peg_394

peg_394

GeneID in NCBI database:Locus tag:
Protein GI in NCBI database:not defined in NCBI databaseProtein Accession:
Gene range:+(406726, 407154)Protein Length:142aa
Gene description:
COG prediction:none
KEGG prediction:not defined in KEGG
SEED prediction:Acetylglutamate kinase (EC 2.7.2.8)
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Arginine Biosynthesis extended
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOP1 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140--
LGFVGNVIKVNRTILDLLIKSGIIPVIAPIAPGYDGATYNINADTFAGAIAEKLNVIRLLFLTDVPGVLDKNRQLISKLSINEARTLIKDGTISGGMIPKIETSIKAIENGVKSVAILDGKKPHSILMEIFTKNGSGTLLIP
ccccEEEEEEcHHHHHHHHHcccEEEEccccccccccEEEEcHHHHHHHHHHHccccEEEEEEcccccccccccccccccHHHHHHHHHcccccccHHHHHHHHHHHHHccccEEEEEEcccccHHHHHHHcccccccEEcc
cccccEEEEccHHHHHHHHcccccEEEEEEcccccccEEEccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHcccccccccHHHHHHHHHHHccccEEEEEcccccHHEHHEEcccccccEEEcc
LGFVGNVIKVNRTILDLLIksgiipviapiapgydgatyninADTFAGAIAEKLNVIRLLFltdvpgvldknRQLISKLSINEARTLIkdgtisggmipkIETSIKAIENGVKSVAildgkkphSILMEIFTkngsgtllip
lgfvgnviKVNRTILDLLIKSGIIPVIAPIAPGYDGATYNINADTFAGAIAEKLNVIRLLFLTDVPGVLDKNRQLISklsineartlikdgtisggmipKIETSIKAIENGVKSVAILDGKKPHSILMEiftkngsgtllip
LGFVGNVIKVNRTILDLLIKSGiipviapiapGYDGATYNINADTFAGAIAEKLNVIRLLFLTDVPGVLDKNRQLISKLSINEARTLIKDGTISGGMIPKIETSIKAIENGVKSVAILDGKKPHSILMEIFTKNGSGTLLIP
LGFVGNVIKVNRTILDLLIKSGIIPVIAPIAPGYDGATYNINADTFAGAIAEKLNVIRLLFLTDVPGVLDKNRQLISKLSINEARTLIKDGTISGGMIPKIETSIKAIENGVKSVAILDGKKPHSILMEIFTKNGSGTLLIP
LGFVGNVIKVNRTILDLLIKSGIIPVIAPIAPGYDGATYNINADTFAGAIAEKLNVIRLLFLTDVPGVLDKNRQLISKLSINEARTLIKDGTISGGMIPKIETSIKAIENGVKSVAILDGKKPHSILMEIFTKNGSGTLLIP
*GFVGNVIKVNRTILDLLIKSGIIPVIAPIAPGYDGATYNINADTFAGAIAEKLNVIRLLFLTDVPGVLDKNRQLISKLSINEARTLIKDGTISGGMIPKIETSIKAIENGVKSVAILDGKKPHSILMEIFTKNGSGTLLIP
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
LGFVGNVIKVNRTILDLLIKSGIIPVIAPIAPGYDGATYNINADTFAGAIAEKLNVIRLLFLTDVPGVLDKNRQLISKLSINEARTLIKDGTISGGMIPKIETSIKAIENGVKSVAILDGKKPHSILMEIFTKNGSGTLLIP
LGFVGNVIKVNRTILDLLIKSGIIPVIAPIAPGYDGATYNINADTFAGAIAEKLNVIRLLFLTDVPGVLDKNRQLISKLSINEARTLIKDGTISGGMIPKIETSIKAIENGVKSVAILDGKKPHSILMEIFTKNGSGTLLIP
LGFVGNVIKVNRTILDLLIKSGIIPVIAPIAPGYDGATYNINADTFAGAIAEKLNVIRLLFLTDVPGVLDKNRQLISKLSINEARTLIKDGTISGGMIPKIETSIKAIENGVKSVAILDGKKPHSILMEIFTKNGSGTLLIP

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target142
254780905 271 glutamate racemase [Candidatus Liberibacter asiati 0.016
>gi|254780905|ref|YP_003065318.1| glutamate racemase [Candidatus Liberibacter asiaticus str. psy62] Length = 271 Back     alignment
 Score = 30.0 bits (66), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 35/65 (53%), Gaps = 9/65 (13%)

Query: 58  RLLFLTDVPGVLDKNRQLISKLSINEARTLIKDGTISG-------GMIPKIETSIKAIEN 110
           RL+FL     +LDK + ++S ++ N A TLIKD   S        G +P I+ +    ++
Sbjct: 63  RLMFL--FSDILDKYQPVLSVIACNTAFTLIKDELRSTFPSMAFLGAVPAIKQAAAYTQS 120

Query: 111 GVKSV 115
           G+ S+
Sbjct: 121 GLISI 125

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target142
315122059292 acetylglutamate kinase [Candidatus Liberibacter solanac 1 2e-64
15887731294 acetylglutamate kinase [Agrobacterium tumefaciens str. 1 5e-53
325291814294 Acetylglutamate kinase [Agrobacterium sp. H13-3] Length 1 1e-52
260461145299 acetylglutamate kinase [Mesorhizobium opportunistum WSM 1 4e-52
116250214295 acetylglutamate kinase [Rhizobium leguminosarum bv. vic 1 4e-52
241202840295 acetylglutamate kinase [Rhizobium leguminosarum bv. tri 1 4e-52
190890099295 acetylglutamate kinase protein [Rhizobium etli CIAT 652 1 7e-52
218678771295 acetylglutamate kinase [Rhizobium etli CIAT 894] Length 1 7e-52
218674519295 acetylglutamate kinase [Rhizobium etli GR56] Length = 2 1 1e-51
319780367297 acetylglutamate kinase [Mesorhizobium ciceri biovar bis 1 2e-51
>gi|315122059|ref|YP_004062548.1| acetylglutamate kinase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 292 Back     alignment and organism information
 Score =  248 bits (634), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 125/142 (88%), Positives = 134/142 (94%)

Query: 1   LGFVGNVIKVNRTILDLLIKSGIIPVIAPIAPGYDGATYNINADTFAGAIAEKLNVIRLL 60
           LGFVG +I++NRTILDLL KSGI+PVIAPIAPG DG+TYNINADTFAGAIA KLNVIRLL
Sbjct: 151 LGFVGEIIEINRTILDLLTKSGIVPVIAPIAPGRDGSTYNINADTFAGAIAGKLNVIRLL 210

Query: 61  FLTDVPGVLDKNRQLISKLSINEARTLIKDGTISGGMIPKIETSIKAIENGVKSVAILDG 120
           FLTDVPGVLDKN +LISKLSI EARTLIKDG ISGGMIPKIETSI+AIENGVKS+AILDG
Sbjct: 211 FLTDVPGVLDKNGELISKLSIKEARTLIKDGVISGGMIPKIETSIEAIENGVKSIAILDG 270

