254780487

254780487

dithiobiotin synthetase

GeneID in NCBI database:8209476Locus tag:CLIBASIA_01870
Protein GI in NCBI database:254780487Protein Accession:YP_003064900.1
Gene range:+(409673, 410326)Protein Length:217aa
Gene description:dithiobiotin synthetase
COG prediction:none
KEGG prediction:bioD; dithiobiotin synthetase (EC:6.3.3.3); K01935 dethiobiotin synthetase [EC:6.3.3.3]
SEED prediction:Dethiobiotin synthetase (EC 6.3.3.3)
Pathway involved in KEGG:Biotin metabolism [PATH:las00780]
Subsystem involved in SEED:Biotin biosynthesis
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------
MKLRLVIVGTDTSVGKTIFASALVHALNAYYWKPIQSGMYEETDSKTIHRIGRIPKSHIIPEKWKLRTPASPHLAAEIDGVIIDPATINPPDINDSIIIEGIGGLLVPLTTEYLFIDLIERWQFPIILCARTSLGTINHSLLSLETLRNRNINIIGIAFIGDSMPKVEETIVKIGRIPHLGRLPKIDPIDPDVLHQKFQEHFTQSLLQKYFYESLTF
ccccEEEEcccccccHHHHHHHHHHHHHHcccccEEcccccccHHHHHHHHHcccccccccccccccccccHHHHHHHccccccHHHHHHHHHccEEEEEccccccccccccccHHHHHHHHcccEEEEEcccccHHHHHHHHHHHHHHccccEEEEEEcccccccHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHccc
cccEEEEEcccccccHHHHHHHHHHHHHHccccccccccccccHHHHHHHHccccccccccccccccccccHHHHHHHcccEEcHHHccccccccEEEEEccccccccccccHHHHHHHHHccccEEEEEEcccccHHHHHHHHHHHHHccccEEEEEEcccccHHHHHHHHHHccccccccccccccccHHHHHHHHHHHccHHHHHHHHHHcccc
MKLRLVIVGTDTSVGKTIFASALVHALNAYywkpiqsgmyeetdsktihrigripkshiipekwklrtpasphlaaeidgviidpatinppdindsiiiegiggllvplttEYLFIDLIERWQFPIILCArtslgtinhsLLSLETLRNRNINIIgiafigdsmpkVEETIVkigriphlgrlpkidpidpdvlHQKFQEHFTQSLLQKYFYESLTF
MKLRLVIVgtdtsvgkTIFASALVHALNAYYWKPIQSGMYEETDSKTIHRIgripkshiipekwkLRTPASPHLAAEIDGVIIDPATINPPDINDSIIIEGIGGLLVPLTTEYLFIDLIERWQFPIILCARTSLGTINHSLLSLETLRNRNINIIGiafigdsmpkVEETIVKIGRIPHLGRLPKIDPIDPDVLHQKFQEHFTQSLLQKYFYESLTF
MKLRLVIVGTDTSVGKTIFASALVHALNAYYWKPIQSGMYEETDSKTIHRIGRIPKSHIIPEKWKLRTPASPHLAAEIDGVIIDPATinppdindsiiiEGIGGLLVPLTTEYLFIDLIERWQFPIILCARTSLGTINHSLLSLETLRNRNINIIGIAFIGDSMPKVEETIVKIGRIPHLGRLPKIDPIDPDVLHQKFQEHFTQSLLQKYFYESLTF
*KLRLVIVGTDTSVGKTIFASALVHALNAYYWKPIQSGMYEETDSKTIHRIGRIPKSHIIPEKWKLRTPASPHLAAEIDGVIIDPATINPPDINDSIIIEGIGGLLVPLTTEYLFIDLIERWQFPIILCARTSLGTINHSLLSLETLRNRNINIIGIAFIGDSMPKVEETIVKIGRIPHLGRLPKIDPIDPDVLHQKFQEHFTQSLLQKYFYESLTF
MKLRLVIVGTDTSVGKTIFASALVHALNAYYWKPIQSGMYEETDSKTIHRIGRIPKSHIIPEKWKLRTPASPHLAAEIDGVIIDPATINPPDINDSIIIEGIGGLLVPLTTEYLFIDLIERWQFPIILCARTSLGTINHSLLSLETLRNRNINIIGIAFIGDSMPKVEETIVKIGRIPHLGRLPKIDPIDPDVLHQKFQEHFTQSLLQKYFYESLTF
*KLRLVIVGTDTSVGKTIFASALVHALNAYYWKPIQSGMYEETDSKTIHRIGRIPKSHIIPEKWKLRTPASPHLAAEIDGVIIDPATINPPDINDSIIIEGIGGLLVPLTTEYLFIDLIERWQFPIILCARTSLGTINHSLLSLETLRNRNINIIGIAFIGDSMPKVEETIVKIGRIPHLGRLPKIDPIDPDVLHQKFQEHFTQSLLQKYFYES***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKLRLVIVGTDTSVGKTIFASALVHALNAYYWKPIQSGMYEETDSKTIHRIGRIPKSHIIPEKWKLRTPASPHLAAEIDGVIIDPATINPPDINDSIIIEGIGGLLVPLTTEYLFIDLIERWQFPIILCARTSLGTINHSLLSLETLRNRNINIIGIAFIGDSMPKVEETIVKIGRIPHLGRLPKIDPIDPDVLHQKFQEHFTQSLLQKYFYESLTF
MKLRLVIVGTDTSVGKTIFASALVHALNAYYWKPIQSGMYEETDSKTIHRIGRIPKSHIIPEKWKLRTPASPHLAAEIDGVIIDPATINPPDINDSIIIEGIGGLLVPLTTEYLFIDLIERWQFPIILCARTSLGTINHSLLSLETLRNRNINIIGIAFIGDSMPKVEETIVKIGRIPHLGRLPKIDPIDPDVLHQKFQEHFTQSLLQKYFYESLTF
MKLRLVIVGTDTSVGKTIFASALVHALNAYYWKPIQSGMYEETDSKTIHRIGRIPKSHIIPEKWKLRTPASPHLAAEIDGVIIDPATINPPDINDSIIIEGIGGLLVPLTTEYLFIDLIERWQFPIILCARTSLGTINHSLLSLETLRNRNINIIGIAFIGDSMPKVEETIVKIGRIPHLGRLPKIDPIDPDVLHQKFQEHFTQSLLQKYFYESLTF

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target217 dithiobiotin synthetase [Candidatus Liberibacter asiati
315122056213 dithiobiotin synthetase [Candidatus Liberibacter solana 1 1e-95
227823050213 dithiobiotin synthetase [Sinorhizobium fredii NGR234] L 1 3e-65
15890969212 dithiobiotin synthetase [Agrobacterium tumefaciens str. 1 7e-63
332716725212 dethiobiotin synthase [Agrobacterium sp. H13-3] Length 1 2e-61
153010145212 dithiobiotin synthetase [Ochrobactrum anthropi ATCC 491 1 4e-61
27377209211 dithiobiotin synthetase [Bradyrhizobium japonicum USDA 1 6e-60
306845846212 dethiobiotin synthase [Brucella sp. BO1] Length = 212 1 8e-60
75676605213 dithiobiotin synthetase [Nitrobacter winogradskyi Nb-25 1 2e-59
256015271212 dithiobiotin synthetase [Brucella microti CCM 4915] Len 1 2e-59
85714581213 dithiobiotin synthetase [Nitrobacter sp. Nb-311A] Lengt 1 2e-59
>gi|315122056|ref|YP_004062545.1| dithiobiotin synthetase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 213 Back     alignment and organism information
 Score =  353 bits (906), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 164/213 (76%), Positives = 192/213 (90%)

Query: 1   MKLRLVIVGTDTSVGKTIFASALVHALNAYYWKPIQSGMYEETDSKTIHRIGRIPKSHII 60
           M LRLV+ GTDTSVGKTIF+SALVHALNAYYWKPIQ+GM E+TDS+ +  +GR+P+SHII
Sbjct: 1   MNLRLVVTGTDTSVGKTIFSSALVHALNAYYWKPIQAGMKEKTDSEIVQEMGRVPQSHII 60

Query: 61  PEKWKLRTPASPHLAAEIDGVIIDPATINPPDINDSIIIEGIGGLLVPLTTEYLFIDLIE 120
           PEKWKL+TPASPHL+AEIDGVIIDP TI+PP +N  IIIEG GGLLVPLTT+YLFIDLIE
Sbjct: 61  PEKWKLKTPASPHLSAEIDGVIIDPKTIDPPQLNHPIIIEGAGGLLVPLTTKYLFIDLIE 120

Query: 121 RWQFPIILCARTSLGTINHSLLSLETLRNRNINIIGIAFIGDSMPKVEETIVKIGRIPHL 180
           RW+FP ILCARTSLGTINH+LLSLE LR+RNI ++G+AFIGDSMPKVE+TI KIG+IP L
Sbjct: 121 RWKFPTILCARTSLGTINHTLLSLEALRHRNIKVLGVAFIGDSMPKVEKTITKIGQIPCL 180

Query: 181 GRLPKIDPIDPDVLHQKFQEHFTQSLLQKYFYE 213
           GR+PKIDP+DPD+LHQ F ++F QSLL+K  YE
Sbjct: 181 GRMPKIDPMDPDILHQNFHKNFAQSLLKKNVYE 213


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|227823050|ref|YP_002827022.1| dithiobiotin synthetase [Sinorhizobium fredii NGR234] Length = 213 Back     alignment and organism information
>gi|15890969|ref|NP_356641.1| dithiobiotin synthetase [Agrobacterium tumefaciens str. C58] Length = 212 Back     alignment and organism information
