVGD
Sbjct: 241 GSKFSENKKVDPIEYVRIIAVARILMPKSRLRLAAGRVMMSDELQALCFFSGANSIFVGD 300

Query: 301 TLLTAKNPSYNKDTILFNRLGLIPDLS 327
           TLLTAKNP+YNKDTILF+RLGL+PDL+
Sbjct: 301 TLLTAKNPNYNKDTILFDRLGLMPDLN 327


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|153010147|ref|YP_001371361.1| biotin synthase [Ochrobactrum anthropi ATCC 49188] Length = 336 Back     alignment and organism information
>gi|239833335|ref|ZP_04681663.1| biotin synthase [Ochrobactrum intermedium LMG 3301] Length = 336 Back     alignment and organism information
>gi|306845848|ref|ZP_07478416.1| biotin synthase [Brucella sp. BO1] Length = 346 Back     alignment and organism information
>gi|306840591|ref|ZP_07473346.1| biotin synthase [Brucella sp. BO2] Length = 346 Back     alignment and organism information
>gi|254720489|ref|ZP_05182300.1| biotin synthase [Brucella sp. 83/13] Length = 346 Back     alignment and organism information
>gi|227823052|ref|YP_002827024.1| biotin synthase BioB [Sinorhizobium fredii NGR234] Length = 339 Back     alignment and organism information
>gi|260544874|ref|ZP_05820695.1| BioB protein [Brucella abortus NCTC 8038] Length = 342 Back     alignment and organism information
>gi|17989120|ref|NP_541753.1| biotin synthase [Brucella melitensis bv. 1 str. 16M] Length = 346 Back     alignment and organism information
>gi|148558280|ref|YP_001257466.1| biotin synthase [Brucella ovis ATCC 25840] Length = 346 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target328 biotin synthase [Candidatus Liberibacter asiaticus str.
PRK15108345 PRK15108, PRK15108, biotin synthase; Provisional 1e-118
PLN02389379 PLN02389, PLN02389, biotin synthase 1e-112
TIGR00433296 TIGR00433, bioB, biotin synthetase 1e-109
KOG2900380 KOG2900, KOG2900, KOG2900, Biotin synthase [Coenzyme tr 6e-99
PRK06256336 PRK06256, PRK06256, biotin synthase; Validated 2e-83
COG0502335 COG0502, BioB, Biotin synthase and related enzymes [Coe 1e-113
PRK08508279 PRK08508, PRK08508, biotin synthase; Provisional 4e-58
COG1060370 COG1060, ThiH, Thiamine biosynthesis enzyme ThiH and re 7e-15
smart00729216 smart00729, Elp3, Elongator protein 3, MiaB family, Rad 4e-30
cd01335204 cd01335, Radical_SAM, Radical SAM superfamily 4e-15
PRK07094323 PRK07094, PRK07094, biotin synthase; Provisional 4e-08
COG1032490 COG1032, COG1032, Fe-S oxidoreductase [Energy productio 1e-06
TIGR03550322 TIGR03550, F420_cofG, 7,8-didemethyl-8-hydroxy-5-deazar 8e-05
PRK09240371 PRK09240, thiH, thiamine biosynthesis protein ThiH; Rev 1e-04
PRK06245336 PRK06245, cofG, FO synthase subunit 1; Reviewed 1e-04
TIGR02351366 TIGR02351, thiH, thiazole biosynthesis protein ThiH 2e-04
COG1180260 COG1180, PflA, Pyruvate-formate lyase-activating enzyme 0.003
smart0087694 smart00876, BATS, Biotin and Thiamin Synthesis associat 3e-28
pfam0696893 pfam06968, BATS, Biotin and Thiamin Synthesis associate 5e-26
pfam04055165 pfam04055, Radical_SAM, Radical SAM superfamily 4e-19
COG0320306 COG0320, LipA, Lipoate synthase [Coenzyme metabolism] 3e-06
TIGR00510302 TIGR00510, lipA, lipoate synthase 3e-06
TIGR01212302 TIGR01212, TIGR01212, radical SAM protein, TIGR01212 fa 7e-05
PRK12928290 PRK12928, PRK12928, lipoyl synthase; Provisional 8e-05
PRK05481289 PRK05481, PRK05481, lipoyl synthase; Provisional 5e-04
KOG2672360 KOG2672, KOG2672, KOG2672, Lipoate synthase [Coenzyme t 8e-04
COG1242312 COG1242, COG1242, Predicted Fe-S oxidoreductase [Genera 0.001
COG1856275 COG1856, COG1856, Uncharacterized homolog of biotin syn 7e-06
>gnl|CDD|185063 PRK15108, PRK15108, biotin synthase; Provisional Back     alignment and domain information
>gnl|CDD|178013 PLN02389, PLN02389, biotin synthase Back     alignment and domain information
>gnl|CDD|161876 TIGR00433, bioB, biotin synthetase Back     alignment and domain information
>gnl|CDD|38111 KOG2900, KOG2900, KOG2900, Biotin synthase [Coenzyme transport and metabolism] Back     alignment and domain information
>gnl|CDD|180492 PRK06256, PRK06256, biotin synthase; Validated Back     alignment and domain information
>gnl|CDD|30848 COG0502, BioB, Biotin synthase and related enzymes [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|181453 PRK08508, PRK08508, biotin synthase; Provisional Back     alignment and domain information
>gnl|CDD|31260 COG1060, ThiH, Thiamine biosynthesis enzyme ThiH and related uncharacterized enzymes [Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|128968 smart00729, Elp3, Elongator protein 3, MiaB family, Radical SAM Back     alignment and domain information
>gnl|CDD|100105 cd01335, Radical_SAM, Radical SAM superfamily Back     alignment and domain information
>gnl|CDD|180835 PRK07094, PRK07094, biotin synthase; Provisional Back     alignment and domain information
>gnl|CDD|31235 COG1032, COG1032, Fe-S oxidoreductase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|132589 TIGR03550, F420_cofG, 7,8-didemethyl-8-hydroxy-5-deazariboflavin synthase, CofG subunit Back     alignment and domain information