Query: 121 KKPHSILMEIFTKNGSGTLLIP 142
            KPHSILMEIFTKNGSGTLL+P
Sbjct: 271 TKPHSILMEIFTKNGSGTLLVP 292


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|15887731|ref|NP_353412.1| acetylglutamate kinase [Agrobacterium tumefaciens str. C58] Length = 294 Back     alignment and organism information
>gi|325291814|ref|YP_004277678.1| Acetylglutamate kinase [Agrobacterium sp. H13-3] Length = 294 Back     alignment and organism information
>gi|260461145|ref|ZP_05809394.1| acetylglutamate kinase [Mesorhizobium opportunistum WSM2075] Length = 299 Back     alignment and organism information
>gi|116250214|ref|YP_766052.1| acetylglutamate kinase [Rhizobium leguminosarum bv. viciae 3841] Length = 295 Back     alignment and organism information
>gi|241202840|ref|YP_002973936.1| acetylglutamate kinase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 295 Back     alignment and organism information
>gi|190890099|ref|YP_001976641.1| acetylglutamate kinase protein [Rhizobium etli CIAT 652] Length = 295 Back     alignment and organism information
>gi|218678771|ref|ZP_03526668.1| acetylglutamate kinase [Rhizobium etli CIAT 894] Length = 295 Back     alignment and organism information
>gi|218674519|ref|ZP_03524188.1| acetylglutamate kinase [Rhizobium etli GR56] Length = 295 Back     alignment and organism information
>gi|319780367|ref|YP_004139843.1| acetylglutamate kinase [Mesorhizobium ciceri biovar biserrulae WSM1271] Length = 297 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target142
PRK00942283 PRK00942, PRK00942, acetylglutamate kinase; Provisional 3e-55
cd04238256 cd04238, AAK_NAGK-like, AAK_NAGK-like: N-Acetyl-L-gluta 1e-45
PLN02512309 PLN02512, PLN02512, acetylglutamate kinase 3e-43
COG0548265 COG0548, ArgB, Acetylglutamate kinase [Amino acid trans 1e-39
CHL00202284 CHL00202, argB, acetylglutamate kinase; Provisional 4e-37
TIGR00761231 TIGR00761, argB, acetylglutamate kinase 2e-29
cd04249252 cd04249, AAK_NAGK-NC, AAK_NAGK-NC: N-Acetyl-L-glutamate 1e-20
PRK14058268 PRK14058, PRK14058, acetylglutamate/acetylaminoadipate 3e-19
cd04237280 cd04237, AAK_NAGS-ABP, AAK_NAGS-ABP: N-acetylglutamate 2e-18
cd04251257 cd04251, AAK_NAGK-UC, AAK_NAGK-UC: N-Acetyl-L-glutamate 3e-18
pfam00696230 pfam00696, AA_kinase, Amino acid kinase family 8e-17
PRK05279 441 PRK05279, PRK05279, N-acetylglutamate synthase; Validat 5e-16
cd04252248 cd04252, AAK_NAGK-fArgBP, AAK_NAGK-fArgBP: N-Acetyl-L-g 9e-16
PRK04531 398 PRK04531, PRK04531, acetylglutamate kinase; Provisional 1e-14
TIGR01890 429 TIGR01890, N-Ac-Glu-synth, amino-acid N-acetyltransfera 5e-14
KOG2436 520 KOG2436, KOG2436, KOG2436, Acetylglutamate kinase/acety 4e-13
cd02115248 cd02115, AAK, Amino Acid Kinases (AAK) superfamily, cat 2e-11
cd04236271 cd04236, AAK_NAGS-Urea, AAK_NAGS-Urea: N-acetylglutamat 4e-09
COG1608252 COG1608, COG1608, Predicted archaeal kinase [General fu 1e-07
cd04241252 cd04241, AAK_FomA-like, AAK_FomA-like: This CD includes 3e-07
cd04235308 cd04235, AAK_CK, AAK_CK: Carbamate kinase (CK) catalyze 1e-06
COG0549312 COG0549, ArcC, Carbamate kinase [Amino acid transport a 4e-06
PRK12686312 PRK12686, PRK12686, carbamate kinase; Reviewed 4e-06
cd04242251 cd04242, AAK_G5K_ProB, AAK_G5K_ProB: Glutamate-5-kinase 2e-05
PRK12352316 PRK12352, PRK12352, putative carbamate kinase; Reviewed 3e-05
COG0263 369 COG0263, ProB, Glutamate 5-kinase [Amino acid transport 5e-05
cd04240203 cd04240, AAK_UC, AAK_UC: Uncharacterized (UC) amino aci 3e-04
PLN02418 718 PLN02418, PLN02418, delta-1-pyrroline-5-carboxylate syn 5e-04
COG2054212 COG2054, COG2054, Uncharacterized archaeal kinase relat 0.001
TIGR00746310 TIGR00746, arcC, carbamate kinase 0.001
PRK12354307 PRK12354, PRK12354, carbamate kinase; Reviewed 0.002
PRK13402 368 PRK13402, PRK13402, gamma-glutamyl kinase; Provisional 0.003
cd04250279 cd04250, AAK_NAGK-C, AAK_NAGK-C: N-Acetyl-L-glutamate k 1e-46
PRK12353314 PRK12353, PRK12353, putative amino acid kinase; Reviewe 1e-05
PRK12454313 PRK12454, PRK12454, carbamate kinase-like carbamoyl pho 1e-05
PRK05429 372 PRK05429, PRK05429, gamma-glutamyl kinase; Provisional 2e-04
cd04246239 cd04246, AAK_AK-DapG-like, AAK_AK-DapG-like: Amino Acid 0.003
>gnl|CDD|179175 PRK00942, PRK00942, acetylglutamate kinase; Provisional Back     alignment and domain information
>gnl|CDD|58604 cd04238, AAK_NAGK-like, AAK_NAGK-like: N-Acetyl-L-glutamate kinase (NAGK)-like Back     alignment and domain information
>gnl|CDD|178128 PLN02512, PLN02512, acetylglutamate kinase Back     alignment and domain information
>gnl|CDD|30894 COG0548, ArgB, Acetylglutamate kinase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|133644 CHL00202, argB, acetylglutamate kinase; Provisional Back     alignment and domain information
>gnl|CDD|162026 TIGR00761, argB, acetylglutamate kinase Back     alignment and domain information
>gnl|CDD|58615 cd04249, AAK_NAGK-NC, AAK_NAGK-NC: N-Acetyl-L-glutamate kinase - noncyclic (NAGK-NC) catalyzes the phosphorylation of the gamma-COOH group of N-acetyl-L-glutamate (NAG) by ATP in the second step of microbial arginine biosynthesis using the acetylated, noncyclic route of ornithine biosynthesis Back     alignment and domain information
>gnl|CDD|184481 PRK14058, PRK14058, acetylglutamate/acetylaminoadipate kinase; Provisional Back     alignment and domain information
>gnl|CDD|58603 cd04237, AAK_NAGS-ABP, AAK_NAGS-ABP: N-acetylglutamate (NAG) kinase-like domain of the NAG Synthase (NAGS) of the arginine-biosynthesis pathway (ABP) found in gamma- and beta-proteobacteria and higher plant chloroplasts Back     alignment and domain information
>gnl|CDD|58617 cd04251, AAK_NAGK-UC, AAK_NAGK-UC: N-Acetyl-L-glutamate kinase - uncharacterized (NAGK-UC) Back     alignment and domain information
>gnl|CDD|144336 pfam00696, AA_kinase, Amino acid kinase family Back     alignment and domain information
>gnl|CDD|179989 PRK05279, PRK05279, N-acetylglutamate synthase; Validated Back     alignment and domain information
>gnl|CDD|58618 cd04252, AAK_NAGK-fArgBP, AAK_NAGK-fArgBP: N-Acetyl-L-glutamate kinase (NAGK) of the fungal arginine-biosynthetic pathway (fArgBP) Back     alignment and domain information
>gnl|CDD|179860 PRK04531, PRK04531, acetylglutamate kinase; Provisional Back     alignment and domain information
>gnl|CDD|162583 TIGR01890, N-Ac-Glu-synth, amino-acid N-acetyltransferase Back     alignment and domain information
>gnl|CDD|37647 KOG2436, KOG2436, KOG2436, Acetylglutamate kinase/acetylglutamate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|58599 cd02115, AAK, Amino Acid Kinases (AAK) superfamily, catalytic domain; present in such enzymes like N-acetylglutamate kinase (NAGK), carbamate kinase (CK), aspartokinase (AK), glutamate-5-kinase (G5K) and UMP kinase (UMPK) Back     alignment and domain information
>gnl|CDD|58602 cd04236, AAK_NAGS-Urea, AAK_NAGS-Urea: N-acetylglutamate (NAG) kinase-like domain of the NAG Synthase (NAGS) of the urea cycle found in animals Back     alignment and domain information
>gnl|CDD|31796 COG1608, COG1608, Predicted archaeal kinase [General function prediction only] Back     alignment and domain information
>gnl|CDD|58607 cd04241, AAK_FomA-like, AAK_FomA-like: This CD includes a fosfomycin biosynthetic gene product, FomA, and similar proteins found in a wide range of organisms Back     alignment and domain information
>gnl|CDD|58601 cd04235, AAK_CK, AAK_CK: Carbamate kinase (CK) catalyzes both the ATP-phosphorylation of carbamate and carbamoyl phosphate (CP) utilization with the production of ATP from ADP and CP Back     alignment and domain information
>gnl|CDD|30895 COG0549, ArcC, Carbamate kinase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|183683 PRK12686, PRK12686, carbamate kinase; Reviewed Back     alignment and domain information
>gnl|CDD|58608 cd04242, AAK_G5K_ProB, AAK_G5K_ProB: Glutamate-5-kinase (G5K) catalyzes glutamate-dependent ATP cleavage; G5K transfers the terminal phosphoryl group of ATP to the gamma-carboxyl group of glutamate, in the first and controlling step of proline (and, in mammals, ornithine) biosynthesis Back     alignment and domain information
>gnl|CDD|183464 PRK12352, PRK12352, putative carbamate kinase; Reviewed Back     alignment and domain information
>gnl|CDD|30612 COG0263, ProB, Glutamate 5-kinase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|58606 cd04240, AAK_UC, AAK_UC: Uncharacterized (UC) amino acid kinase-like proteins found mainly in archaea and a few bacteria Back     alignment and domain information
>gnl|CDD|178039 PLN02418, PLN02418, delta-1-pyrroline-5-carboxylate synthase Back     alignment and domain information
>gnl|CDD|32237 COG2054, COG2054, Uncharacterized archaeal kinase related to aspartokinases, uridylate kinases [General function prediction only] Back     alignment and domain information
>gnl|CDD|162019 TIGR00746, arcC, carbamate kinase Back     alignment and domain information
>gnl|CDD|183466 PRK12354, PRK12354, carbamate kinase; Reviewed Back     alignment and domain information
>gnl|CDD|184032 PRK13402, PRK13402, gamma-glutamyl kinase; Provisional Back     alignment and domain information
>gnl|CDD|58616 cd04250, AAK_NAGK-C, AAK_NAGK-C: N-Acetyl-L-glutamate kinase - cyclic (NAGK-C) catalyzes the phosphorylation of the gamma-COOH group of N-acetyl-L-glutamate (NAG) by ATP in the second step of arginine biosynthesis found in some bacteria and photosynthetic organisms using the non-acetylated, cyclic route of ornithine biosynthesis Back     alignment and domain information
>gnl|CDD|183465 PRK12353, PRK12353, putative amino acid kinase; Reviewed Back     alignment and domain information
>gnl|CDD|183535 PRK12454, PRK12454, carbamate kinase-like carbamoyl phosphate synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|180076 PRK05429, PRK05429, gamma-glutamyl kinase; Provisional Back     alignment and domain information
>gnl|CDD|58612 cd04246, AAK_AK-DapG-like, AAK_AK-DapG-like: Amino Acid Kinase Superfamily (AAK), AK-DapG-like; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the diaminopimelate-sensitive aspartokinase isoenzyme AKI (DapG), a monofunctional enzymes found in Bacilli (Bacillus subtilis 168), Clostridia, and Actinobacteria bacterial species, as well as, the catalytic AK domain of the lysine-sensitive aspartokinase isoenzyme AKII of Bacillus subtilis 168, the lysine plus threonine-sensitive aspartokinase of Corynebacterium glutamicum, and related isoenzymes Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 142
cd04237280 AAK_NAGS-ABP AAK_NAGS-ABP: N-acetylglutamate (NAG) kina 100.0
CHL00202284 argB acetylglutamate kinase; Provisional 100.0