>gi|332716725|ref|YP_004444191.1| dethiobiotin synthase [Agrobacterium sp. H13-3] Length = 212 Back     alignment and organism information
>gi|153010145|ref|YP_001371359.1| dithiobiotin synthetase [Ochrobactrum anthropi ATCC 49188] Length = 212 Back     alignment and organism information
>gi|27377209|ref|NP_768738.1| dithiobiotin synthetase [Bradyrhizobium japonicum USDA 110] Length = 211 Back     alignment and organism information
>gi|306845846|ref|ZP_07478414.1| dethiobiotin synthase [Brucella sp. BO1] Length = 212 Back     alignment and organism information
>gi|75676605|ref|YP_319026.1| dithiobiotin synthetase [Nitrobacter winogradskyi Nb-255] Length = 213 Back     alignment and organism information
>gi|256015271|ref|YP_003105280.1| dithiobiotin synthetase [Brucella microti CCM 4915] Length = 212 Back     alignment and organism information
>gi|85714581|ref|ZP_01045568.1| dithiobiotin synthetase [Nitrobacter sp. Nb-311A] Length = 213 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target217 dithiobiotin synthetase [Candidatus Liberibacter asiati
PRK00090222 PRK00090, bioD, dithiobiotin synthetase; Reviewed 4e-58
PRK12374231 PRK12374, PRK12374, putative dithiobiotin synthetase; P 5e-08
PLN02974 817 PLN02974, PLN02974, adenosylmethionine-8-amino-7-oxonon 4e-06
COG3367339 COG3367, COG3367, Uncharacterized conserved protein [Fu 0.002
COG0132223 COG0132, BioD, Dethiobiotin synthetase [Coenzyme metabo 8e-45
TIGR00347166 TIGR00347, bioD, dethiobiotin synthase 3e-27
cd03109134 cd03109, DTBS, Dethiobiotin synthetase (DTBS) is the pe 1e-14
>gnl|CDD|178855 PRK00090, bioD, dithiobiotin synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|183480 PRK12374, PRK12374, putative dithiobiotin synthetase; Provisional Back     alignment and domain information
>gnl|CDD|178557 PLN02974, PLN02974, adenosylmethionine-8-amino-7-oxononanoate transaminase Back     alignment and domain information
>gnl|CDD|33174 COG3367, COG3367, Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>gnl|CDD|30481 COG0132, BioD, Dethiobiotin synthetase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|129447 TIGR00347, bioD, dethiobiotin synthase Back     alignment and domain information
>gnl|CDD|73338 cd03109, DTBS, Dethiobiotin synthetase (DTBS) is the penultimate enzyme in the biotin biosynthesis pathway in Escherichia coli and other microorganisms Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 217 dithiobiotin synthetase [Candidatus Liberibacter asiati
PRK00090223 bioD dithiobiotin synthetase; Reviewed 100.0
PRK12374231 putative dithiobiotin synthetase; Provisional 100.0
COG0132223 BioD Dethiobiotin synthetase [Coenzyme metabolism] 100.0
PRK01077 451 cobyrinic acid a,c-diamide synthase; Validated 100.0
COG1797 451 CobB Cobyrinic acid a,c-diamide synthase [Coenzyme meta 100.0
TIGR00379 464 cobB cobyrinic acid a,c-diamide synthase; InterPro: IPR 99.97
PRK13896 432 cobyrinic acid a,c-diamide synthase; Provisional 99.97
TIGR00313 502 cobQ cobyric acid synthase CobQ; InterPro: IPR004459 Co 99.97
PRK00784 492 cobyric acid synthase; Provisional 99.97
PRK05632 702 phosphate acetyltransferase; Reviewed 99.95
COG1492 486 CobQ Cobyric acid synthase [Coenzyme metabolism] 99.88
COG0857 354 Pta BioD-like N-terminal domain of phosphotransacetylas 99.76
pfam01656212 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain. Thi 99.38
TIGR01969258 minD_arch cell division ATPase MinD; InterPro: IPR01022 99.32
CHL00175279 minD septum-site determining protein; Validated 99.14
PRK13233275 nifH nitrogenase reductase; Reviewed 99.11
cd02117212 NifH_like This family contains the NifH (iron protein) 99.1
PRK13185269 chlL protochlorophyllide reductase iron-sulfur ATP-bind 99.07
cd02032267 Bchl_like This family of proteins contains bchL and chl 99.04
PRK13231264 nitrogenase reductase-like protein; Reviewed 99.03
cd02037169 MRP-like MRP (Multiple Resistance and pH adaptation) is 98.96
cd02036179 MinD Bacterial cell division requires the formation of 98.91
PRK13235274 nifH nitrogenase reductase; Reviewed 98.91
PRK13232273 nifH nitrogenase reductase; Reviewed 98.91
PRK11670369 putative ATPase; Provisional 98.91
PRK13234293 nifH nitrogenase reductase; Reviewed 98.87
CHL00072271 chlL photochlorophyllide reductase subunit L 98.81
COG0541 451 Ffh Signal recognition particle GTPase [Intracellular t 98.78
COG0455262 flhG Antiactivator of flagellar biosynthesis FleN, an A 98.77
PRK00771 433 signal recognition particle protein Srp54; Provisional 98.77
PRK13236295 nitrogenase reductase; Reviewed 98.76
COG0489265 Mrp ATPases involved in chromosome partitioning [Cell d 98.76
PRK10818270 cell division inhibitor MinD; Provisional 98.75
TIGR00959 439 ffh signal recognition particle protein; InterPro: IPR0 98.74
TIGR01968272 minD_bact septum site-determining protein MinD; InterPr 98.72
PRK10867 453 signal recognition particle protein; Provisional 98.72
TIGR01281275 DPOR_bchL light-independent protochlorophyllide reducta 98.71
pfam07755302 DUF1611 Protein of unknown function (DUF1611). This reg 98.68
PRK13230292 nitrogenase reductase-like protein; Reviewed 98.67
cd02040270 NifH NifH gene encodes component II (iron protein) of n 98.65
cd00550254 ArsA_ATPase Oxyanion-translocating ATPase (ArsA). This 98.65
COG2894272 MinD Septum formation inhibitor-activating ATPase [Cell 98.58
pfam00142269 Fer4_NifH 4Fe-4S iron sulfur cluster binding proteins, 98.58
cd02033329 BchX Chlorophyllide reductase converts chlorophylls int 98.57
PRK10416499 cell division protein FtsY; Provisional 98.51
TIGR02016 355 BchX chlorophyllide reductase iron protein subunit X; I 98.47