>gnl|CDD|181720 PRK09240, thiH, thiamine biosynthesis protein ThiH; Reviewed Back     alignment and domain information
>gnl|CDD|180485 PRK06245, cofG, FO synthase subunit 1; Reviewed Back     alignment and domain information
>gnl|CDD|131404 TIGR02351, thiH, thiazole biosynthesis protein ThiH Back     alignment and domain information
>gnl|CDD|31373 COG1180, PflA, Pyruvate-formate lyase-activating enzyme [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|129109 smart00876, BATS, Biotin and Thiamin Synthesis associated domain Back     alignment and domain information
>gnl|CDD|148534 pfam06968, BATS, Biotin and Thiamin Synthesis associated domain Back     alignment and domain information
>gnl|CDD|146602 pfam04055, Radical_SAM, Radical SAM superfamily Back     alignment and domain information
>gnl|CDD|30668 COG0320, LipA, Lipoate synthase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|161907 TIGR00510, lipA, lipoate synthase Back     alignment and domain information
>gnl|CDD|130279 TIGR01212, TIGR01212, radical SAM protein, TIGR01212 family Back     alignment and domain information
>gnl|CDD|183830 PRK12928, PRK12928, lipoyl synthase; Provisional Back     alignment and domain information
>gnl|CDD|180115 PRK05481, PRK05481, lipoyl synthase; Provisional Back     alignment and domain information
>gnl|CDD|37883 KOG2672, KOG2672, KOG2672, Lipoate synthase [Coenzyme transport and metabolism] Back     alignment and domain information
>gnl|CDD|31435 COG1242, COG1242, Predicted Fe-S oxidoreductase [General function prediction only] Back     alignment and domain information
>gnl|CDD|32041 COG1856, COG1856, Uncharacterized homolog of biotin synthetase [Function unknown] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 328 biotin synthase [Candidatus Liberibacter asiaticus str.
PRK06256325 biotin synthase; Validated 100.0
COG0502335 BioB Biotin synthase and related enzymes [Coenzyme meta 100.0
PRK08444353 hypothetical protein; Provisional 100.0
TIGR00433350 bioB biotin synthase; InterPro: IPR002684 Biotin syntha 100.0
PRK07094323 biotin synthase; Provisional 100.0
PRK05927350 hypothetical protein; Provisional 100.0
PRK07360375 FO synthase subunit 2; Reviewed 100.0
PRK08445348 hypothetical protein; Provisional 100.0
PRK05926371 hypothetical protein; Provisional 100.0
PRK09234846 fbiC FO synthase; Reviewed 100.0
TIGR03551343 F420_cofH 7,8-didemethyl-8-hydroxy-5-deazariboflavin sy 100.0
COG1060370 ThiH Thiamine biosynthesis enzyme ThiH and related unch 100.0
KOG2900380 consensus 100.0
PRK09240371 thiH thiamine biosynthesis protein ThiH; Reviewed 100.0
TIGR02351378 thiH thiazole biosynthesis protein ThiH; InterPro: IPR0 100.0
PRK09613471 thiH thiamine biosynthesis protein ThiH; Reviewed 100.0
PRK09234 846 fbiC FO synthase; Reviewed 100.0
PRK08508279 biotin synthase; Provisional 100.0
TIGR00423331 TIGR00423 conserved hypothetical protein TIGR00423; Int 100.0
TIGR03550322 F420_cofG 7,8-didemethyl-8-hydroxy-5-deazariboflavin sy 100.0
PRK06245336 cofG FO synthase subunit 1; Reviewed 100.0
TIGR00539371 hemN_rel putative oxygen-independent coproporphyrinogen 99.2
TIGR00538462 hemN oxygen-independent coproporphyrinogen III oxidase; 98.85
PRK11194372 hypothetical protein; Provisional 98.52
PRK06267324 hypothetical protein; Provisional 100.0
TIGR01212307 TIGR01212 radical SAM protein, TIGR01212 family; InterP 99.72
COG1242312 Predicted Fe-S oxidoreductase [General function predict 99.53
TIGR02026506 BchE magnesium-protoporphyrin IX monomethyl ester anaer 99.21
COG2108353 Uncharacterized conserved protein related to pyruvate f 99.09
TIGR01211 573 ELP3 histone acetyltransferase, ELP3 family; InterPro: 98.05
PRK05481289 lipoyl synthase; Provisional 99.83
COG0320306 LipA Lipoate synthase [Coenzyme metabolism] 99.83
cd01335204 Radical_SAM Radical SAM superfamily. Enzymes of this fa 99.83
smart00729216 Elp3 Elongator protein 3, MiaB family, Radical SAM. Thi 99.82
PRK12928290 lipoyl synthase; Provisional 99.82
TIGR03471472 HpnJ hopanoid biosynthesis associated radical SAM prote 99.8
) of Arabidopsis thaliana (Mouse-ear cress), mammalian Gephryin (e.g. Q9NQX3 from SWISSPROT) and Drosophila melanogaster (Fruit fly) Cinnamon (P39205 from SWISSPROT) . This entry represents the bacterial form of MoaA (molybdenum cofactor biosynthesis protein A). The MoaA protein is a member of the wider S-adenosylmethionine(SAM)-dependent enzyme family which catalyze the formation of protein and/or substrate radicals by reductive cleavage of SAM via a [4Fe-4S] cluster. Monomeric and homodimeric forms of MoaA have been observed in vivo, and it is not clear what the physiologically relevant form of the enzyme is . The core of each monomer consists of an incomplete TIM barrel, formed by the N-terminal region of the protein, containing a [4Fe-4S] cluster. The C-terminal region of the protein, which also contains a [4Fe-4S] cluster consists of a beta-sheet covering the lateral opening of the barrel, an extended loop and three alpha helices. The N-terminal [4Fe-4S] cluster is coordinated with 3 cysteines and an exchangeable SAM molecule, while the C-terminal [4Fe-4S], also coordinated with 3 cysteines, is the binding and activation site for GTP .; GO: 0046872 metal ion binding, 0006777 Mo-molybdopterin cofactor biosynthetic process." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR02666">TIGR02666346 moaA molybdenum cofactor biosynthesis protein A; InterP 99.73