PRK05279 441 N-acetylglutamate synthase; Validated 100.0
cd04250279 AAK_NAGK-C AAK_NAGK-C: N-Acetyl-L-glutamate kinase - cy 100.0
PRK00942262 acetylglutamate kinase; Provisional 100.0
cd04238256 AAK_NAGK-like AAK_NAGK-like: N-Acetyl-L-glutamate kinas 100.0
cd04249252 AAK_NAGK-NC AAK_NAGK-NC: N-Acetyl-L-glutamate kinase - 100.0
COG0548265 ArgB Acetylglutamate kinase [Amino acid transport and m 100.0
cd04252248 AAK_NAGK-fArgBP AAK_NAGK-fArgBP: N-Acetyl-L-glutamate k 100.0
cd04251257 AAK_NAGK-UC AAK_NAGK-UC: N-Acetyl-L-glutamate kinase - 100.0
PRK04531 421 acetylglutamate kinase; Provisional 100.0
cd04236271 AAK_NAGS-Urea AAK_NAGS-Urea: N-acetylglutamate (NAG) ki 100.0
TIGR00761254 argB acetylglutamate kinase; InterPro: IPR004662 N -Ace 100.0
TIGR01890 439 N-Ac-Glu-synth amino-acid N-acetyltransferase; InterPro 100.0
cd02115248 AAK Amino Acid Kinases (AAK) superfamily, catalytic dom 99.96
cd04241252 AAK_FomA-like AAK_FomA-like: This CD includes a fosfomy 99.96
PRK12353312 carbamate kinase; Reviewed 99.92
cd04256284 AAK_P5CS_ProBA AAK_P5CS_ProBA: Glutamate-5-kinase (G5K) 99.91
PRK12314265 gamma-glutamyl kinase; Provisional 99.88
PRK12454313 carbamate kinase-like carbamoyl phosphate synthetase; R 99.88
pfam00696230 AA_kinase Amino acid kinase family. This family include 99.87
cd04235308 AAK_CK AAK_CK: Carbamate kinase (CK) catalyzes both the 99.86
cd04242251 AAK_G5K_ProB AAK_G5K_ProB: Glutamate-5-kinase (G5K) cat 99.86
TIGR01027 379 proB glutamate 5-kinase; InterPro: IPR005715 L-glutamat 99.85
COG1608252 Predicted archaeal kinase [General function prediction 99.84
PRK05429 372 gamma-glutamyl kinase; Provisional 99.84
PRK13402 363 gamma-glutamyl kinase; Provisional 99.83
PRK12686313 carbamate kinase; Reviewed 99.83
PRK12352316 putative carbamate kinase; Reviewed 99.82
KOG2436 520 consensus 99.81
TIGR00746321 arcC carbamate kinase; InterPro: IPR003964 The arginine 99.8
PRK12354302 carbamate kinase; Reviewed 99.8
COG0549312 ArcC Carbamate kinase [Amino acid transport and metabol 99.78
COG0263 369 ProB Glutamate 5-kinase [Amino acid transport and metab 99.77
cd04239229 AAK_UMPK-like AAK_UMPK-like: UMP kinase (UMPK)-like, th 99.76
cd04253221 AAK_UMPK-PyrH-Pf AAK_UMPK-PyrH-Pf: UMP kinase (UMPK)-Pf 99.71
PRK09411297 carbamate kinase; Reviewed 99.71
PRK00358231 pyrH uridylate kinase; Provisional 99.7
TIGR01092 738 P5CS delta l-pyrroline-5-carboxylate synthetase; InterP 99.57
cd04254231 AAK_UMPK-PyrH-Ec UMP kinase (UMPK)-Ec, the microbial/ch 99.55
cd04240203 AAK_UC AAK_UC: Uncharacterized (UC) amino acid kinase-l 99.53
TIGR00657 504 asp_kinases aspartate kinase; InterPro: IPR001341 Bacte 99.53
KOG1154285 consensus 99.5
TIGR02076232 pyrH_arch uridylate kinase, putative; InterPro: IPR0118 99.32
PRK07431 594 aspartate kinase; Provisional 99.24
cd04260244 AAK_AKi-DapG-BS AAK_AKi-DapG-BS: Amino Acid Kinase Supe 99.24
PRK08841 392 aspartate kinase; Validated 99.23
COG0527 447 LysC Aspartokinases [Amino acid transport and metabolis 99.23
cd04255262 AAK_UMPK-MosAB AAK_UMPK-MosAB: This CD includes the alp 99.22
PRK08210 405 aspartate kinase I; Reviewed 99.21
cd04246239 AAK_AK-DapG-like AAK_AK-DapG-like: Amino Acid Kinase Su 99.19
cd04261239 AAK_AKii-LysC-BS AAK_AKii-LysC-BS: Amino Acid Kinase Su 99.17
PRK06635 402 aspartate kinase; Reviewed 99.17
cd04234227 AAK_AK AAK_AK: Amino Acid Kinase Superfamily (AAK), Asp 99.1
PRK09034 450 aspartate kinase; Reviewed 99.09
PRK06291 466 aspartate kinase; Provisional 99.07
PRK05925 440 aspartate kinase; Provisional 99.07
cd04245288 AAK_AKiii-YclM-BS AAK_AKiii-YclM-BS: Amino Acid Kinase 99.05
cd04244298 AAK_AK-LysC-like AAK_AK-LysC-like: Amino Acid Kinase Su 99.01
cd04247306 AAK_AK-Hom3 AAK_AK-Hom3: Amino Acid Kinase Superfamily 99.0
cd04243293 AAK_AK-HSDH-like AAK_AK-HSDH-like: Amino Acid Kinase Su 98.99
cd04257294 AAK_AK-HSDH AAK_AK-HSDH: Amino Acid Kinase Superfamily 98.99
PRK12443247 uridylate kinase; Reviewed 98.98
PRK08373359 aspartate kinase; Validated 98.96
PRK09466 810 metL bifunctional aspartate kinase II/homoserine dehydr 98.96
TIGR02075236 pyrH_bact uridylate kinase; InterPro: IPR015963 Uridyla 98.95
cd04258292 AAK_AKiii-LysC-EC AAK_AKiii-LysC-EC: Amino Acid Kinase 98.94
COG2054212 Uncharacterized archaeal kinase related to aspartokinas 98.92
COG0528238 PyrH Uridylate kinase [Nucleotide transport and metabol 98.92
PRK09084 447 aspartate kinase III; Validated 98.91
PRK09436 817 thrA bifunctional aspartokinase I/homeserine dehydrogen 98.89
PRK08961 865 bifunctional aspartate kinase/diaminopimelate decarboxy 98.84
cd04259295 AAK_AK-DapDC AAK_AK-DapDC: Amino Acid Kinase Superfamil 98.78
cd04248304 AAK_AK-Ectoine AAK_AK-Ectoine: Amino Acid Kinase Superf 98.46
PRK09181 476 aspartate kinase; Validated 98.31
TIGR02078341 AspKin_pair Pyrococcus aspartate kinase subunit, putati 98.12
KOG0456 559 consensus 96.49
TIGR00656 480 asp_kin_monofn asparate kinase, monofunctional class; I 98.12
>cd04237 AAK_NAGS-ABP AAK_NAGS-ABP: N-acetylglutamate (NAG) kinase-like domain of the NAG Synthase (NAGS) of the arginine-biosynthesis pathway (ABP) found in gamma- and beta-proteobacteria and higher plant chloroplasts Back     alignment and domain information
>CHL00202 argB acetylglutamate kinase; Provisional Back     alignment and domain information
>PRK05279 N-acetylglutamate synthase; Validated Back     alignment and domain information
>cd04250 AAK_NAGK-C AAK_NAGK-C: N-Acetyl-L-glutamate kinase - cyclic (NAGK-C) catalyzes the phosphorylation of the gamma-COOH group of N-acetyl-L-glutamate (NAG) by ATP in the second step of arginine biosynthesis found in some bacteria and photosynthetic organisms using the non-acetylated, cyclic route of ornithine biosynthesis Back     alignment and domain information
>PRK00942 acetylglutamate kinase; Provisional Back     alignment and domain information
>cd04238 AAK_NAGK-like AAK_NAGK-like: N-Acetyl-L-glutamate kinase (NAGK)-like Back     alignment and domain information
>cd04249 AAK_NAGK-NC AAK_NAGK-NC: N-Acetyl-L-glutamate kinase - noncyclic (NAGK-NC) catalyzes the phosphorylation of the gamma-COOH group of N-acetyl-L-glutamate (NAG) by ATP in the second step of microbial arginine biosynthesis using the acetylated, noncyclic route of ornithine biosynthesis Back     alignment and domain information
>COG0548 ArgB Acetylglutamate kinase [Amino acid transport and metabolism] Back     alignment and domain information
>cd04252 AAK_NAGK-fArgBP AAK_NAGK-fArgBP: N-Acetyl-L-glutamate kinase (NAGK) of the fungal arginine-biosynthetic pathway (fArgBP) Back     alignment and domain information
>cd04251 AAK_NAGK-UC AAK_NAGK-UC: N-Acetyl-L-glutamate kinase - uncharacterized (NAGK-UC) Back     alignment and domain information
>PRK04531 acetylglutamate kinase; Provisional Back     alignment and domain information
>cd04236 AAK_NAGS-Urea AAK_NAGS-Urea: N-acetylglutamate (NAG) kinase-like domain of the NAG Synthase (NAGS) of the urea cycle found in animals Back     alignment and domain information
>TIGR00761 argB acetylglutamate kinase; InterPro: IPR004662 N -Acetylglutamate (NAG) fulfils distinct biological roles in lower and higher organisms Back     alignment and domain information
>TIGR01890 N-Ac-Glu-synth amino-acid N-acetyltransferase; InterPro: IPR010167 This entry represents a clade of amino-acid N-acetyltransferases, or N-acetylglutamate synthase, which is the product of the argA gene and the first enzyme in arginine biosynthesis Back     alignment and domain information
>cd02115 AAK Amino Acid Kinases (AAK) superfamily, catalytic domain; present in such enzymes like N-acetylglutamate kinase (NAGK), carbamate kinase (CK), aspartokinase (AK), glutamate-5-kinase (G5K) and UMP kinase (UMPK) Back     alignment and domain information
>cd04241 AAK_FomA-like AAK_FomA-like: This CD includes a fosfomycin biosynthetic gene product, FomA, and similar proteins found in a wide range of organisms Back     alignment and domain information
>PRK12353 carbamate kinase; Reviewed Back     alignment and domain information
>cd04256 AAK_P5CS_ProBA AAK_P5CS_ProBA: Glutamate-5-kinase (G5K) domain of the bifunctional delta 1-pyrroline-5-carboxylate synthetase (P5CS), composed of an N-terminal G5K (ProB) and a C-terminal glutamyl 5- phosphate reductase (G5PR, ProA), the first and second enzyme catalyzing proline (and, in mammals, ornithine) biosynthesis Back     alignment and domain information
>PRK12314 gamma-glutamyl kinase; Provisional Back     alignment and domain information
>PRK12454 carbamate kinase-like carbamoyl phosphate synthetase; Reviewed Back     alignment and domain information
>pfam00696 AA_kinase Amino acid kinase family Back     alignment and domain information
>cd04235 AAK_CK AAK_CK: Carbamate kinase (CK) catalyzes both the ATP-phosphorylation of carbamate and carbamoyl phosphate (CP) utilization with the production of ATP from ADP and CP Back     alignment and domain information
>cd04242 AAK_G5K_ProB AAK_G5K_ProB: Glutamate-5-kinase (G5K) catalyzes glutamate-dependent ATP cleavage; G5K transfers the terminal phosphoryl group of ATP to the gamma-carboxyl group of glutamate, in the first and controlling step of proline (and, in mammals, ornithine) biosynthesis Back     alignment and domain information
>TIGR01027 proB glutamate 5-kinase; InterPro: IPR005715 L-glutamate 5-phosphotransferase, (gamma-glutamyl kinase, proB, 2 Back     alignment and domain information
>COG1608 Predicted archaeal kinase [General function prediction only] Back     alignment and domain information
>PRK05429 gamma-glutamyl kinase; Provisional Back     alignment and domain information
>PRK13402 gamma-glutamyl kinase; Provisional Back     alignment and domain information
>PRK12686 carbamate kinase; Reviewed Back     alignment and domain information
>PRK12352 putative carbamate kinase; Reviewed Back     alignment and domain information
>KOG2436 consensus Back     alignment and domain information
>TIGR00746 arcC carbamate kinase; InterPro: IPR003964 The arginine dihydrolase (AD) pathway is found in many prokaryotes and some primitive eukaryotes Back     alignment and domain information
>PRK12354 carbamate kinase; Reviewed Back     alignment and domain information
>COG0549 ArcC Carbamate kinase [Amino acid transport and metabolism] Back     alignment and domain information
>COG0263 ProB Glutamate 5-kinase [Amino acid transport and metabolism] Back     alignment and domain information
>cd04239 AAK_UMPK-like AAK_UMPK-like: UMP kinase (UMPK)-like, the microbial/chloroplast uridine monophosphate kinase (uridylate kinase) enzyme that catalyzes UMP phosphorylation and plays a key role in pyrimidine nucleotide biosynthesis Back     alignment and domain information