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Validated 98.39
TIGR03371246 cellulose_yhjQ cellulose synthase operon protein YhjQ. 98.37
KOG3022300 consensus 98.3
COG1348278 NifH Nitrogenase subunit NifH (ATPase) [Inorganic ion t 98.2
KOG0780 483 consensus 98.03
TIGR01425 453 SRP54_euk signal recognition particle protein SRP54; In 97.98
TIGR00064284 ftsY signal recognition particle-docking protein FtsY; 97.87
pfam06564244 YhjQ YhjQ protein. This family consists of several bact 97.85
COG0552340 FtsY Signal recognition particle GTPase [Intracellular 97.84
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 97.68
TIGR01287278 nifH nitrogenase iron protein; InterPro: IPR005977 The 97.61
PRK10751170 molybdopterin-guanine dinucleotide biosynthesis protein 97.48
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 97.33
PTZ00301210 uridine kinase; Provisional 95.4
TIGR00235220 udk uridine kinase; InterPro: IPR000764 Uridine kinase 94.57
TIGR00347187 bioD dethiobiotin synthase; InterPro: IPR004472 The enz 100.0
cd03109134 DTBS Dethiobiotin synthetase (DTBS) is the penultimate 100.0
PRK06278482 cobyrinic acid a,c-diamide synthase; Validated 99.62
cd03110179 Fer4_NifH_child This protein family's function is unkow 99.08
TIGR01007207 eps_fam capsular exopolysaccharide family; InterPro: IP 98.93
PRK09841726 cryptic autophosphorylating protein tyrosine kinase Etk 98.9
PRK11519720 tyrosine kinase; Provisional 98.83
TIGR03029274 EpsG chain length determinant protein tyrosine kinase E 98.77
TIGR03018207 pepcterm_TyrKin exopolysaccharide/PEPCTERM locus tyrosi 98.5
COG3367339 Uncharacterized conserved protein [Function unknown] 98.42
cd02038139 FleN-like FleN is a member of the Fer4_NifH superfamily 98.35
cd03115173 SRP The signal recognition particle (SRP) mediates the 98.01
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 97.97
PHA02518211 ParA-like protein; Provisional 97.94
pfam00448196 SRP54 SRP54-type protein, GTPase domain. This family in 97.93
cd0198399 Fer4_NifH The Fer4_NifH superfamily contains a variety 97.82
PRK05703412 flhF flagellar biosynthesis regulator FlhF; Validated 97.55
pfam07015231 VirC1 VirC1 protein. This family consists of several ba 97.54
PRK13849231 putative crown gall tumor protein VirC1; Provisional 97.51
cd03116159 MobB Molybdenum is an essential trace element in the fo 97.48
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility and s 97.35
PRK06995404 flhF flagellar biosynthesis regulator FlhF; Validated 97.24
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provisional 96.91
cd02042104 ParA ParA and ParB of Caulobacter crescentus belong to 96.91
PRK05380 534 pyrG CTP synthetase; Validated 96.67
PRK13886241 conjugal transfer protein TraL; Provisional 96.59
COG0572218 Udk Uridine kinase [Nucleotide transport and metabolism 96.41
PRK12727557 flagellar biosynthesis regulator FlhF; Provisional 96.35
cd03114148 ArgK-like The function of this protein family is unkown 96.12
COG4108 528 PrfC Peptide chain release factor RF-3 [Translation, ri 95.91
cd03111106 CpaE_like This protein family consists of proteins simi 95.89
COG1703323 ArgK Putative periplasmic protein kinase ArgK and relat 95.86
PRK04040189 adenylate kinase; Provisional 95.75
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This prote 95.24
COG2019189 AdkA Archaeal adenylate kinase [Nucleotide transport an 95.16
PRK13768253 GTPase; Provisional 94.96
PRK11823 454 DNA repair protein RadA; Provisional 94.85
TIGR01005778 eps_transp_fam exopolysaccharide transport protein fami 94.78
PRK05800170 cobU adenosylcobinamide kinase/adenosylcobinamide-phosp 94.68
PRK06835330 DNA replication protein DnaC; Validated 94.42
pfam03029234 ATP_bind_1 Conserved hypothetical ATP binding protein. 94.25
pfam02283166 CobU Cobinamide kinase / cobinamide phosphate guanyltra 93.58
PRK08116262 hypothetical protein; Validated 93.05
PRK09183258 transposase/IS protein; Provisional 92.53
TIGR02768 888 TraA_Ti Ti-type conjugative transfer relaxase TraA; Int 92.02
TIGR00503 530 prfC peptide chain release factor 3; InterPro: IPR00454 91.89
pfam06418275 CTP_synth_N CTP synthase N-terminus. This family consis 91.83
PRK06526254 transposase; Provisional 91.73
PRK07952242 DNA replication protein DnaC; Validated 91.51
KOG0781587 consensus 91.49
COG0504 533 PyrG CTP synthase (UTP-ammonia lyase) [Nucleotide trans 91.45
cd04166208 CysN_ATPS CysN_ATPS subfamily. CysN, together with prot 91.4
COG1066 456 Sms Predicted ATP-dependent serine protease [Posttransl 91.25
cd00544169 CobU Adenosylcobinamide kinase / adenosylcobinamide pho 91.13
PRK08181269 transposase; Validated 90.98
cd03113255 CTGs CTP synthetase (CTPs) is a two-domain protein, whi 90.71
PTZ00141 443 elongation factor 1 alpha; Provisional 90.41
PRK05124 475 cysN sulfate adenylyltransferase subunit 1; Provisional 90.32
COG1149284 MinD superfamily P-loop ATPase containing an inserted f 98.53
cd02035217 ArsA ArsA ATPase functionas as an efflux pump located o 98.38
COG3640255 CooC CO dehydrogenase maturation factor [Cell division 98.35
PRK05632 702 phosphate acetyltransferase; Reviewed 94.69
cd04170268 EF-G_bact Elongation factor G (EF-G) subfamily. Translo 90.03
pfam02374304 ArsA_ATPase Anion-transporting ATPase. This Pfam family 98.4
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 96.44
COG2403 449 Predicted GTPase [General function prediction only] 97.88
TIGR00750333 lao LAO/AO transport system ATPase; InterPro: IPR005129 97.51