PRK13361329 molybdenum cofactor biosynthesis protein A; Provisional 99.7
PRK00164334 moaA molybdenum cofactor biosynthesis protein A; Review 99.68
PRK08208 436 coproporphyrinogen III oxidase; Validated 99.62
COG2516339 Biotin synthase-related enzyme [General function predic 99.62
PRK05904353 coproporphyrinogen III oxidase; Provisional 99.61
PRK08599377 coproporphyrinogen III oxidase; Provisional 99.61
PRK05799374 coproporphyrinogen III oxidase; Provisional 99.59
COG2896322 MoaA Molybdenum cofactor biosynthesis enzyme [Coenzyme 99.58
PRK07379399 coproporphyrinogen III oxidase; Provisional 99.58
PRK05628376 coproporphyrinogen III oxidase; Validated 99.57
PRK05660378 coproporphyrinogen III oxidase; Provisional 99.57
PRK09058 447 coproporphyrinogen III oxidase; Provisional 99.57
PRK08807385 consensus 99.56
COG1032490 Fe-S oxidoreductase [Energy production and conversion] 99.56
PRK06582390 coproporphyrinogen III oxidase; Provisional 99.55
PRK08949378 consensus 99.54
PRK09057381 coproporphyrinogen III oxidase; Provisional 99.53
PRK06294374 coproporphyrinogen III oxidase; Provisional 99.53
PRK08446351 coproporphyrinogen III oxidase; Provisional 99.52
PRK13347 453 coproporphyrinogen III oxidase; Provisional 99.49
TIGR00089455 TIGR00089 RNA modification enzyme, MiaB family; InterPr 99.48
PRK08898393 coproporphyrinogen III oxidase; Provisional 99.48
COG0621437 MiaB 2-methylthioadenine synthetase [Translation, ribos 99.47
PRK09249 456 coproporphyrinogen III oxidase; Provisional 99.47
PRK05301375 pyrroloquinoline quinone biosynthesis protein PqqE; Pro 99.46
KOG2672360 consensus 99.45
COG0635416 HemN Coproporphyrinogen III oxidase and related Fe-S ox 99.43
PRK08629 424 coproporphyrinogen III oxidase; Provisional 99.37
TIGR01574456 miaB-methiolase tRNA-i(6)A37 thiotransferase enzyme Mia 99.28
TIGR00510310 lipA lipoic acid synthetase; InterPro: IPR003698 Lipoic 99.25
TIGR01125475 TIGR01125 MiaB-like tRNA modifying enzyme YliG, TIGR011 99.19
TIGR01578487 MiaB-like-B MiaB-like tRNA modifying enzyme, archaeal-t 99.15
COG2100414 Predicted Fe-S oxidoreductase [General function predict 99.15
TIGR01579492 MiaB-like-C MiaB-like tRNA modifying enzyme; InterPro: 99.12
COG1243 515 ELP3 Histone acetyltransferase [Transcription / Chromat 99.02
COG0535347 Predicted Fe-S oxidoreductases [General function predic 99.0
COG4277404 Predicted DNA-binding protein with the Helix-hairpin-he 98.95
TIGR02109363 PQQ_syn_pqqE coenzyme PQQ biosynthesis protein E; Inter 98.88
PRK11145246 pflA pyruvate formate lyase-activating enzyme 1; Provis 98.82
COG1180260 PflA Pyruvate-formate lyase-activating enzyme [Posttran 98.77
COG0641378 AslB Arylsulfatase regulator (Fe-S oxidoreductase) [Gen 98.71
COG0731296 Fe-S oxidoreductases [Energy production and conversion] 98.7
TIGR02493243 PFLA pyruvate formate-lyase 1-activating enzyme; InterP 98.68
TIGR01290 461 nifB nitrogenase cofactor biosynthesis protein NifB; In 98.62
KOG4355547 consensus 98.52
COG1031560 Uncharacterized Fe-S oxidoreductase [Energy production 98.49
COG1509369 KamA Lysine 2,3-aminomutase [Amino acid transport and m 98.42
PRK01254742 hypothetical protein; Provisional 98.36
KOG2876323 consensus 98.27
PRK00955599 hypothetical protein; Provisional 98.24
COG0820349 Predicted Fe-S-cluster redox enzyme [General function p 98.11
COG1313335 PflX Uncharacterized Fe-S protein PflX, homolog of pyru 97.98
COG1244358 Predicted Fe-S oxidoreductase [General function predict 97.88
PRK10076213 pyruvate formate lyase II activase; Provisional 97.79
TIGR00048378 TIGR00048 radical SAM enzyme, Cfr family; InterPro: IPR 97.78
COG5014228 Predicted Fe-S oxidoreductase [General function predict 97.51
PRK13762321 tRNA-modifying enzyme; Provisional 97.24
COG1625 414 Fe-S oxidoreductase, related to NifB/MoaA family [Energ 96.49
TIGR02494305 PFLE_PFLC glycyl-radical enzyme activating protein fami 95.82
pfam0696893 BATS Biotin and Thiamin Synthesis associated domain. Bi 99.81
smart0087694 BATS Biotin and Thiamin Synthesis associated domain. Bi 99.76
COG1856275 Uncharacterized homolog of biotin synthetase [Function 99.76
KOG2492552 consensus 98.19
PRK08207497 coproporphyrinogen III oxidase; Provisional 99.73
TIGR02668324 moaA_archaeal probable molybdenum cofactor biosynthesis 99.64
pfam04055165 Radical_SAM Radical SAM superfamily. Radical SAM protei 99.57
TIGR03470318 HpnH hopanoid biosynthesis associated radical SAM prote 99.4
PRK13758370 anaerobic sulfatase-maturase; Provisional 98.96
PRK13745 412 anaerobic sulfatase-maturase; Provisional 98.44
TIGR02495220 NrdG2 anaerobic ribonucleoside-triphosphate reductase a 98.21
COG1533297 SplB DNA repair photolyase [DNA replication, recombinat 98.03