>cd04253 AAK_UMPK-PyrH-Pf AAK_UMPK-PyrH-Pf: UMP kinase (UMPK)-Pf, the mostly archaeal uridine monophosphate kinase (uridylate kinase) enzymes that catalyze UMP phosphorylation and play a key role in pyrimidine nucleotide biosynthesis; regulation of this process is via feed-back control and via gene repression of carbamoyl phosphate synthetase (the first enzyme of the pyrimidine biosynthesis pathway) Back     alignment and domain information
>PRK09411 carbamate kinase; Reviewed Back     alignment and domain information
>PRK00358 pyrH uridylate kinase; Provisional Back     alignment and domain information
>TIGR01092 P5CS delta l-pyrroline-5-carboxylate synthetase; InterPro: IPR005766 delta l-pyrroline-5-carboxylate synthetase contains a glutamate 5-kinase (ProB, 2 Back     alignment and domain information
>cd04254 AAK_UMPK-PyrH-Ec UMP kinase (UMPK)-Ec, the microbial/chloroplast uridine monophosphate kinase (uridylate kinase) enzyme that catalyzes UMP phosphorylation and plays a key role in pyrimidine nucleotide biosynthesis; regulation of this process is via feed-back control and via gene repression of carbamoyl phosphate synthetase (the first enzyme of the pyrimidine biosynthesis pathway) Back     alignment and domain information
>cd04240 AAK_UC AAK_UC: Uncharacterized (UC) amino acid kinase-like proteins found mainly in archaea and a few bacteria Back     alignment and domain information
>TIGR00657 asp_kinases aspartate kinase; InterPro: IPR001341 Bacteria, plants and fungi metabolise aspartic acid to produce four amino acids - lysine, threonine, methionine and isoleucine - in a series of reactions known as the aspartate pathway Back     alignment and domain information
>KOG1154 consensus Back     alignment and domain information
>TIGR02076 pyrH_arch uridylate kinase, putative; InterPro: IPR011818 Uridylate kinases (also known as UMP kinases) are key enzymes in the synthesis of nucleoside triphosphates Back     alignment and domain information
>PRK07431 aspartate kinase; Provisional Back     alignment and domain information
>cd04260 AAK_AKi-DapG-BS AAK_AKi-DapG-BS: Amino Acid Kinase Superfamily (AAK), AKi-DapG; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the diaminopimelate-sensitive aspartokinase isoenzyme AKI (DapG), a monofunctional class enzyme found in Bacilli (Bacillus subtilis 168), Clostridia, and Actinobacteria bacterial species Back     alignment and domain information
>PRK08841 aspartate kinase; Validated Back     alignment and domain information
>COG0527 LysC Aspartokinases [Amino acid transport and metabolism] Back     alignment and domain information
>cd04255 AAK_UMPK-MosAB AAK_UMPK-MosAB: This CD includes the alpha and beta subunits of the Mo storage protein (MosA and MosB) which are related to uridine monophosphate kinase (UMPK) enzymes that catalyze the phosphorylation of UMP by ATP, yielding UDP, and playing a key role in pyrimidine nucleotide biosynthesis Back     alignment and domain information
>PRK08210 aspartate kinase I; Reviewed Back     alignment and domain information
>cd04246 AAK_AK-DapG-like AAK_AK-DapG-like: Amino Acid Kinase Superfamily (AAK), AK-DapG-like; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the diaminopimelate-sensitive aspartokinase isoenzyme AKI (DapG), a monofunctional enzymes found in Bacilli (Bacillus subtilis 168), Clostridia, and Actinobacteria bacterial species, as well as, the catalytic AK domain of the lysine-sensitive aspartokinase isoenzyme AKII of Bacillus subtilis 168, the lysine plus threonine-sensitive aspartokinase of Corynebacterium glutamicum, and related isoenzymes Back     alignment and domain information
>cd04261 AAK_AKii-LysC-BS AAK_AKii-LysC-BS: Amino Acid Kinase Superfamily (AAK), AKii; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the lysine-sensitive aspartokinase isoenzyme AKII of Bacillus subtilis 168, and the lysine plus threonine-sensitive aspartokinase of Corynebacterium glutamicum, and related sequences Back     alignment and domain information
>PRK06635 aspartate kinase; Reviewed Back     alignment and domain information
>cd04234 AAK_AK AAK_AK: Amino Acid Kinase Superfamily (AAK), Aspartokinase (AK); this CD includes the N-terminal catalytic domain of aspartokinase (4-L-aspartate-4-phosphotransferase;) Back     alignment and domain information
>PRK09034 aspartate kinase; Reviewed Back     alignment and domain information
>PRK06291 aspartate kinase; Provisional Back     alignment and domain information
>PRK05925 aspartate kinase; Provisional Back     alignment and domain information
>cd04245 AAK_AKiii-YclM-BS AAK_AKiii-YclM-BS: Amino Acid Kinase Superfamily (AAK), AKiii-YclM-BS; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the lysine plus threonine-sensitive aspartokinase isoenzyme AKIII, a monofunctional class enzyme found in Bacilli (Bacillus subtilis YclM) and Clostridia species Back     alignment and domain information
>cd04244 AAK_AK-LysC-like AAK_AK-LysC-like: Amino Acid Kinase Superfamily (AAK), AK-LysC-like; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the lysine-sensitive AK isoenzyme found in higher plants Back     alignment and domain information
>cd04247 AAK_AK-Hom3 AAK_AK-Hom3: Amino Acid Kinase Superfamily (AAK), AK-Hom3; this CD includes the N-terminal catalytic domain of the aspartokinase HOM3, a monofunctional class enzyme found in Saccharomyces cerevisiae and other related AK domains Back     alignment and domain information
>cd04243 AAK_AK-HSDH-like AAK_AK-HSDH-like: Amino Acid Kinase Superfamily (AAK), AK-HSDH-like; this family includes the N-terminal catalytic domain of aspartokinase (AK) of the bifunctional enzyme AK- homoserine dehydrogenase (HSDH) Back     alignment and domain information
>cd04257 AAK_AK-HSDH AAK_AK-HSDH: Amino Acid Kinase Superfamily (AAK), AK-HSDH; this CD includes the N-terminal catalytic domain of aspartokinase (AK) of the bifunctional enzyme AK - homoserine dehydrogenase (HSDH) Back     alignment and domain information
>PRK12443 uridylate kinase; Reviewed Back     alignment and domain information
>PRK08373 aspartate kinase; Validated Back     alignment and domain information
>PRK09466 metL bifunctional aspartate kinase II/homoserine dehydrogenase II; Provisional Back     alignment and domain information
>TIGR02075 pyrH_bact uridylate kinase; InterPro: IPR015963 Uridylate kinases (also known as UMP kinases) are key enzymes in the synthesis of nucleoside triphosphates Back     alignment and domain information
>cd04258 AAK_AKiii-LysC-EC AAK_AKiii-LysC-EC: Amino Acid Kinase Superfamily (AAK), AKiii-LysC-EC: this CD includes the N-terminal catalytic aspartokinase (AK) domain of the lysine-sensitive aspartokinase isoenzyme AKIII Back     alignment and domain information
>COG2054 Uncharacterized archaeal kinase related to aspartokinases, uridylate kinases [General function prediction only] Back     alignment and domain information
>COG0528 PyrH Uridylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK09084 aspartate kinase III; Validated Back     alignment and domain information
>PRK09436 thrA bifunctional aspartokinase I/homeserine dehydrogenase I; Provisional Back     alignment and domain information
>PRK08961 bifunctional aspartate kinase/diaminopimelate decarboxylase protein; Provisional Back     alignment and domain information
>cd04259 AAK_AK-DapDC AAK_AK-DapDC: Amino Acid Kinase Superfamily (AAK), AK-DapDC; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the bifunctional enzyme AK - DAP decarboxylase (DapDC) found in some bacteria Back     alignment and domain information
>cd04248 AAK_AK-Ectoine AAK_AK-Ectoine: Amino Acid Kinase Superfamily (AAK), AK-Ectoine; this CD includes the N-terminal catalytic domain of the aspartokinase of the ectoine (1,4,5,6-tetrahydro-2-methyl pyrimidine-4-carboxylate) biosynthetic pathway found in Methylomicrobium alcaliphilum, Vibrio cholerae, and other various halotolerant or halophilic bacteria Back     alignment and domain information
>PRK09181 aspartate kinase; Validated Back     alignment and domain information
>TIGR02078 AspKin_pair Pyrococcus aspartate kinase subunit, putative; InterPro: IPR011819 This family consists of proteins restricted to and found as paralogous pairs (typically close together) in species of Pyrococcus, a hyperthermophilic archaeal genus Back     alignment and domain information
>KOG0456 consensus Back     alignment and domain information
>TIGR00656 asp_kin_monofn asparate kinase, monofunctional class; InterPro: IPR005260 Aspartate kinase catalyzes the first step in the biosynthesis of Lys (via its precursor diaminopimelate), Met, and Thr Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target142
2jj4_A321 The Complex Of Pii And Acetylglutamate Kinase From 2e-33
2buf_A300 Arginine Feed-Back Inhibitable Acetylglutamate Kina 2e-32
2bty_A282 Acetylglutamate Kinase From Thermotoga Maritima Com 5e-32
2rd5_B284 Structural Basis For The Regulation Of N-Acetylglut 1e-27
2rd5_A282 Structural Basis For The Regulation Of N-Acetylglut 1e-27
2ap9_A299 Crystal Structure Of Acetylglutamate Kinase From My 3e-21
2r8v_A 456 Native Structure Of N-Acetylglutamate Synthase From 2e-19
2r98_A 456 Crystal Structure Of N-Acetylglutamate Synthase (Se 7e-18
1gs5_A258 N-Acetyl-L-Glutamate Kinase From Escherichia Coli C 2e-15
1gsj_A258 Selenomethionine Substituted N-Acetyl-L-Glutamate K 4e-15
2egx_A269 Crystal Structure Of The Putative Acetylglutamate K 8e-15
3l86_A279 The Crystal Structure Of Smu.665 From Streptococcus 1e-12
2j5t_G 358 Glutamate 5-Kinase From Escherichia Coli Complexed 1e-05
2j5t_C 357 Glutamate 5-Kinase From Escherichia Coli Complexed 1e-05
2j5t_E 367 Glutamate 5-Kinase From Escherichia Coli Complexed 6e-05
2w21_A259 Crystal Structure Of The Aminoacid Kinase Domain Of 6e-05
2j5v_A 367 Glutamate 5-Kinase From Escherichia Coli Complexed 7e-05
2j5t_A 357 Glutamate 5-Kinase From Escherichia Coli Complexed 8e-05
3ll9_A269 X-Ray Structures Of Isopentenyl Phosphate Kinase Le 1e-04
2j5t_F 356 Glutamate 5-Kinase From Escherichia Coli Complexed 5e-04
2j5t_B 354 Glutamate 5-Kinase From Escherichia Coli Complexed 0.002
1e19_A314 Structure Of The Carbamate Kinase-Like Carbamoyl Ph 0.004
>gi|158429027|pdb|2JJ4|A Chain A, The Complex Of Pii And Acetylglutamate Kinase From Synechococcus Elongatus Pcc7942 Length = 321 Back     alignment and structure
 Score =  145 bits (366), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 61/144 (42%), Positives = 98/144 (68%), Gaps = 3/144 (2%)