) of Arabidopsis thaliana (Mouse-ear cress), mammalian Gephryin (e.g. Q9NQX3 from SWISSPROT) and Drosophila melanogaster (Fruit fly) Cinnamon (P39205 from SWISSPROT) . The MobB domain is similar to that of the urease accessory protein UreG and the hydrogenase accessory protein HypB, both GTP hydrolases involved in loading nickel into the metallocentres of their respective target enzymes. It is involved in the final step of molybdenum-cofactor biosynthesis. While its precise function has not been identified it is thought to be involved in the transfer of a guanine dinucleotide moiety to molybdopterin, as it shows GTP-binding and weak GTPase activity . The MobB protein (P32125 from SWISSPROT) from Escherichia coli, which is comprised of this domain, is a homodimer . Each molecule is composed of two distinct regions - an outer region comprised of 6 beta-strands and three alpha helices, and an inner region comprised of a two-strand beta hairpin followed by an alpha helix. These regions require interaction with the second monomer to allow proper folding to occur. The two monomers are intertwined and form an extensive 16-stranded beta-sheet. While the active site could not be positively identified, the presence of highly conserved residues suggests the substrate binding site occurs in the central solvent channel.; GO: 0005525 GTP binding, 0006777 Mo-molybdopterin cofactor biosynthetic process." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR00176">TIGR00176165 mobB molybdopterin-guanine dinucleotide biosynthesis pr 97.37
COG1763161 MobB Molybdopterin-guanine dinucleotide biosynthesis pr 97.06
pfam09140261 MipZ ATPase MipZ. MipZ is an ATPase that forms a comple 96.88
COG0378202 HypB Ni2+-binding GTPase involved in regulation of expr 96.42
pfam00485196 PRK Phosphoribulokinase / Uridine kinase family. In Ara 96.32
KOG2749415 consensus 96.0
cd02026273 PRK Phosphoribulokinase (PRK) is an enzyme involved in 95.62
TIGR02173173 cyt_kin_arch cytidylate kinase, putative; InterPro: IPR 95.57
COG1341 398 Predicted GTPase or GTP-binding protein [General functi 95.44
PRK09270230 frcK putative fructose transport system kinase; Reviewe 95.42
PRK07429 331 phosphoribulokinase; Provisional 95.12
cd02025220 PanK Pantothenate kinase (PanK) catalyzes the phosphory 95.09
pfam03308267 ArgK ArgK protein. The ArgK protein acts as an ATPase e 94.91
TIGR00073225 hypB hydrogenase accessory protein HypB; InterPro: IPR0 94.65
PRK10463290 hydrogenase nickel incorporation protein HypB; Provisio 94.4
PRK09361224 radB DNA repair and recombination protein RadB; Provisi 93.66
cd01124187 KaiC KaiC is a circadian clock protein primarily found 93.07
cd01394218 radB RadB. The archaeal protein radB shares similarity 92.96
COG1102179 Cmk Cytidylate kinase [Nucleotide transport and metabol 92.55
PRK09435325 arginine/ornithine transport system ATPase; Provisional 92.05
PRK10037250 cell division protein; Provisional 97.42
COG1192259 Soj ATPases involved in chromosome partitioning [Cell d 97.04
COG1618179 Predicted nucleotide kinase [Nucleotide transport and m 97.03
PRK04220306 2-phosphoglycerate kinase; Provisional 96.56
cd02028179 UMPK_like Uridine monophosphate kinase_like (UMPK_like) 96.05
TIGR00455187 apsK adenylylsulfate kinase; InterPro: IPR002891 Enzyme 95.95
PRK00091304 miaA tRNA delta(2)-isopentenylpyrophosphate transferase 95.91
TIGR01087 476 murD UDP-N-acetylmuramoylalanine--D-glutamate ligase; I 95.79
PRK12338 320 hypothetical protein; Provisional 95.76
TIGR00763 941 lon ATP-dependent protease La; InterPro: IPR004815 Prot 95.72
TIGR01085 494 murE UDP-N-acetylmuramyl-tripeptide synthetases; InterP 95.58
PRK02472 450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 95.44
TIGR01420350 pilT_fam twitching motility protein; InterPro: IPR00632 95.44
PRK01710 458 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 95.38
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1.48), 95.31
PRK03839180 putative kinase; Provisional 95.28
PRK02705 459 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 95.18
PRK04663 438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 95.03
PRK04308 445 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 94.99
PRK02006 501 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 94.91
PRK03369 487 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 94.82
PRK00141 476 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 94.8
PRK05480209 uridine kinase; Provisional 94.78
PRK13695174 putative NTPase; Provisional 94.68
PRK01438 481 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 94.59
COG0771 448 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Ce 94.51
PRK08006471 replicative DNA helicase; Provisional 94.5
PRK03806 438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 94.47
pfam06414191 Zeta_toxin Zeta toxin. This family consists of several 94.44
COG1936180 Predicted nucleotide kinase (related to CMP and AMP kin 94.43
PRK03731172 aroL shikimate kinase II; Reviewed 94.35
PRK01368 450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 94.34
PRK08233182 hypothetical protein; Provisional 94.33
PRK13869405 plasmid-partitioning protein RepA; Provisional 94.18
PRK08118167 topology modulation protein; Reviewed 94.14
PRK08840464 replicative DNA helicase; Provisional 94.13
pfam03205122 MobB Molybdopterin guanine dinucleotide synthesis prote 94.1
COG1072283 CoaA Panthothenate kinase [Coenzyme metabolism] 94.09
PRK00421 459 murC UDP-N-acetylmuramate--L-alanine ligase; Provisiona 94.07
PRK01390 457 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 94.05
PRK08694468 consensus 94.03
PRK04690 468 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 93.97
COG0324308 MiaA tRNA delta(2)-isopentenylpyrophosphate transferase 93.94