TIGR03279433 cyano_FeS_chp putative FeS-containing Cyanobacterial-sp 96.2
COG1964 475 Predicted Fe-S oxidoreductases [General function predic 93.23
PRK08195337 4-hydroxy-2-ketovalerate aldolase; Validated 98.45
TIGR03217333 4OH_2_O_val_ald 4-hydroxy-2-oxovalerate aldolase. Membe 98.42
pfam00682237 HMGL-like HMGL-like. This family contains a diverse set 98.3
PRK05692287 hydroxymethylglutaryl-CoA lyase; Provisional 97.85
pfam05853274 DUF849 Prokaryotic protein of unknown function (DUF849) 97.27
PRK11858 378 aksA trans-homoaconitate synthase; Reviewed 96.19
PRK05211248 consensus 95.51
PRK03220257 consensus 95.25
PRK13597252 imidazole glycerol phosphate synthase subunit HisF; Pro 95.15
PRK07028429 bifunctional hexulose-6-phosphate synthase/ribonuclease 94.6
COG0119 409 LeuA Isopropylmalate/homocitrate/citramalate synthases 94.28
KOG3111224 consensus 94.26
PRK04281254 consensus 94.0
PRK02747257 consensus 93.82
TIGR02660 369 nifV_homocitr homocitrate synthase; InterPro: IPR013477 93.76
PRK09140206 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; Review 93.65
PRK13585240 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylid 93.1
PRK05581220 ribulose-phosphate 3-epimerase; Validated 93.05
PRK01659252 consensus 92.62
PRK02621254 consensus 91.64
cd00429211 RPE Ribulose-5-phosphate 3-epimerase (RPE). This enzyme 91.54
PRK12595360 bifunctional 3-deoxy-7-phosphoheptulonate synthase/chor 91.42
PRK08745223 ribulose-phosphate 3-epimerase; Provisional 91.36
PRK08005210 ribulose-phosphate 3-epimerase; Validated 91.19
PTZ00170224 D-ribulose-5-phosphate 3-epimerase; Provisional 90.47
TIGR03278 404 methan_mark_10 putative methanogenesis marker protein 1 97.38
cd00003234 PNPsynthase Pyridoxine 5'-phosphate (PNP) synthase doma 95.62
PRK05265240 pyridoxine 5'-phosphate synthase; Provisional 95.15
pfam03740239 PdxJ Pyridoxal phosphate biosynthesis protein PdxJ. Mem 95.04
TIGR00676302 fadh2 5,10-methylenetetrahydrofolate reductase; InterPr 94.4
TIGR01302476 IMP_dehydrog inosine-5'-monophosphate dehydrogenase; In 94.14
pfam05913357 DUF871 Bacterial protein of unknown function (DUF871). 92.1
PRK11613282 folP dihydropteroate synthase; Provisional 91.21
TIGR00559265 pdxJ pyridoxal phosphate biosynthetic protein PdxJ; Int 90.2
COG0854243 PdxJ Pyridoxal phosphate biosynthesis protein [Coenzyme 90.08
pfam10113 505 Fibrillarin_2 Fibrillarin-like archaeal protein. Member 97.02
COG4018 505 Uncharacterized protein conserved in archaea [Function 95.72
TIGR03365238 Bsubt_queE 7-cyano-7-deazaguanosine (preQ0) biosynthesi 96.7
COG0602212 NrdG Organic radical activating enzymes [Posttranslatio 95.79
KOG4039238 consensus 92.48
PRK00915 511 2-isopropylmalate synthase; Validated 96.54
PRK09389 487 (R)-citramalate synthase; Provisional 95.7
pfam00478467 IMPDH IMP dehydrogenase / GMP reductase domain. This fa 95.36
PRK00507221 deoxyribose-phosphate aldolase; Provisional 94.85
cd04739325 DHOD_like Dihydroorotate dehydrogenase (DHOD) like prot 93.63
PRK07565333 dihydroorotate dehydrogenase 2; Reviewed 91.51
KOG2550503 consensus 92.85
KOG2535 554 consensus 91.37
PRK12331463 oxaloacetate decarboxylase; Provisional 90.76
PRK07807479 inositol-5-monophosphate dehydrogenase; Validated 92.75
PTZ00314499 inosine-5'-monophosphate dehydrogenase; Provisional 92.29
>PRK06256 biotin synthase; Validated Back     alignment and domain information
>COG0502 BioB Biotin synthase and related enzymes [Coenzyme metabolism] Back     alignment and domain information
>PRK08444 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00433 bioB biotin synthase; InterPro: IPR002684 Biotin synthase 2 Back     alignment and domain information
>PRK07094 biotin synthase; Provisional Back     alignment and domain information
>PRK05927 hypothetical protein; Provisional Back     alignment and domain information
>PRK07360 FO synthase subunit 2; Reviewed Back     alignment and domain information
>PRK08445 hypothetical protein; Provisional Back     alignment and domain information
>PRK05926 hypothetical protein; Provisional Back     alignment and domain information
>PRK09234 fbiC FO synthase; Reviewed Back     alignment and domain information
>TIGR03551 F420_cofH 7,8-didemethyl-8-hydroxy-5-deazariboflavin synthase, CofH subunit Back     alignment and domain information
>COG1060 ThiH Thiamine biosynthesis enzyme ThiH and related uncharacterized enzymes [Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>KOG2900 consensus Back     alignment and domain information
>PRK09240 thiH thiamine biosynthesis protein ThiH; Reviewed Back     alignment and domain information
>TIGR02351 thiH thiazole biosynthesis protein ThiH; InterPro: IPR012726 Members of this protein family are the ThiH proteins involved in thiamine biosynthesis Back     alignment and domain information
>PRK09613 thiH thiamine biosynthesis protein ThiH; Reviewed Back     alignment and domain information
>PRK09234 fbiC FO synthase; Reviewed Back     alignment and domain information
>PRK08508 biotin synthase; Provisional Back     alignment and domain information