Query: 1   LGFVGNVIKVNRTILDLLIKSGIIPVIAPIAPGYDGATYNINADTFAGAIAEKLNVIRLL 60
           +GFVG V  VN  +++ L++ G IPVI+ +A   +G ++NINADT AG IA  LN  +L+
Sbjct: 166 IGFVGEVNSVNSEVIEPLLERGYIPVISSVAADENGQSFNINADTVAGEIAAALNAEKLI 225

Query: 61  FLTDVPGVLDKNRQLISKL---SINEARTLIKDGTISGGMIPKIETSIKAIENGVKSVAI 117
            LTD  G+L+  ++  S +   +I ++R LI  G + GGMIPK++  I+++  GV++  I
Sbjct: 226 LLTDTRGILEDPKRPESLIPRLNIPQSRELIAQGIVGGGMIPKVDCCIRSLAQGVRAAHI 285

Query: 118 LDGKKPHSILMEIFTKNGSGTLLI 141
           +DG+ PH++L+EIFT  G GT+++
Sbjct: 286 IDGRIPHALLLEIFTDAGIGTMIV 309


>gi|85544321|pdb|2BUF|A Chain A, Arginine Feed-Back Inhibitable Acetylglutamate Kinase Length = 300 Back     alignment and structure
gi|313507214|pdb|2BTY|A Chain A, Acetylglutamate Kinase From Thermotoga Maritima Complexed With Its Inhibitor Arginine Length = 282 Back     alignment and structure
>gi|75766294|pdb|2AP9|A Chain A, Crystal Structure Of Acetylglutamate Kinase From Mycobacterium Tuberculosis Cdc1551 Length = 299 Back     alignment and structure
>gi|165761077|pdb|2R8V|A Chain A, Native Structure Of N-Acetylglutamate Synthase From Neisseria Gonorrhoeae Length = 456 Back     alignment and structure
gi|21465503|pdb|1GS5|A Chain A, N-Acetyl-L-Glutamate Kinase From Escherichia Coli Complexed With Its Substrate N-Acetylglutamate And Its Substrate Analog Amppnp Length = 258 Back     alignment and structure
>gi|21465504|pdb|1GSJ|A Chain A, Selenomethionine Substituted N-Acetyl-L-Glutamate Kinase From Escherichia Coli Complexed With Its Substrate N- Acetyl-L-Glutamate And Its Substrate Analog Amppnp Length = 258 Back     alignment and structure
gi|158428337|pdb|2EGX|A Chain A, Crystal Structure Of The Putative Acetylglutamate Kinase From Thermus Thermophilus Length = 269 Back     alignment and structure
>gi|316983219|pdb|3L86|A Chain A, The Crystal Structure Of Smu.665 From Streptococcus Mutans Ua159 Length = 279 Back     alignment and structure
>gi|268612106|pdb|2W21|A Chain A, Crystal Structure Of The Aminoacid Kinase Domain Of The Glutamate 5 Kinase Of Escherichia Coli Length = 259 Back     alignment and structure
>gi|134104656|pdb|2J5V|A Chain A, Glutamate 5-Kinase From Escherichia Coli Complexed With Glutamyl-5-Phosphate And Pyroglutamic Acid Length = 367 Back     alignment and structure
>gi|297343038|pdb|3LL9|A Chain A, X-Ray Structures Of Isopentenyl Phosphate Kinase Length = 269 Back     alignment and structure
gi|9955156|pdb|1E19|A Chain A, Structure Of The Carbamate Kinase-Like Carbamoyl Phosphate Synthetase From The Hyperthermophilic Archaeon Pyrococcus Furiosus Bound To Adp Length = 314 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target142
2buf_A300 Acetylglutamate kinase; acetyglutamate kinase, ADP, arg 8e-33
2rd5_A298 Acetylglutamate kinase-like protein; protein-protein co 5e-31
3d2m_A 456 Putative acetylglutamate synthase; protein-COA-Glu tern 2e-30
2bty_A282 Acetylglutamate kinase; N-acetyl-L-glutamate kinase, am 8e-30
2v5h_A321 Acetylglutamate kinase; amino-acid biosynthesis, transc 7e-29
2ap9_A299 NAG kinase, acetylglutamate kinase, AGK; structural gen 7e-26
1gs5_A258 Acetylglutamate kinase; carbamate kinase, amino acid ki 6e-22
2egx_A269 Putative acetylglutamate kinase; structural genomics, N 1e-21
3kzf_A317 Carbamate kinase; arginine dihydrolase pathway, drug ta 3e-21
1e19_A314 Carbamate kinase-like carbamoylphosphate synthetase; tr 4e-21
2we5_A310 Carbamate kinase 1; arginine catabolism, arginine metab 7e-21
3ll9_A269 Isopentenyl phosphate kinase; mevalonate biosynthesis i 1e-19
1b7b_A310 Carbamate kinase; phosphotransferase, arginine cataboli 9e-19
3ll5_A249 Gamma-glutamyl kinase related protein; alternate mevalo 3e-18
2e9y_A316 Carbamate kinase; transferase, structural genomics, NPP 2e-17
3k4o_A266 Isopentenyl phosphate kinase; small molecule kinase, AT 9e-17
2ogx_B270 Molybdenum storage protein subunit beta; open alpha/bet 2e-14
3d40_A286 FOMA protein; fosfomycin, antibiotic resistance, kinase 4e-13
2ogx_A276 Molybdenum storage protein subunit alpha; open alpha/be 4e-11
2ako_A251 Glutamate 5-kinase; structural genomics, PSI, protein s 4e-07
2a1f_A247 Uridylate kinase; PYRH, structural genomics, PSI, prote 7e-04
>2buf_A Acetylglutamate kinase; acetyglutamate kinase, ADP, arginine biosynthesis, FEED-BACK inhibition, hexamer, transferase; HET: NLG ADP; 2.95A {Pseudomonas aeruginosa} SCOP: c.73.1.2 Length = 300 Back     alignment and structure
 Score =  134 bits (338), Expect = 8e-33
 Identities = 67/139 (48%), Positives = 98/139 (70%)

Query: 1   LGFVGNVIKVNRTILDLLIKSGIIPVIAPIAPGYDGATYNINADTFAGAIAEKLNVIRLL 60
           +G VG V  VN  +L++L+K   IPVIAPI  G +G +YNINAD  AG +AE L   +L+
Sbjct: 155 IGHVGEVTGVNVGLLNMLVKGDFIPVIAPIGVGSNGESYNINADLVAGKVAEALKAEKLM 214