TIGR01082 491 murC UDP-N-acetylmuramate--alanine ligase; InterPro: IP 93.77
PRK00889175 adenylylsulfate kinase; Provisional 93.76
TIGR03600421 phage_DnaB phage replicative helicase, DnaB family, HK0 93.7
cd02034116 CooC The accessory protein CooC, which contains a nucle 93.63
PRK07263453 consensus 93.57
PRK00683 418 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 93.46
PRK03803 448 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 93.46
PRK12339197 2-phosphoglycerate kinase; Provisional 93.43
PRK06761281 hypothetical protein; Provisional 93.28
TIGR02759 613 TraD_Ftype type IV conjugative transfer system coupling 93.26
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' he 93.26
PRK06217185 hypothetical protein; Validated 93.24
KOG2004 906 consensus 93.16
PRK06904472 replicative DNA helicase; Validated 93.09
TIGR01448 769 recD_rel helicase, RecD/TraA family; InterPro: IPR00634 93.04
PRK05541176 adenylylsulfate kinase; Provisional 93.01
PRK13700 732 conjugal transfer protein TraD; Provisional 92.84
PRK05748448 replicative DNA helicase; Provisional 92.7
pfam03266168 DUF265 Protein of unknown function, DUF265. 92.67
COG2805353 PilT Tfp pilus assembly protein, pilus retraction ATPas 92.55
pfam08245188 Mur_ligase_M Mur ligase middle domain. 92.46
TIGR02397 363 dnaX_nterm DNA polymerase III, subunits gamma and tau; 92.44
PRK07261171 topology modulation protein; Provisional 92.36
PRK09165484 replicative DNA helicase; Provisional 92.34
COG0773 459 MurC UDP-N-acetylmuramate-alanine ligase [Cell envelope 92.34
COG0529197 CysC Adenylylsulfate kinase and related kinases [Inorga 92.24
TIGR00174307 miaA tRNA delta(2)-isopentenylpyrophosphate transferase 92.09
TIGR02928 383 TIGR02928 orc1/cdc6 family replication initiation prote 92.01
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexameric h 91.93
PRK03846198 adenylylsulfate kinase; Provisional 91.89
PRK10846 416 bifunctional folylpolyglutamate synthase/ dihydrofolate 91.86
cd02029277 PRK_like Phosphoribulokinase-like (PRK-like) is a famil 91.82
pfam01695178 IstB IstB-like ATP binding protein. This protein contai 91.76
pfam01583157 APS_kinase Adenylylsulphate kinase. Enzyme that catalys 91.73
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phosphoryl t 91.73
COG0125208 Tmk Thymidylate kinase [Nucleotide transport and metabo 91.72
PRK08082453 consensus 91.64
PRK08760476 replicative DNA helicase; Provisional 91.6
COG2074299 2-phosphoglycerate kinase [Carbohydrate transport and m 91.51
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyze 91.34
PRK00726 359 murG N-acetylglucosaminyl transferase; Provisional 91.13
smart00382148 AAA ATPases associated with a variety of cellular activ 91.09
PRK08770 663 DNA polymerase III subunits gamma and tau; Validated 90.85
KOG3347176 consensus 90.8
PRK06872 696 DNA polymerase III subunits gamma and tau; Provisional 90.73
TIGR02533495 type_II_gspE general secretory pathway protein E; Inter 90.59
PRK06482276 short chain dehydrogenase; Provisional 90.56
PRK09302 501 circadian clock protein KaiC; Reviewed 90.53
PRK05648 705 DNA polymerase III subunits gamma and tau; Reviewed 90.52
PRK06645 507 DNA polymerase III subunits gamma and tau; Validated 90.17
PRK09111 600 DNA polymerase III subunits gamma and tau; Validated 90.16
PRK12323 721 DNA polymerase III subunits gamma and tau; Provisional 90.12
COG1484254 DnaC DNA replication protein [DNA replication, recombin 90.06
PRK08017256 short chain dehydrogenase; Provisional 90.04
COG0003322 ArsA Predicted ATPase involved in chromosome partitioni 97.35
PRK09825176 idnK D-gluconate kinase; Provisional 95.62
COG4028271 Predicted P-loop ATPase/GTPase [General function predic 95.56
TIGR01313175 therm_gnt_kin carbohydrate kinase, thermoresistant gluc 94.39
PRK11545177 gntK gluconate kinase 1; Provisional 92.76
KOG3354191 consensus 90.75
cd01884195 EF_Tu EF-Tu subfamily. This subfamily includes ortholog 93.26
pfam1060981 ParA ParA/MinD ATPase like. This family contains ATPase 92.98
TIGR03007510 pepcterm_ChnLen polysaccharide chain length determinant 91.74
>PRK00090 bioD dithiobiotin synthetase; Reviewed Back     alignment and domain information
>PRK12374 putative dithiobiotin synthetase; Provisional Back     alignment and domain information
>COG0132 BioD Dethiobiotin synthetase [Coenzyme metabolism] Back     alignment and domain information
>PRK01077 cobyrinic acid a,c-diamide synthase; Validated Back     alignment and domain information
>COG1797 CobB Cobyrinic acid a,c-diamide synthase [Coenzyme metabolism] Back     alignment and domain information
>TIGR00379 cobB cobyrinic acid a,c-diamide synthase; InterPro: IPR004484 This family describes cobyrinic acid a,c-diamide synthase, the cobB (cbiA in Salmonella) protein of cobalamin biosynthesis Back     alignment and domain information
>PRK13896 cobyrinic acid a,c-diamide synthase; Provisional Back     alignment and domain information
>TIGR00313 cobQ cobyric acid synthase CobQ; InterPro: IPR004459 Cobyric acid synthase (CobQ) catalyses amidations at positions B, D, E, and G on adenosylcobyrinic A,C-diamide in the biosynthesis of cobalamin Back     alignment and domain information
>PRK00784 cobyric acid synthase; Provisional Back     alignment and domain information
>PRK05632 phosphate acetyltransferase; Reviewed Back     alignment and domain information
>COG1492 CobQ Cobyric acid synthase [Coenzyme metabolism] Back     alignment and domain information
>COG0857 Pta BioD-like N-terminal domain of phosphotransacetylase [General function prediction only] Back     alignment and domain information