>TIGR00423 TIGR00423 conserved hypothetical protein TIGR00423; InterPro: IPR005244 This entry describes a family of conserved hypothetical proteins with no known function Back     alignment and domain information
>TIGR03550 F420_cofG 7,8-didemethyl-8-hydroxy-5-deazariboflavin synthase, CofG subunit Back     alignment and domain information
>PRK06245 cofG FO synthase subunit 1; Reviewed Back     alignment and domain information
>TIGR00539 hemN_rel putative oxygen-independent coproporphyrinogen III oxidase; InterPro: IPR004559 Experimentally determined examples of oxygen-independent coproporphyrinogen III oxidase, an enzyme that replaces HemF function under anaerobic conditions, belong to a family of proteins called HemN (IPR004558 from INTERPRO) Back     alignment and domain information
>TIGR00538 hemN oxygen-independent coproporphyrinogen III oxidase; InterPro: IPR004558 This family represents HemN, the oxygen-independent coproporphyrinogen III oxidase that replaces HemF function under anaerobic conditions Back     alignment and domain information
>PRK11194 hypothetical protein; Provisional Back     alignment and domain information
>PRK06267 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01212 TIGR01212 radical SAM protein, TIGR01212 family; InterPro: IPR005911 This uncharacterised protein family shows significant similarity to IPR005910 from INTERPRO, a longer protein that is a histone acetyltransferase at its C-terminus and is a subunit of RNA polymerase II (in yeast) Back     alignment and domain information
>COG1242 Predicted Fe-S oxidoreductase [General function prediction only] Back     alignment and domain information
>TIGR02026 BchE magnesium-protoporphyrin IX monomethyl ester anaerobic oxidative cyclase; InterPro: IPR011772 This entry respresents the cobalamin-dependent oxidative cyclase responsible for forming the distinctive E-ring of the chlorin ring system under anaerobic conditions Back     alignment and domain information
>COG2108 Uncharacterized conserved protein related to pyruvate formate-lyase activating enzyme [General function prediction only] Back     alignment and domain information
>TIGR01211 ELP3 histone acetyltransferase, ELP3 family; InterPro: IPR005910 Histone acetylation is carried out by a class of enzymes known as histone acetyltransferases (HATs), which catalyse the transfer of an acetyl group from acetyl-CoA to the lysine E-amino groups on the N-terminal tails of histones Back     alignment and domain information
>PRK05481 lipoyl synthase; Provisional Back     alignment and domain information
>COG0320 LipA Lipoate synthase [Coenzyme metabolism] Back     alignment and domain information
>cd01335 Radical_SAM Radical SAM superfamily Back     alignment and domain information
>smart00729 Elp3 Elongator protein 3, MiaB family, Radical SAM Back     alignment and domain information
>PRK12928 lipoyl synthase; Provisional Back     alignment and domain information
>TIGR03471 HpnJ hopanoid biosynthesis associated radical SAM protein HpnJ Back     alignment and domain information
>TIGR02666 moaA molybdenum cofactor biosynthesis protein A; InterPro: IPR013483 The majority of molybdenum-containing enzymes utilise a molybdenum cofactor (MoCF or Moco) consisting of a Mo atom coordinated via a cisdithiolene moiety to molybdopterin (MPT) Back     alignment and domain information
>PRK13361 molybdenum cofactor biosynthesis protein A; Provisional Back     alignment and domain information
>PRK00164 moaA molybdenum cofactor biosynthesis protein A; Reviewed Back     alignment and domain information
>PRK08208 coproporphyrinogen III oxidase; Validated Back     alignment and domain information
>COG2516 Biotin synthase-related enzyme [General function prediction only] Back     alignment and domain information
>PRK05904 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK08599 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK05799 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>COG2896 MoaA Molybdenum cofactor biosynthesis enzyme [Coenzyme metabolism] Back     alignment and domain information
>PRK07379 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK05628 coproporphyrinogen III oxidase; Validated Back     alignment and domain information
>PRK05660 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK09058 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK08807 consensus Back     alignment and domain information
>COG1032 Fe-S oxidoreductase [Energy production and conversion] Back     alignment and domain information
>PRK06582 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK08949 consensus Back     alignment and domain information
>PRK09057 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK06294 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK08446 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK13347 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>TIGR00089 TIGR00089 RNA modification enzyme, MiaB family; InterPro: IPR005839 This entry represents a family defined on the basis of sequence similarity Back     alignment and domain information