Query: 61  FLTDVPGVLDKNRQLISKLSINEARTLIKDGTISGGMIPKIETSIKAIENGVKSVAILDG 120
            LT++ G++DK  Q+++ LS  +   LI DGTI GGM+PKI  +++A++ GV S  I+DG
Sbjct: 215 LLTNIAGLMDKQGQVLTGLSTEQVNELIADGTIYGGMLPKIRCALEAVQGGVTSAHIIDG 274

Query: 121 KKPHSILMEIFTKNGSGTL 139
           + P+++L+EIFT +G GTL
Sbjct: 275 RVPNAVLLEIFTDSGVGTL 293


>2rd5_A Acetylglutamate kinase-like protein; protein-protein complex, regulation of arginine biosynthesis, nitrogen metabolism, kinase, transferase, transcription; HET: ARG ADP NLG ATP; 2.51A {Arabidopsis thaliana} Length = 298 Back     alignment and structure
>3d2m_A Putative acetylglutamate synthase; protein-COA-Glu ternary complex, transferase; HET: COA GLU; 2.21A {Neisseria gonorrhoeae} PDB: 2r8v_A* 3b8g_A* 2r98_A* 3d2p_A* Length = 456 Back     alignment and structure
>2bty_A Acetylglutamate kinase; N-acetyl-L-glutamate kinase, amino acid kinase, phosphoryl group transfer, arginine metabolism, transferase; HET: ARG NLG; 2.75A {Thermotoga maritima} SCOP: c.73.1.2 Length = 282 Back     alignment and structure
>2v5h_A Acetylglutamate kinase; amino-acid biosynthesis, transcription regulation, transferase, cyanobacteria, transcription; HET: NLG; 2.75A {Synechococcus elongatus} PDB: 2jj4_A* Length = 321 Back     alignment and structure
>2ap9_A NAG kinase, acetylglutamate kinase, AGK; structural genomics, protein structure initiative, NYSGXRC, PSI; 2.80A {Mycobacterium tuberculosis CDC1551} SCOP: c.73.1.2 Length = 299 Back     alignment and structure
>1gs5_A Acetylglutamate kinase; carbamate kinase, amino acid kinase, arginine biosynthesis, phosphoryl group transfer, protein crystallography; HET: NLG ANP; 1.5A {Escherichia coli} SCOP: c.73.1.2 PDB: 1gsj_A* 1oh9_A* 1oha_A* 1ohb_A* Length = 258 Back     alignment and structure
>2egx_A Putative acetylglutamate kinase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.92A {Thermus thermophilus HB8} Length = 269 Back     alignment and structure
>3kzf_A Carbamate kinase; arginine dihydrolase pathway, drug target, transferase; 3.00A {Giardia lamblia atcc 50803} Length = 317 Back     alignment and structure
>1e19_A Carbamate kinase-like carbamoylphosphate synthetase; transferase, hyperthermophiles, ADP site, phosphoryl group transfer; HET: ADP; 1.5A {Pyrococcus furiosus} SCOP: c.73.1.1 Length = 314 Back     alignment and structure
>2we5_A Carbamate kinase 1; arginine catabolism, arginine metabolism, ATP synthesys, open alpha/beta sheet, phosphotransferase, transferase; HET: ADP; 1.39A {Enterococcus faecalis} PDB: 1b7b_A 2we4_A* Length = 310 Back     alignment and structure
>3ll9_A Isopentenyl phosphate kinase; mevalonate biosynthesis isoprenoid, transferase; HET: ADP; 2.15A {Methanothermobacter thermautotrophicusorganism_taxid} Length = 269 Back     alignment and structure
>1b7b_A Carbamate kinase; phosphotransferase, arginine catabolism, ATP synthesys, acylphosphate-making enzymes, open alpha/beta sheet; 2.80A {Enterococcus faecium} SCOP: c.73.1.1 Length = 310 Back     alignment and structure
>3ll5_A Gamma-glutamyl kinase related protein; alternate mevalonate pathway, isopentenyl phsophate kinase, beta-alpha sandwich fold; HET: MSE ADP IPE ATP IP8; 1.99A {Thermoplasma acidophilum} PDB: 3lkk_A* Length = 249 Back     alignment and structure
>2e9y_A Carbamate kinase; transferase, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.80A {Aeropyrum pernix K1} Length = 316 Back     alignment and structure
>3k4o_A Isopentenyl phosphate kinase; small molecule kinase, ATP-binding, transferase, methanocald jannaschii, isopentenyl monophosphate; 2.05A {Methanocaldococcus jannaschii} PDB: 3k4y_A* 3k52_A* 3k56_A* Length = 266 Back     alignment and structure
>2ogx_B Molybdenum storage protein subunit beta; open alpha/beta structure, metal binding protein; HET: ATP; 1.60A {Azotobacter vinelandii} Length = 270 Back     alignment and structure
>3d40_A FOMA protein; fosfomycin, antibiotic resistance, kinase, phosphoryl transfer, transferase; 1.53A {Streptomyces wedmorensis} PDB: 3d41_A* Length = 286 Back     alignment and structure
>2ogx_A Molybdenum storage protein subunit alpha; open alpha/beta structure, metal binding protein; HET: ATP; 1.60A {Azotobacter vinelandii} Length = 276 Back     alignment and structure
>2ako_A Glutamate 5-kinase; structural genomics, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics, nysgxrc; HET: ADP; 2.20A {Campylobacter jejuni} SCOP: c.73.1.3 Length = 251 Back     alignment and structure
>2a1f_A Uridylate kinase; PYRH, structural genomics, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.10A {Haemophilus influenzae} SCOP: c.73.1.3 PDB: 2bne_A* 2bnf_A* 2v4y_A* 2bnd_A* Length = 247 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target142
2buf_A300 Acetylglutamate kinase; acetyglutamate kinase, ADP, arg 100.0
2v5h_A321 Acetylglutamate kinase; amino-acid biosynthesis, transc 100.0
2bty_A282 Acetylglutamate kinase; N-acetyl-L-glutamate kinase, am 100.0
2rd5_A298 Acetylglutamate kinase-like protein; protein-protein co 100.0
2ap9_A299 NAG kinase, acetylglutamate kinase, AGK; structural gen 100.0
3d2m_A 456 Putative acetylglutamate synthase; protein-COA-Glu tern 100.0
2egx_A269 Putative acetylglutamate kinase; structural genomics, N 100.0
3kzf_A317 Carbamate kinase; arginine dihydrolase pathway, drug ta 99.98
1e19_A314 Carbamate kinase-like carbamoylphosphate synthetase; tr 99.97
2we5_A310 Carbamate kinase 1; arginine catabolism, arginine metab 99.97
2e9y_A316 Carbamate kinase; transferase, structural genomics, NPP 99.97
3ll9_A269 Isopentenyl phosphate kinase; mevalonate biosynthesis i 99.94
3ll5_A249 Gamma-glutamyl kinase related protein; alternate mevalo 99.93
3d40_A286 FOMA protein; fosfomycin, antibiotic resistance, kinase 99.93
3k4o_A266 Isopentenyl phosphate kinase; small molecule kinase, AT 99.93
1gs5_A258 Acetylglutamate kinase; carbamate kinase, amino acid ki 99.92
2ako_A251 Glutamate 5-kinase; structural genomics, PSI, protein s 99.85
2j5v_A 367 Glutamate 5-kinase; proline biosynthesis, gamma glutamy 99.83
2ogx_B270 Molybdenum storage protein subunit beta; open alpha/bet 99.82
2brx_A244 Uridylate kinase; UMP kinase, amino acid kinase, phosph 99.82
2ogx_A276 Molybdenum storage protein subunit alpha; open alpha/be 99.81
2j4j_A226 Uridylate kinase; transferase, nucleoside monophosphate 99.74
2ij9_A219 Uridylate kinase; structural genomics, protein structur 99.73
3ek6_A243 Uridylate kinase; UMPK unique GTP binding site, alloste 99.63
3nwy_A281 Uridylate kinase; allosterically activated form, AAK fo 99.62
2a1f_A247 Uridylate kinase; PYRH, structural genomics, PSI, prote 99.55
1ybd_A239 Uridylate kinase; alpha/beta/alpha fold, hexamer, struc 99.44
2va1_A256 Uridylate kinase; UMPK, transferase, pyrimidine biosynt 99.32
2jjx_A255 Uridylate kinase, UMP kinase; structural genomics, pyri 99.32
3c1m_A 473 Probable aspartokinase; allosteric inhibition, threonin 99.03
2cdq_A 510 Aspartokinase; aspartate kinase, amino acid metabolism, 98.94
2j0w_A 449 Lysine-sensitive aspartokinase 3; feedback inhibition, 98.91
3ab4_A 421 Aspartokinase; aspartate kinase, concerted inhibition, 98.82
3l76_A 600 Aspartokinase; allostery, ACT domains, kinase transfera 98.74
1z9d_A252 Uridylate kinase, UK, UMP kinase; structural genomics, 99.35
>2buf_A Acetylglutamate kinase; acetyglutamate kinase, ADP, arginine biosynthesis, FEED-BACK inhibition, hexamer, transferase; HET: NLG ADP; 2.95A {Pseudomonas aeruginosa} SCOP: c.73.1.2 Back     alignment and structure
Probab=100.00  E-value=1.2e-43  Score=260.45  Aligned_cols=142  Identities=47%  Similarity=0.842  Sum_probs=139.5