>pfam01656 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain Back     alignment and domain information
>TIGR01969 minD_arch cell division ATPase MinD; InterPro: IPR010224 Proper placement of the bacterial cell division site requires the site-specific inactivation of other potential division sites Back     alignment and domain information
>CHL00175 minD septum-site determining protein; Validated Back     alignment and domain information
>PRK13233 nifH nitrogenase reductase; Reviewed Back     alignment and domain information
>cd02117 NifH_like This family contains the NifH (iron protein) of nitrogenase, L subunit (BchL/ChlL) of the protochlorophyllide reductase and the BchX subunit of the Chlorophyllide reductase Back     alignment and domain information
>PRK13185 chlL protochlorophyllide reductase iron-sulfur ATP-binding protein; Provisional Back     alignment and domain information
>cd02032 Bchl_like This family of proteins contains bchL and chlL Back     alignment and domain information
>PRK13231 nitrogenase reductase-like protein; Reviewed Back     alignment and domain information
>cd02037 MRP-like MRP (Multiple Resistance and pH adaptation) is a homologue of the Fer4_NifH superfamily Back     alignment and domain information
>cd02036 MinD Bacterial cell division requires the formation of a septum at mid-cell Back     alignment and domain information
>PRK13235 nifH nitrogenase reductase; Reviewed Back     alignment and domain information
>PRK13232 nifH nitrogenase reductase; Reviewed Back     alignment and domain information
>PRK11670 putative ATPase; Provisional Back     alignment and domain information
>PRK13234 nifH nitrogenase reductase; Reviewed Back     alignment and domain information
>CHL00072 chlL photochlorophyllide reductase subunit L Back     alignment and domain information
>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>COG0455 flhG Antiactivator of flagellar biosynthesis FleN, an ATPase [Cell motility] Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>PRK13236 nitrogenase reductase; Reviewed Back     alignment and domain information
>COG0489 Mrp ATPases involved in chromosome partitioning [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK10818 cell division inhibitor MinD; Provisional Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein; InterPro: IPR004780 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes , Back     alignment and domain information
>TIGR01968 minD_bact septum site-determining protein MinD; InterPro: IPR010223 This entry describes the bacterial and chloroplast form of MinD, a multifunctional cell division protein that guides correct placement of the septum Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>TIGR01281 DPOR_bchL light-independent protochlorophyllide reductase, iron-sulfur ATP-binding protein; InterPro: IPR005971 Synonym: dark protochlorophyllide reductase Protochlorophyllide reductase catalyzes the reductive formation of chlorophyllide from protochlorophyllide during biosynthesis of chlorophylls and bacteriochlorophylls Back     alignment and domain information
>pfam07755 DUF1611 Protein of unknown function (DUF1611) Back     alignment and domain information
>PRK13230 nitrogenase reductase-like protein; Reviewed Back     alignment and domain information
>cd02040 NifH NifH gene encodes component II (iron protein) of nitrogenase Back     alignment and domain information
>cd00550 ArsA_ATPase Oxyanion-translocating ATPase (ArsA) Back     alignment and domain information
>COG2894 MinD Septum formation inhibitor-activating ATPase [Cell division and chromosome partitioning] Back     alignment and domain information
>pfam00142 Fer4_NifH 4Fe-4S iron sulfur cluster binding proteins, NifH/frxC family Back     alignment and domain information
>cd02033 BchX Chlorophyllide reductase converts chlorophylls into bacteriochlorophylls by reducing the chlorin B-ring Back     alignment and domain information
>PRK10416 cell division protein FtsY; Provisional Back     alignment and domain information
>TIGR02016 BchX chlorophyllide reductase iron protein subunit X; InterPro: IPR010246 This entry represents the X subunit of the three-subunit enzyme, (bacterio)chlorophyllide reductase , Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>TIGR03371 cellulose_yhjQ cellulose synthase operon protein YhjQ Back     alignment and domain information
>KOG3022 consensus Back     alignment and domain information
>COG1348 NifH Nitrogenase subunit NifH (ATPase) [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0780 consensus Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54; InterPro: IPR006325 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes , Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY; InterPro: IPR004390 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>pfam06564 YhjQ YhjQ protein Back     alignment and domain information
>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR01287 nifH nitrogenase iron protein; InterPro: IPR005977 The enzyme responsible for nitrogen fixation, the nitrogenase, shows a high degree of conservation of structure, function, and amino acid sequence across wide phylogenetic ranges Back     alignment and domain information
>PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PTZ00301 uridine kinase; Provisional Back     alignment and domain information
>TIGR00235 udk uridine kinase; InterPro: IPR000764 Uridine kinase (pyrimidine ribonucleoside kinase) is the rate-limiting enzyme in the pyrimidine salvage pathway Back     alignment and domain information