>PRK08898 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>COG0621 MiaB 2-methylthioadenine synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK09249 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK05301 pyrroloquinoline quinone biosynthesis protein PqqE; Provisional Back     alignment and domain information
>KOG2672 consensus Back     alignment and domain information
>COG0635 HemN Coproporphyrinogen III oxidase and related Fe-S oxidoreductases [Coenzyme metabolism] Back     alignment and domain information
>PRK08629 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>TIGR01574 miaB-methiolase tRNA-i(6)A37 thiotransferase enzyme MiaB; InterPro: IPR006463 These sequences are homologs of the MiaB enzyme responsible for the modification of the isopentenylated adenine-37 base of most bacterial and eukaryotic tRNAs that read codons beginning with uracil (all except tRNA(I,V) Ser) Back     alignment and domain information
>TIGR00510 lipA lipoic acid synthetase; InterPro: IPR003698 Lipoic acid is a covalently bound disulphide-containing cofactor required for function of the pyruvate dehydrogenase, alpha-ketoglutarate dehydrogenase, and glycine cleavage enzyme complexes of Escherichia coli Back     alignment and domain information
>TIGR01125 TIGR01125 MiaB-like tRNA modifying enzyme YliG, TIGR01125; InterPro: IPR005840 This is a family of mainly hypothetical proteins of unknown function Back     alignment and domain information
>TIGR01578 MiaB-like-B MiaB-like tRNA modifying enzyme, archaeal-type; InterPro: IPR006466 This clade of sequences is closely related to MiaB, a modifier of isopentenylated adenosine-37 of certain eukaryotic and bacterial tRNAs (see IPR006463 from INTERPRO) Back     alignment and domain information
>COG2100 Predicted Fe-S oxidoreductase [General function prediction only] Back     alignment and domain information
>TIGR01579 MiaB-like-C MiaB-like tRNA modifying enzyme; InterPro: IPR006467 This clade of sequences is closely related to MiaB, a modifier of isopentenylated adenosine-37 of certain eukaryotic and bacterial tRNAs (see IPR006463 from INTERPRO) Back     alignment and domain information
>COG1243 ELP3 Histone acetyltransferase [Transcription / Chromatin structure and dynamics] Back     alignment and domain information
>COG0535 Predicted Fe-S oxidoreductases [General function prediction only] Back     alignment and domain information
>COG4277 Predicted DNA-binding protein with the Helix-hairpin-helix motif [General function prediction only] Back     alignment and domain information
>TIGR02109 PQQ_syn_pqqE coenzyme PQQ biosynthesis protein E; InterPro: IPR011843 This entry describes coenzyme PQQ biosynthesis protein E, a gene required for the biosynthesis of pyrrolo-quinoline-quinone (coenzyme PQQ) Back     alignment and domain information
>PRK11145 pflA pyruvate formate lyase-activating enzyme 1; Provisional Back     alignment and domain information
>COG1180 PflA Pyruvate-formate lyase-activating enzyme [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0641 AslB Arylsulfatase regulator (Fe-S oxidoreductase) [General function prediction only] Back     alignment and domain information
>COG0731 Fe-S oxidoreductases [Energy production and conversion] Back     alignment and domain information
>TIGR02493 PFLA pyruvate formate-lyase 1-activating enzyme; InterPro: IPR012838 Members of this family are iron-sulphur proteins with a radical-SAM domain Back     alignment and domain information
>TIGR01290 nifB nitrogenase cofactor biosynthesis protein NifB; InterPro: IPR005980 NifB is a protein required for the biosynthesis of the iron-molybdenum (or iron-vanadium) cofactor used by the nitrogen-fixing enzyme nitrogenase Back     alignment and domain information
>KOG4355 consensus Back     alignment and domain information
>COG1031 Uncharacterized Fe-S oxidoreductase [Energy production and conversion] Back     alignment and domain information
>COG1509 KamA Lysine 2,3-aminomutase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK01254 hypothetical protein; Provisional Back     alignment and domain information
>KOG2876 consensus Back     alignment and domain information
>PRK00955 hypothetical protein; Provisional Back     alignment and domain information
>COG0820 Predicted Fe-S-cluster redox enzyme [General function prediction only] Back     alignment and domain information
>COG1313 PflX Uncharacterized Fe-S protein PflX, homolog of pyruvate formate lyase activating proteins [General function prediction only] Back     alignment and domain information
>COG1244 Predicted Fe-S oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK10076 pyruvate formate lyase II activase; Provisional Back     alignment and domain information
>TIGR00048 TIGR00048 radical SAM enzyme, Cfr family; InterPro: IPR004383 This family of conserved hypothetical proteins groups bacterial proteins of unknown function Back     alignment and domain information