Q ss_pred             CCCCCCEEEECHHHHHHHHHCCCEEEECCCCCCCCCCEECCCHHHHHHHHHHHHCHHHHHHHCCCCCEEECCCCCCCCCC
Q ss_conf             98552013556999999997798499857431787320066147999999986251133432267633534555556338
Q 537021.9.peg.3    1 LGFVGNVIKVNRTILDLLIKSGIIPVIAPIAPGYDGATYNINADTFAGAIAEKLNVIRLLFLTDVPGVLDKNRQLISKLS   80 (142)
Q Consensus         1 ~g~~G~v~~vd~~~i~~lL~~g~iPVi~pig~~~~G~~~nin~D~~a~~lA~~l~A~kli~ltdv~Gv~d~~~~~i~~i~   80 (142)
                      +||+|+|+++|.+.|+.+|++|+|||++|++++.+|+.+|+|+|++|+++|.+|+|+||||+||++|+|+.+++++++++
T Consensus       155 ~g~~g~v~~v~~~~I~~lL~~g~Ipvi~~~~~~~~g~~~nid~D~~Aa~lA~~l~AdkLI~ltdv~Gv~~~~g~~~~~~~  234 (300)
T 2buf_A          155 IGHVGEVTGVNVGLLNMLVKGDFIPVIAPIGVGSNGESYNINADLVAGKVAEALKAEKLMLLTNIAGLMDKQGQVLTGLS  234 (300)
T ss_dssp             CBSBEEEEEECHHHHHHHHHTTCEEEEEEEEECTTSCEEECCHHHHHHHHHHHHTCSEEEEEESSSCCBCTTSCBCCEEC
T ss_pred             CCCCCCCCCCCHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHCCCEEEEECCCCCEECCCCCCCCCCC
T ss_conf             56544456565699999980998599647667875101058899999999987267859998288773389997321078


Q ss_pred             HHHHHHHHHCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHCCCCCCCEECC
Q ss_conf             88999996269767867899999999998499889995257876899999679986634549
Q 537021.9.peg.3   81 INEARTLIKDGTISGGMIPKIETSIKAIENGVKSVAILDGKKPHSILMEIFTKNGSGTLLIP  142 (142)
Q Consensus        81 ~~e~~~l~~~~~~~~gm~~Ki~~a~~a~~~Gv~~v~i~~~~~~~~ll~elft~~g~GT~i~p  142 (142)
                      ..++++++++++++|||.+|+++|.+|+++|++||||+|++.|++|+.||||++|+||+|.|
T Consensus       235 ~~~~~~l~~~~~~~gGM~~Kl~aA~~al~~GV~rv~I~~g~~~~~ll~elft~~g~GT~I~~  296 (300)
T 2buf_A          235 TEQVNELIADGTIYGGMLPKIRCALEAVQGGVTSAHIIDGRVPNAVLLEIFTDSGVGTLISN  296 (300)
T ss_dssp             HHHHHHHHHTTCSCTTHHHHHHHHHHHHHTTCSEEEEEETTSTTHHHHHHSSTTCCSEEEEC
T ss_pred             HHHHHHHHHCCCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHCCCCCEEEEEC
T ss_conf             89999999759837609999999999998699989996599988899998179998207946



>2v5h_A Acetylglutamate kinase; amino-acid biosynthesis, transcription regulation, transferase, cyanobacteria, transcription; HET: NLG; 2.75A {Synechococcus elongatus} PDB: 2jj4_A* Back     alignment and structure
>2bty_A Acetylglutamate kinase; N-acetyl-L-glutamate kinase, amino acid kinase, phosphoryl group transfer, arginine metabolism, transferase; HET: ARG NLG; 2.75A {Thermotoga maritima} SCOP: c.73.1.2 Back     alignment and structure
>2rd5_A Acetylglutamate kinase-like protein; protein-protein complex, regulation of arginine biosynthesis, nitrogen metabolism, kinase, transferase, transcription; HET: ARG ADP NLG ATP; 2.51A {Arabidopsis thaliana} Back     alignment and structure
>2ap9_A NAG kinase, acetylglutamate kinase, AGK; structural genomics, protein structure initiative, NYSGXRC, PSI; 2.80A {Mycobacterium tuberculosis CDC1551} SCOP: c.73.1.2 Back     alignment and structure
>3d2m_A Putative acetylglutamate synthase; protein-COA-Glu ternary complex, transferase; HET: COA GLU; 2.21A {Neisseria gonorrhoeae} PDB: 2r8v_A* 3b8g_A* 2r98_A* 3d2p_A* Back     alignment and structure
>2egx_A Putative acetylglutamate kinase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.92A {Thermus thermophilus HB8} Back     alignment and structure
>3kzf_A Carbamate kinase; arginine dihydrolase pathway, drug target, transferase; 3.00A {Giardia lamblia atcc 50803} Back     alignment and structure
>1e19_A Carbamate kinase-like carbamoylphosphate synthetase; transferase, hyperthermophiles, ADP site, phosphoryl group transfer; HET: ADP; 1.5A {Pyrococcus furiosus} SCOP: c.73.1.1 Back     alignment and structure
>2we5_A Carbamate kinase 1; arginine catabolism, arginine metabolism, ATP synthesys, open alpha/beta sheet, phosphotransferase, transferase; HET: ADP; 1.39A {Enterococcus faecalis} PDB: 1b7b_A 2we4_A* Back     alignment and structure
>2e9y_A Carbamate kinase; transferase, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.80A {Aeropyrum pernix K1} Back     alignment and structure
>3ll9_A Isopentenyl phosphate kinase; mevalonate biosynthesis isoprenoid, transferase; HET: ADP; 2.15A {Methanothermobacter thermautotrophicusorganism_taxid} Back     alignment and structure
>3ll5_A Gamma-glutamyl kinase related protein; alternate mevalonate pathway, isopentenyl phsophate kinase, beta-alpha sandwich fold; HET: MSE ADP IPE ATP IP8; 1.99A {Thermoplasma acidophilum} PDB: 3lkk_A* Back     alignment and structure
>3d40_A FOMA protein; fosfomycin, antibiotic resistance, kinase, phosphoryl transfer, transferase; 1.53A {Streptomyces wedmorensis} PDB: 3d41_A* Back     alignment and structure
>3k4o_A Isopentenyl phosphate kinase; small molecule kinase, ATP-binding, transferase, methanocald jannaschii, isopentenyl monophosphate; 2.05A {Methanocaldococcus jannaschii} PDB: 3k4y_A* 3k52_A* 3k56_A* Back     alignment and structure
>1gs5_A Acetylglutamate kinase; carbamate kinase, amino acid kinase, arginine biosynthesis, phosphoryl group transfer, protein crystallography; HET: NLG ANP; 1.5A {Escherichia coli} SCOP: c.73.1.2 PDB: 1gsj_A* 1oh9_A* 1oha_A* 1ohb_A* 2wxb_A 2x2w_A* Back     alignment and structure
>2ako_A Glutamate 5-kinase; structural genomics, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics, nysgxrc; HET: ADP; 2.20A {Campylobacter jejuni} SCOP: c.73.1.3 Back     alignment and structure
>2j5v_A Glutamate 5-kinase; proline biosynthesis, gamma glutamyl kinase, amino-acid biosynthesis, transferase, feedback regulation, PUA domain; HET: RGP; 2.5A {Escherichia coli} PDB: 2j5t_A* 2w21_A Back     alignment and structure
>2ogx_B Molybdenum storage protein subunit beta; open alpha/beta structure, metal binding protein; HET: ATP; 1.60A {Azotobacter vinelandii} Back     alignment and structure
>2brx_A Uridylate kinase; UMP kinase, amino acid kinase, phosphoryl group transfer, pyrimidine biosynthesis, transferase; 2.40A {Pyrococcus furiosus} SCOP: c.73.1.3 PDB: 2ji5_A* 2bmu_A* 2bri_A* Back     alignment and structure
>2ogx_A Molybdenum storage protein subunit alpha; open alpha/beta structure, metal binding protein; HET: ATP; 1.60A {Azotobacter vinelandii} Back     alignment and structure
>2j4j_A Uridylate kinase; transferase, nucleoside monophosphate kinase, UMP kinase, aspartokinase fold, pyrimidine nucleotide synthesis; HET: U5P ACP 4TC; 2.1A {Sulfolobus solfataricus} PDB: 2j4k_A* 2j4l_A* Back     alignment and structure
>2ij9_A Uridylate kinase; structural genomics, protein structure initiative, PSI, nysgxrc; 2.90A {Archaeoglobus fulgidus dsm 4304} SCOP: c.73.1.3 Back     alignment and structure
>3ek6_A Uridylate kinase; UMPK unique GTP binding site, allosteric regulation, ATP-binding, cytoplasm kinase, nucleotide-binding; 2.34A {Xanthomonas campestris PV} PDB: 3ek5_A Back     alignment and structure
>3nwy_A Uridylate kinase; allosterically activated form, AAK fold, UMP kinase, transfe; HET: GTP UDP; 2.54A {Mycobacterium tuberculosis} Back     alignment and structure
>2a1f_A Uridylate kinase; PYRH, structural genomics, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.10A {Haemophilus influenzae} SCOP: c.73.1.3 PDB: 2bne_A* 2bnf_A* 2v4y_A* 2bnd_A* Back     alignment and structure
>1ybd_A Uridylate kinase; alpha/beta/alpha fold, hexamer, structural genomics, protein structure initiative, PSI; 2.60A {Neisseria meningitidis} SCOP: c.73.1.3 Back     alignment and structure
>2va1_A Uridylate kinase; UMPK, transferase, pyrimidine biosynthesis, amino acid kinase family; 2.50A {Ureaplasma parvum} Back     alignment and structure
>2jjx_A Uridylate kinase, UMP kinase; structural genomics, pyrimidine biosynthesis, ATP-binding, nucleotide-binding, OPPF, PYRH, cytoplasm; HET: ATP; 2.82A {Bacillus anthracis} Back     alignment and structure
>2cdq_A Aspartokinase; aspartate kinase, amino acid metabolism, ACT domain, allostery, S-adenosylmethionine, lysine, allosteric effector, plant; HET: TAR SAM LYS; 2.85A {Arabidopsis thaliana} SCOP: c.73.1.3 d.58.18.10 d.58.18.10 Back     alignment and structure
>2j0w_A Lysine-sensitive aspartokinase 3; feedback inhibition, allosteric regulation, ACT domain, transferase, amino acid biosynthesis; HET: ADP; 2.5A {Escherichia coli} SCOP: c.73.1.3 d.58.18.10 d.58.18.10 PDB: 2j0x_A* Back     alignment and structure
>3ab4_A Aspartokinase; aspartate kinase, concerted inhibition, alternative initiati amino-acid biosynthesis, ATP-binding; HET: LYS; 2.47A {Corynebacterium glutamicum} PDB: 3aaw_A* 3ab2_A Back     alignment and structure
>3l76_A Aspartokinase; allostery, ACT domains, kinase transferase; HET: LYS; 2.54A {Synechocystis} Back     alignment and structure
>1z9d_A Uridylate kinase, UK, UMP kinase; structural genomics, protein structure initiative, NYSGXRC, PYRH, putative uridylate kinase, PSI; 2.80A {Streptococcus pyogenes} SCOP: c.73.1.3 Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 142
d2bufa1300 c.73.1.2 (A:2-301) N-acetyl-l-glutamate kinase {Pseudom 7e-33
d2btya1282 c.73.1.2 (A:1-282) N-acetyl-l-glutamate kinase {Thermot 7e-30
d2ap9a1291 c.73.1.2 (A:6-296) N-acetyl-l-glutamate kinase {Mycobac 7e-26
d1b7ba_307 c.73.1.1 (A:) Carbamate kinase {Enterococcus faecium [T 2e-19
d1gs5a_258 c.73.1.2 (A:) N-acetyl-l-glutamate kinase {Escherichia 1e-17
d1e19a_313 c.73.1.1 (A:) Carbamate kinase {Archaeon Pyrococcus fur 2e-16
d2akoa1250 c.73.1.3 (A:2-251) Glutamate 5-kinase {Campylobacter je 9e-06
>d2bufa1 c.73.1.2 (A:2-301) N-acetyl-l-glutamate kinase {Pseudomonas aeruginosa [TaxId: 287]} Length = 300 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Carbamate kinase-like
superfamily: Carbamate kinase-like
family: N-acetyl-l-glutamate kinase
domain: N-acetyl-l-glutamate kinase
species: Pseudomonas aeruginosa [TaxId: 287]
 Score =  133 bits (335), Expect = 7e-33
 Identities = 67/139 (48%), Positives = 98/139 (70%)