>TIGR00347 bioD dethiobiotin synthase; InterPro: IPR004472 The enzyme is involved in biotin biosynthesis and catalyses the reaction (CO2 + 7,8-diaminononanoate + ATP = dethiobiotin + phosphate + ADP) Back     alignment and domain information
>cd03109 DTBS Dethiobiotin synthetase (DTBS) is the penultimate enzyme in the biotin biosynthesis pathway in Escherichia coli and other microorganisms Back     alignment and domain information
>PRK06278 cobyrinic acid a,c-diamide synthase; Validated Back     alignment and domain information
>cd03110 Fer4_NifH_child This protein family's function is unkown Back     alignment and domain information
>TIGR01007 eps_fam capsular exopolysaccharide family; InterPro: IPR005702 This family describes the capsular exopolysaccharide proteins in bacteria Back     alignment and domain information
>PRK09841 cryptic autophosphorylating protein tyrosine kinase Etk; Provisional Back     alignment and domain information
>PRK11519 tyrosine kinase; Provisional Back     alignment and domain information
>TIGR03029 EpsG chain length determinant protein tyrosine kinase EpsG Back     alignment and domain information
>TIGR03018 pepcterm_TyrKin exopolysaccharide/PEPCTERM locus tyrosine autokinase Back     alignment and domain information
>COG3367 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd02038 FleN-like FleN is a member of the Fer4_NifH superfamily Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PHA02518 ParA-like protein; Provisional Back     alignment and domain information
>pfam00448 SRP54 SRP54-type protein, GTPase domain Back     alignment and domain information
>cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>pfam07015 VirC1 VirC1 protein Back     alignment and domain information
>PRK13849 putative crown gall tumor protein VirC1; Provisional Back     alignment and domain information
>cd03116 MobB Molybdenum is an essential trace element in the form of molybdenum cofactor (Moco) which is associated with the metabolism of nitrogen, carbon and sulfur by redox active enzymes Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd02042 ParA ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation Back     alignment and domain information
>PRK05380 pyrG CTP synthetase; Validated Back     alignment and domain information
>PRK13886 conjugal transfer protein TraL; Provisional Back     alignment and domain information
>COG0572 Udk Uridine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd03114 ArgK-like The function of this protein family is unkown Back     alignment and domain information
>COG4108 PrfC Peptide chain release factor RF-3 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd03111 CpaE_like This protein family consists of proteins similar to the cpaE protein of the Caulobacter pilus assembly and the orf4 protein of Actinobacillus pilus formation gene cluster Back     alignment and domain information
>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] Back     alignment and domain information
>PRK04040 adenylate kinase; Provisional Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>COG2019 AdkA Archaeal adenylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK13768 GTPase; Provisional Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>TIGR01005 eps_transp_fam exopolysaccharide transport protein family; InterPro: IPR005700 The bacterial exopolysaccharide transport protein is part of a large genetic locus which is associated with exopolysaccharide (EPS) biosynthesis Back     alignment and domain information
>PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>pfam03029 ATP_bind_1 Conserved hypothetical ATP binding protein Back     alignment and domain information
>pfam02283 CobU Cobinamide kinase / cobinamide phosphate guanyltransferase Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA; InterPro: IPR014136 This entry represents the Ti-type conjugative transfer relaxase TraA Back     alignment and domain information
>TIGR00503 prfC peptide chain release factor 3; InterPro: IPR004548 Peptide chain release factor 3 increases the formation of ribosomal termination complexes and stimulates activity of RF-1 and RF-2 Back     alignment and domain information
>pfam06418 CTP_synth_N CTP synthase N-terminus Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>KOG0781 consensus Back     alignment and domain information
>COG0504 PyrG CTP synthase (UTP-ammonia lyase) [Nucleotide transport and metabolism] Back     alignment and domain information
>cd04166 CysN_ATPS CysN_ATPS subfamily Back     alignment and domain information
>COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>cd03113 CTGs CTP synthetase (CTPs) is a two-domain protein, which consists of an N-terminal synthetase domain and C-terminal glutaminase domain Back     alignment and domain information
>PTZ00141 elongation factor 1 alpha; Provisional Back     alignment and domain information
>PRK05124 cysN sulfate adenylyltransferase subunit 1; Provisional Back     alignment and domain information
>COG1149 MinD superfamily P-loop ATPase containing an inserted ferredoxin domain [Energy production and conversion] Back     alignment and domain information
>cd02035 ArsA ArsA ATPase functionas as an efflux pump located on the inner membrane of the cell Back     alignment and domain information
>COG3640 CooC CO dehydrogenase maturation factor [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK05632 phosphate acetyltransferase; Reviewed Back     alignment and domain information
>cd04170 EF-G_bact Elongation factor G (EF-G) subfamily Back     alignment and domain information
>pfam02374 ArsA_ATPase Anion-transporting ATPase Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>COG2403 Predicted GTPase [General function prediction only] Back     alignment and domain information
>TIGR00750 lao LAO/AO transport system ATPase; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components Back     alignment and domain information
>TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein B; InterPro: IPR004435 The majority of molybdenum-containing enzymes utilise a molybdenum cofactor (MoCF or Moco) consisting of a Mo atom coordinated via a cisdithiolene moiety to molybdopterin (MPT) Back     alignment and domain information
>COG1763 MobB Molybdopterin-guanine dinucleotide biosynthesis protein [Coenzyme metabolism] Back     alignment and domain information
>pfam09140 MipZ ATPase MipZ Back     alignment and domain information
>COG0378 HypB Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription] Back     alignment and domain information
>pfam00485 PRK Phosphoribulokinase / Uridine kinase family Back     alignment and domain information
>KOG2749 consensus Back     alignment and domain information
>cd02026 PRK Phosphoribulokinase (PRK) is an enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes Back     alignment and domain information
>TIGR02173 cyt_kin_arch cytidylate kinase, putative; InterPro: IPR011892 Proteins in this family are believed to be cytidylate kinase Back     alignment and domain information
>COG1341 Predicted GTPase or GTP-binding protein [General function prediction only] Back     alignment and domain information
>PRK09270 frcK putative fructose transport system kinase; Reviewed Back     alignment and domain information
>PRK07429 phosphoribulokinase; Provisional Back     alignment and domain information
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway Back     alignment and domain information
>pfam03308 ArgK ArgK protein Back     alignment and domain information
>TIGR00073 hypB hydrogenase accessory protein HypB; InterPro: IPR004392 The hydrogenase accessory protein HypB is a GTP hydrolase for assembly of nickel metallocentre of hydrogenase Back     alignment and domain information
>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK09435 arginine/ornithine transport system ATPase; Provisional Back     alignment and domain information
>PRK10037 cell division protein; Provisional Back     alignment and domain information
>COG1192 Soj ATPases involved in chromosome partitioning [Cell division and chromosome partitioning] Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK04220 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>TIGR00455 apsK adenylylsulfate kinase; InterPro: IPR002891 Enzyme that catalyses the phosphorylation of adenylylsulphate to 3'-phosphoadenylylsulphate Back     alignment and domain information
>PRK00091 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed Back     alignment and domain information
>TIGR01087 murD UDP-N-acetylmuramoylalanine--D-glutamate ligase; InterPro: IPR005762 The bacterial cell wall provides strength and rigidity to counteract internal osmotic pressure, and protection against the environment Back     alignment and domain information
>PRK12338 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La; InterPro: IPR004815 Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes Back     alignment and domain information
>TIGR01085 murE UDP-N-acetylmuramyl-tripeptide synthetases; InterPro: IPR005761 The bacterial cell wall provides strength and rigidity to counteract internal osmotic pressure, and protection against the environment Back     alignment and domain information
>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR01420 pilT_fam twitching motility protein; InterPro: IPR006321 These represent the PilT subfamily of proteins related to GspE, a protein involved in type II secretion (also called the General Secretion Pathway) Back     alignment and domain information
>PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>PRK02705 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK04663 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK04308 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK02006 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK00141 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK05480 uridine kinase; Provisional Back     alignment and domain information
>PRK13695 putative NTPase; Provisional Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG0771 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK08006 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK03806 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>pfam06414 Zeta_toxin Zeta toxin Back     alignment and domain information
>COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK03731 aroL shikimate kinase II; Reviewed Back     alignment and domain information
>PRK01368 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>PRK13869 plasmid-partitioning protein RepA; Provisional Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>PRK08840 replicative DNA helicase; Provisional Back     alignment and domain information
>pfam03205 MobB Molybdopterin guanine dinucleotide synthesis protein B Back     alignment and domain information
>COG1072 CoaA Panthothenate kinase [Coenzyme metabolism] Back     alignment and domain information
>PRK00421 murC UDP-N-acetylmuramate--L-alanine ligase; Provisional Back     alignment and domain information
>PRK01390 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK08694 consensus Back     alignment and domain information
>PRK04690 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information