>COG5014 Predicted Fe-S oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK13762 tRNA-modifying enzyme; Provisional Back     alignment and domain information
>COG1625 Fe-S oxidoreductase, related to NifB/MoaA family [Energy production and conversion] Back     alignment and domain information
>TIGR02494 PFLE_PFLC glycyl-radical enzyme activating protein family; InterPro: IPR012839 This subset of the radical-SAM domain includes a number of probable activating proteins acting on different enzymes all requiring an amino-acid-centred radical Back     alignment and domain information
>pfam06968 BATS Biotin and Thiamin Synthesis associated domain Back     alignment and domain information
>smart00876 BATS Biotin and Thiamin Synthesis associated domain Back     alignment and domain information
>COG1856 Uncharacterized homolog of biotin synthetase [Function unknown] Back     alignment and domain information
>KOG2492 consensus Back     alignment and domain information
>PRK08207 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>TIGR02668 moaA_archaeal probable molybdenum cofactor biosynthesis protein A; InterPro: IPR013485 This entry consists of archaeal proteins which are predicted to be functionally equivalent to MoaA (molybdenum cofactor biosynthesis protein A) from bacteria (see IPR013483 from INTERPRO) Back     alignment and domain information
>pfam04055 Radical_SAM Radical SAM superfamily Back     alignment and domain information
>TIGR03470 HpnH hopanoid biosynthesis associated radical SAM protein HpnH Back     alignment and domain information
>PRK13758 anaerobic sulfatase-maturase; Provisional Back     alignment and domain information
>PRK13745 anaerobic sulfatase-maturase; Provisional Back     alignment and domain information
>TIGR02495 NrdG2 anaerobic ribonucleoside-triphosphate reductase activating protein; InterPro: IPR012840 This enzyme is a member of the radical-SAM family Back     alignment and domain information
>COG1533 SplB DNA repair photolyase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR03279 cyano_FeS_chp putative FeS-containing Cyanobacterial-specific oxidoreductase Back     alignment and domain information
>COG1964 Predicted Fe-S oxidoreductases [General function prediction only] Back     alignment and domain information
>PRK08195 4-hydroxy-2-ketovalerate aldolase; Validated Back     alignment and domain information
>TIGR03217 4OH_2_O_val_ald 4-hydroxy-2-oxovalerate aldolase Back     alignment and domain information
>pfam00682 HMGL-like HMGL-like Back     alignment and domain information
>PRK05692 hydroxymethylglutaryl-CoA lyase; Provisional Back     alignment and domain information
>pfam05853 DUF849 Prokaryotic protein of unknown function (DUF849) Back     alignment and domain information
>PRK11858 aksA trans-homoaconitate synthase; Reviewed Back     alignment and domain information
>PRK05211 consensus Back     alignment and domain information
>PRK03220 consensus Back     alignment and domain information
>PRK13597 imidazole glycerol phosphate synthase subunit HisF; Provisional Back     alignment and domain information
>PRK07028 bifunctional hexulose-6-phosphate synthase/ribonuclease regulator; Validated Back     alignment and domain information
>COG0119 LeuA Isopropylmalate/homocitrate/citramalate synthases [Amino acid transport and metabolism] Back     alignment and domain information
>KOG3111 consensus Back     alignment and domain information
>PRK04281 consensus Back     alignment and domain information
>PRK02747 consensus Back     alignment and domain information
>TIGR02660 nifV_homocitr homocitrate synthase; InterPro: IPR013477 Most NifV-type homocitrate synthases are encoded within operons for nitrogen fixation Back     alignment and domain information
>PRK09140 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; Reviewed Back     alignment and domain information
>PRK13585 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>PRK05581 ribulose-phosphate 3-epimerase; Validated Back     alignment and domain information
>PRK01659 consensus Back     alignment and domain information
>PRK02621 consensus Back     alignment and domain information
>cd00429 RPE Ribulose-5-phosphate 3-epimerase (RPE) Back     alignment and domain information
>PRK12595 bifunctional 3-deoxy-7-phosphoheptulonate synthase/chorismate mutase; Reviewed Back     alignment and domain information
>PRK08745 ribulose-phosphate 3-epimerase; Provisional Back     alignment and domain information
>PRK08005 ribulose-phosphate 3-epimerase; Validated Back     alignment and domain information
>PTZ00170 D-ribulose-5-phosphate 3-epimerase; Provisional Back     alignment and domain information
>TIGR03278 methan_mark_10 putative methanogenesis marker protein 10 Back     alignment and domain information
>cd00003 PNPsynthase Pyridoxine 5'-phosphate (PNP) synthase domain; pyridoxal 5'-phosphate is the active form of vitamin B6 that acts as an essential, ubiquitous coenzyme in amino acid metabolism Back     alignment and domain information
>PRK05265 pyridoxine 5'-phosphate synthase; Provisional Back     alignment and domain information
>pfam03740 PdxJ Pyridoxal phosphate biosynthesis protein PdxJ Back     alignment and domain information
>TIGR00676 fadh2 5,10-methylenetetrahydrofolate reductase; InterPro: IPR004620 The enzyme activities methylenetetrahydrofolate reductase (1 Back     alignment and domain information
>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase; InterPro: IPR005990 Synonyms: Inosine-5'-monophosphate dehydrogenase, Inosinic acid dehydrogenase IMP dehydrogenase (1 Back     alignment and domain information
>pfam05913 DUF871 Bacterial protein of unknown function (DUF871) Back     alignment and domain information
>PRK11613 folP dihydropteroate synthase; Provisional Back     alignment and domain information
>TIGR00559 pdxJ pyridoxal phosphate biosynthetic protein PdxJ; InterPro: IPR004569 Pyridoxal phosphate is the active form of vitamin B6 (pyridoxine or pyridoxal) Back     alignment and domain information
>COG0854 PdxJ Pyridoxal phosphate biosynthesis protein [Coenzyme metabolism] Back     alignment and domain information
>pfam10113 Fibrillarin_2 Fibrillarin-like archaeal protein Back     alignment and domain information
>COG4018 Uncharacterized protein conserved in archaea [Function unknown] Back     alignment and domain information
>TIGR03365 Bsubt_queE 7-cyano-7-deazaguanosine (preQ0) biosynthesis protein QueE Back     alignment and domain information
>COG0602 NrdG Organic radical activating enzymes [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4039 consensus Back     alignment and domain information
>PRK00915 2-isopropylmalate synthase; Validated Back     alignment and domain information
>PRK09389 (R)-citramalate synthase; Provisional Back     alignment and domain information
>pfam00478 IMPDH IMP dehydrogenase / GMP reductase domain Back     alignment and domain information
>PRK00507 deoxyribose-phosphate aldolase; Provisional Back     alignment and domain information
>cd04739 DHOD_like Dihydroorotate dehydrogenase (DHOD) like proteins Back     alignment and domain information
>PRK07565 dihydroorotate dehydrogenase 2; Reviewed Back     alignment and domain information
>KOG2550 consensus Back     alignment and domain information
>KOG2535 consensus Back     alignment and domain information
>PRK12331 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>PRK07807 inositol-5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target328 biotin synthase [Candidatus Liberibacter asiaticus str.
1r30_A369 The Crystal Structure Of Biotin Synthase, An S- Ade 3e-90
3cix_A348 X-Ray Structure Of The [fefe]-Hydrogenase Maturase 5e-43
3ciw_A348 X-Ray Structure Of The [fefe]-Hydrogenase Maturase 6e-43
3iiz_A348 X-Ray Structure Of The Fefe-Hydrogenase Maturase Hy 8e-43
2fb2_A340 Structure Of The Moaa Arg17266268ALA TRIPLE MUTANT 1e-04
1tv7_A340 Structure Of The S-Adenosylmethionine Dependent Enz 1e-04
>gi|42543470|pdb|1R30|A Chain A, The Crystal Structure Of Biotin Synthase, An S- Adenosylmethionine-Dependent Radical Enzyme Length = 369 Back     alignment and structure
 Score =  336 bits (861), Expect = 3e-90,   Method: Composition-based stats.
 Identities = 168/316 (53%), Positives = 228/316 (72%)

Query: 13  TKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYC 72
           +     WT  +V +++  P  DLLF +  VHR++F+P  +Q+S LL+IKTG CPE+C YC
Sbjct: 24  SAHRPRWTLSQVTELFEKPLLDLLFEAQQVHRQHFDPRQVQVSTLLSIKTGACPEDCKYC 83

Query: 73  NQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGV 132
            QS   K+ L+A +L+ V+QVL+ A+ AK  G+TR+CMGAAW+ P ERD+  +  M++GV
Sbjct: 84  PQSSRYKTGLEAERLMEVEQVLESARKAKAAGSTRFCMGAAWKNPHERDMPYLEQMVQGV 143

Query: 133 KSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENV 192
           K++GLE CMTLG LS  QAQ L+ AGLDYYNHN+DTS  FY ++ TT T+++RL TLE V
Sbjct: 144 KAMGLEACMTLGTLSESQAQRLANAGLDYYNHNLDTSPEFYGNIITTRTYQERLDTLEKV 203

Query: 193 RKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDP 252
           R +GIKVC GGI+GLGE + DR  +LL LANL TPPES+PIN+L+ + G+   +N  VD 
Sbjct: 204 RDAGIKVCSGGIVGLGETVKDRAGLLLQLANLPTPPESVPINMLVKVKGTPLADNDDVDA 263

Query: 253 IEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNK 312
            + +R I+VARI+MP S +RL+AGR  M+++ QA+CF +GANSIF G  LLT  NP  +K
Sbjct: 264 FDFIRTIAVARIMMPTSYVRLSAGREQMNEQTQAMCFMAGANSIFYGCKLLTTPNPEEDK 323

Query: 313 DTILFNRLGLIPDLSA 328
           D  LF +LGL P  +A
Sbjct: 324 DLQLFRKLGLNPQQTA 339


>gi|178847576|pdb|3CIX|A Chain A, X-Ray Structure Of The [fefe]-Hydrogenase Maturase Hyde From Thermotoga Maritima In Complex With Thiocyanate Length = 348 Back     alignment and structure
>gi|178847575|pdb|3CIW|A Chain A, X-Ray Structure Of The [fefe]-Hydrogenase Maturase Hyde From Thermotoga Maritima Length = 348 Back     alignment and structure
>gi|259090313|pdb|3IIZ|A Chain A, X-Ray Structure Of The Fefe-Hydrogenase Maturase Hyde From T. Maritima In Complex With S-Adenosyl-L-Methionine Length = 348 Back     alignment and structure