Query: 1   LGFVGNVIKVNRTILDLLIKSGIIPVIAPIAPGYDGATYNINADTFAGAIAEKLNVIRLL 60
           +G VG V  VN  +L++L+K   IPVIAPI  G +G +YNINAD  AG +AE L   +L+
Sbjct: 155 IGHVGEVTGVNVGLLNMLVKGDFIPVIAPIGVGSNGESYNINADLVAGKVAEALKAEKLM 214

Query: 61  FLTDVPGVLDKNRQLISKLSINEARTLIKDGTISGGMIPKIETSIKAIENGVKSVAILDG 120
            LT++ G++DK  Q+++ LS  +   LI DGTI GGM+PKI  +++A++ GV S  I+DG
Sbjct: 215 LLTNIAGLMDKQGQVLTGLSTEQVNELIADGTIYGGMLPKIRCALEAVQGGVTSAHIIDG 274

Query: 121 KKPHSILMEIFTKNGSGTL 139
           + P+++L+EIFT +G GTL
Sbjct: 275 RVPNAVLLEIFTDSGVGTL 293


>d2btya1 c.73.1.2 (A:1-282) N-acetyl-l-glutamate kinase {Thermotoga maritima [TaxId: 2336]} Length = 282 Back     information, alignment and structure
>d2ap9a1 c.73.1.2 (A:6-296) N-acetyl-l-glutamate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 291 Back     information, alignment and structure
>d1b7ba_ c.73.1.1 (A:) Carbamate kinase {Enterococcus faecium [TaxId: 1352]} Length = 307 Back     information, alignment and structure
>d1gs5a_ c.73.1.2 (A:) N-acetyl-l-glutamate kinase {Escherichia coli [TaxId: 562]} Length = 258 Back     information, alignment and structure
>d1e19a_ c.73.1.1 (A:) Carbamate kinase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 313 Back     information, alignment and structure
>d2akoa1 c.73.1.3 (A:2-251) Glutamate 5-kinase {Campylobacter jejuni [TaxId: 197]} Length = 250 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target142
d2bufa1300 N-acetyl-l-glutamate kinase {Pseudomonas aeruginosa [Ta 100.0
d2btya1282 N-acetyl-l-glutamate kinase {Thermotoga maritima [TaxId 100.0
d2ap9a1291 N-acetyl-l-glutamate kinase {Mycobacterium tuberculosis 100.0
d1e19a_313 Carbamate kinase {Archaeon Pyrococcus furiosus [TaxId: 99.98
d1b7ba_307 Carbamate kinase {Enterococcus faecium [TaxId: 1352]} 99.97
d1gs5a_258 N-acetyl-l-glutamate kinase {Escherichia coli [TaxId: 5 99.94
d2akoa1250 Glutamate 5-kinase {Campylobacter jejuni [TaxId: 197]} 99.86
d2brxa1225 Uridylate kinase PyrH {Pyrococcus furiosus [TaxId: 2261 99.83
d2ij9a1219 Uridylate kinase PyrH {Archaeoglobus fulgidus [TaxId: 2 99.74
d2a1fa1236 Uridylate kinase PyrH {Haemophilus influenzae [TaxId: 7 99.66
d1ybda1236 Uridylate kinase PyrH {Neisseria meningitidis [TaxId: 4 99.51
d2hmfa1302 Aspartokinase {Methanococcus jannaschii [TaxId: 2190]} 99.1
d2cdqa1304 Aspartokinase {Thale cress (Arabidopsis thaliana) [TaxI 99.03
d2j0wa1292 Aspartokinase {Escherichia coli [TaxId: 562]} 98.96
d1z9da1238 Uridylate kinase PyrH {Streptococcus pyogenes [TaxId: 1 99.28
>d2bufa1 c.73.1.2 (A:2-301) N-acetyl-l-glutamate kinase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Carbamate kinase-like
superfamily: Carbamate kinase-like
family: N-acetyl-l-glutamate kinase
domain: N-acetyl-l-glutamate kinase
species: Pseudomonas aeruginosa [TaxId: 287]
Probab=100.00  E-value=5.6e-45  Score=266.62  Aligned_cols=142  Identities=47%  Similarity=0.842  Sum_probs=139.3

Q ss_pred             CCCCCCEEEECHHHHHHHHHCCCEEEECCCCCCCCCCEECCCHHHHHHHHHHHHCHHHHHHHCCCCCEEECCCCCCCCCC
Q ss_conf             98552013556999999997798499857431787320066147999999986251133432267633534555556338
Q 537021.9.peg.3    1 LGFVGNVIKVNRTILDLLIKSGIIPVIAPIAPGYDGATYNINADTFAGAIAEKLNVIRLLFLTDVPGVLDKNRQLISKLS   80 (142)
Q Consensus         1 ~g~~G~v~~vd~~~i~~lL~~g~iPVi~pig~~~~G~~~nin~D~~a~~lA~~l~A~kli~ltdv~Gv~d~~~~~i~~i~   80 (142)
                      +||+|+|++||++.|+.+++.|+|||++|++++.+|+.+|+|+|++|+++|.+|+|+|||||||++|+|+.+++++++++
T Consensus       155 ~g~~G~v~~v~~~~i~~ll~~g~Ipvis~~~~~~~G~~~nin~D~~Aa~lA~~L~AdkLI~Ltdv~Gv~~~~g~~~~~l~  234 (300)
T d2bufa1         155 IGHVGEVTGVNVGLLNMLVKGDFIPVIAPIGVGSNGESYNINADLVAGKVAEALKAEKLMLLTNIAGLMDKQGQVLTGLS  234 (300)
T ss_dssp             CBSBEEEEEECHHHHHHHHHTTCEEEEEEEEECTTSCEEECCHHHHHHHHHHHHTCSEEEEEESSSCCBCTTSCBCCEEC
T ss_pred             CCCCCCEEECCHHHHHHHHCCCCEEEECCCCCCCCCCHHCCCHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCHHHCC
T ss_conf             57651103034257999865998578614434765110025489999999987079759997277762267775111206


Q ss_pred             HHHHHHHHHCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHCCCCCCCEECC
Q ss_conf             88999996269767867899999999998499889995257876899999679986634549
Q 537021.9.peg.3   81 INEARTLIKDGTISGGMIPKIETSIKAIENGVKSVAILDGKKPHSILMEIFTKNGSGTLLIP  142 (142)
Q Consensus        81 ~~e~~~l~~~~~~~~gm~~Ki~~a~~a~~~Gv~~v~i~~~~~~~~ll~elft~~g~GT~i~p  142 (142)
                      .++++++++++++++||++|+++|.+|+++|++||||+||+.|++|+.||||++|+||+|.+
T Consensus       235 ~~~~~~li~~~~i~gGM~~Kl~aa~~a~~~Gv~rv~Ii~g~~~~~ll~eLft~~g~GT~I~~  296 (300)
T d2bufa1         235 TEQVNELIADGTIYGGMLPKIRCALEAVQGGVTSAHIIDGRVPNAVLLEIFTDSGVGTLISN  296 (300)
T ss_dssp             HHHHHHHHHTTCSCTTHHHHHHHHHHHHHTTCSEEEEEETTSTTHHHHHHSSTTCCSEEEEC
T ss_pred             HHHHHHHHHCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCHHHHHHCCCCCCEEEEEC
T ss_conf             79999999759807529999999999998399989995599998799997179996568955



>d2btya1 c.73.1.2 (A:1-282) N-acetyl-l-glutamate kinase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2ap9a1 c.73.1.2 (A:6-296) N-acetyl-l-glutamate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1e19a_ c.73.1.1 (A:) Carbamate kinase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1b7ba_ c.73.1.1 (A:) Carbamate kinase {Enterococcus faecium [TaxId: 1352]} Back     information, alignment and structure
>d1gs5a_ c.73.1.2 (A:) N-acetyl-l-glutamate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2akoa1 c.73.1.3 (A:2-251) Glutamate 5-kinase {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d2brxa1 c.73.1.3 (A:1-225) Uridylate kinase PyrH {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2ij9a1 c.73.1.3 (A:1-219) Uridylate kinase PyrH {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2a1fa1 c.73.1.3 (A:2-237) Uridylate kinase PyrH {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ybda1 c.73.1.3 (A:6-241) Uridylate kinase PyrH {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure