254780488

254780488

adenosylmethionine--8-amino-7-oxononanoate transaminase

GeneID in NCBI database:8209477Locus tag:CLIBASIA_01875
Protein GI in NCBI database:254780488Protein Accession:YP_003064901.1
Gene range:+(410307, 411578)Protein Length:423aa
Gene description:adenosylmethionine--8-amino-7-oxononanoate transaminase
COG prediction:none
KEGG prediction:adenosylmethionine--8-amino-7-oxononanoate transaminase (EC:2.6.1.62); K00833 adenosylmethionine-8-amino-7-oxononanoate aminotransferase [EC:2.6.1.62]
SEED prediction:Adenosylmethionine-8-amino-7-oxononanoate aminotransferase (EC 2.6.1.62)
Pathway involved in KEGG:Biotin metabolism [PATH:las00780]
Subsystem involved in SEED:Biotin biosynthesis
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED4 TM-Helix
HMMTOPnone TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420---
MNHLHSNYPIWHPFVQHFCNPTFKKIIKTEGSYLIDENHDKIIDAISSWWVITHGHRHPIIMNAIRSASENYDQIIFSEYTHEPAEQLARLLIKIAPLGLQYVFFSDSGSTSIEVALKMALGFFNNNNMPRNKIVVMEHGYHGDTIGSMSVSMRGAFNNSYEPLLFDVETIPFPHHNEEQKTLDDLEKHCSTQKIAAFLVEPLILGAGGMQTYRPYILKEFMRITKKYDTLLIADEVMTGWGRTGKIFACNHADITPDILCLSKGITGGALPLAATLCSEEIFDSHLSSDKKKTFFHSSSYTANPIACAAALANLQIWEKEPVIERIKNLERMHADRLSLLKSNKKFVNIRQMGTIVALDFNVQNKGYFFDKNAKLKNFFREKKILIRPLGHIMYLMPPYCITATDLDHIYNTINEAVDFLEL
ccccccccccccHHHHcccccccEEEEEEcccEEEEccccEEEEcHHHHHHHccccccHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHccccccEEEEEccHHHHHHHHHHHHHHHHHHccccccEEEEEEccccccHHHHHHHHccHHHcccccccccccEEEcccccccHHHHHHHHHHHcccccEEEEEEEcccccccccccccHHHHHHHHHHHHHHccEEEEcccccccccccccccHHHHcccccEEEEEHHHccccccEEEEEEcHHHHHHHccccccccEEEcccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHccccEEEccccEEEEEEEccccccccHHHHHHHHHHHHHccEEEEEcccEEEEcccccccHHHHHHHHHHHHHHHHHHcc
cccccccccEcccccccccccccEEEEEEEEcEEEEccccEEEEcccccccccccEccHHHHHHHHHHHHHccccccccEEcHHHHHHHHHHHHHccccccEEEEEccHHHHHHHHHHHHHHHHHcccccccEEEEEccccccccHHHHccccccHHHHHHccccccccccccccccccHHHHHHHHHHHccccEEEEEEcccEEcccccEEEccHHHHHHHHHHHHHccEEEEEcccccccccccccHHHHHcccccEEEEcHHHHccccccEEEEEcHHHHHHHcccccccEEEccccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcccccccHEEcEEEEEEEEEcccccccccHHHHHHHHHHHccEEcccEccEEEEcccccccHHHHHHHHHHHHHHcHHccc
mnhlhsnypiwhpfvqhfcnpTFKKIIKTegsylidenHDKIIDAISSWWvithghrhpIIMNAIRSASENYDQIIFSEYTHEPAEQLARLLIKIAPLGLQYVFFSDSGSTSIEVALKMALGffnnnnmprnKIVVMEhgyhgdtigSMSVSMrgafnnsyepllfdvetipfphhneeqkTLDDLEKHCSTQKIAAFLVEplilgaggmqtyrPYILKEFMRITKKYDTLLIADEvmtgwgrtgkifacnhaditpdilclskgitggalplaatlcseeifdshlssdkkktffhsssytanPIACAAALANLQIWEKEPVIERIKNLERMHADRLSLLKSNKKFVNIRQMGTIVALdfnvqnkgyffdknaKLKNFFREKkilirplghimylmppycitatdlDHIYNTINEAVDFLEL
mnhlhsnypiwhPFVQHFCNPTFKKIIKTEGSYLIDENHDKIIDAISSWWVITHGHRHPIIMNAIRSASENYDQIIFSEYTHEPAEQLARLLIKIAPLGLQYVFFSDSGSTSIEVALKMALGFFNNNNMPRNKIVVMEHGYHGDTIGSMSVSMRGAFNNSYEPLLFDVETIPFPHHNEEQKTLDDLEKHCSTQKIAAFLVEPLILGAGGMQTYRPYILKEFMRITKKYDTLLIADEVMTGWGRTGKIFACNHADITPDILCLSKGITGGALPLAATLCSEEIFDSHLSSDKKKTFFHSSSYTANPIACAAALANLQIWEKEPVIERIKNLERMHADRLSLLKSNKKFVNIRQMGTIVALDFNVQNKGYFFDKNAKLKNFFREKKILIRPLGHIMYLMPPYCITATDLDHIYNTINEAVDFLEL
MNHLHSNYPIWHPFVQHFCNPTFKKIIKTEGSYLIDENHDKIIDAISSWWVITHGHRHPIIMNAIRSASENYDQIIFSEYTHEPAEQLARLLIKIAPLGLQYVFFSDSGSTSIEVALKMALGFFNNNNMPRNKIVVMEHGYHGDTIGSMSVSMRGAFNNSYEPLLFDVETIPFPHHNEEQKTLDDLEKHCSTQKIAAFLVEPLILGAGGMQTYRPYILKEFMRITKKYDTLLIADEVMTGWGRTGKIFACNHADITPDILCLSKGITGGALPLAATLCSEEIFDSHLSSDKKKTFFHSSSYTanpiacaaalanlQIWEKEPVIERIKNLERMHADRLSLLKSNKKFVNIRQMGTIVALDFNVQNKGYFFDKNAKLKNFFREKKILIRPLGHIMYLMPPYCITATDLDHIYNTINEAVDFLEL
****HSN*PIWHPFVQHFCNPTFKKIIKTEGSYLIDENHDKIIDAISSWWVITHGHRHPIIMNAIRSASENYDQIIFSEYTHEPAEQLARLLIKIAPLGLQYVFFSDSGSTSIEVALKMALGFFNNNNMPRNKIVVMEHGYHGDTIGSMSVSMRGAFNNSYEPLLFDVETIPFPHHNEEQKTLDDLEKHCSTQKIAAFLVEPLILGAGGMQTYRPYILKEFMRITKKYDTLLIADEVMTGWGRTGKIFACNHADITPDILCLSKGITGGALPLAATLCSEEIFDSHLSSDKKKTFFHSSSYTANPIACAAALANLQIWEKEPVIERIKNLERMHADRLSLLKSNKKFVNIRQMGTIVALDFNVQNKGYFFDKNAKLKNFFREKKILIRPLGHIMYLMPPYCITATDLDHIYNTINEAVDFLEL
MNHLHSNYPIWHPFVQHFCNPTFKKIIKTEGSYLIDENHDKIIDAISSWWVITHGHRHPIIMNAIRSASENYDQIIFSEYTHEPAEQLARLLIKIAPLGLQYVFFSDSGSTSIEVALKMALGFFNNNNMPRNKIVVMEHGYHGDTIGSMSVSMRGAFNNSYEPLLFDVETIPFPHHNEEQKTLDDLEKHCSTQKIAAFLVEPLILGAGGMQTYRPYILKEFMRITKKYDTLLIADEVMTGWGRTGKIFACNHADITPDILCLSKGITGGALPLAATLCSEEIFDSHLSSDKKKTFFHSSSYTANPIACAAALANLQIWEKEPVIERIKNLERMHADRLSLLKSNKKFVNIRQMGTIVALDFNVQNKGYFFDKNAKLKNFFREKKILIRPLGHIMYLMPPYCITATDLDHIYNTINEAVDFLEL
*****SNYPIWHPFVQHFCNPTFKKIIKTEGSYLIDENHDKIIDAISSWWVITHGHRHPIIMNAIRSASENYDQIIFSEYTHEPAEQLARLLIKIAPLGLQYVFFSDSGSTSIEVALKMALGFFNNNNMPRNKIVVMEHGYHGDTIGSMSVSMRGAFNNSYEPLLFDVETIPFPHHNEEQKTLDDLEKHCSTQKIAAFLVEPLILGAGGMQTYRPYILKEFMRITKKYDTLLIADEVMTGWGRTGKIFACNHADITPDILCLSKGITGGALPLAATLCSEEIFDSHLSSDKKKTFFHSSSYTANPIACAAALANLQIWEKEPVIERIKNLERMHADRLSLLKSNKKFVNIRQMGTIVALDFNVQNKGYFFDKNAKLKNFFREKKILIRPLGHIMYLMPPYCITATDLDHIYNTINEAVDFLEL
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNHLHSNYPIWHPFVQHFCNPTFKKIIKTEGSYLIDENHDKIIDAISSWWVITHGHRHPIIMNAIRSASENYDQIIFSEYTHEPAEQLARLLIKIAPLGLQYVFFSDSGSTSIEVALKMALGFFNNNNMPRNKIVVMEHGYHGDTIGSMSVSMRGAFNNSYEPLLFDVETIPFPHHNEEQKTLDDLEKHCSTQKIAAFLVEPLILGAGGMQTYRPYILKEFMRITKKYDTLLIADEVMTGWGRTGKIFACNHADITPDILCLSKGITGGALPLAATLCSEEIFDSHLSSDKKKTFFHSSSYTANPIACAAALANLQIWEKEPVIERIKNLERMHADRLSLLKSNKKFVNIRQMGTIVALDFNVQNKGYFFDKNAKLKNFFREKKILIRPLGHIMYLMPPYCITATDLDHIYNTINEAVDFLEL
MNHLHSNYPIWHPFVQHFCNPTFKKIIKTEGSYLIDENHDKIIDAISSWWVITHGHRHPIIMNAIRSASENYDQIIFSEYTHEPAEQLARLLIKIAPLGLQYVFFSDSGSTSIEVALKMALGFFNNNNMPRNKIVVMEHGYHGDTIGSMSVSMRGAFNNSYEPLLFDVETIPFPHHNEEQKTLDDLEKHCSTQKIAAFLVEPLILGAGGMQTYRPYILKEFMRITKKYDTLLIADEVMTGWGRTGKIFACNHADITPDILCLSKGITGGALPLAATLCSEEIFDSHLSSDKKKTFFHSSSYTANPIACAAALANLQIWEKEPVIERIKNLERMHADRLSLLKSNKKFVNIRQMGTIVALDFNVQNKGYFFDKNAKLKNFFREKKILIRPLGHIMYLMPPYCITATDLDHIYNTINEAVDFLEL
MNHLHSNYPIWHPFVQHFCNPTFKKIIKTEGSYLIDENHDKIIDAISSWWVITHGHRHPIIMNAIRSASENYDQIIFSEYTHEPAEQLARLLIKIAPLGLQYVFFSDSGSTSIEVALKMALGFFNNNNMPRNKIVVMEHGYHGDTIGSMSVSMRGAFNNSYEPLLFDVETIPFPHHNEEQKTLDDLEKHCSTQKIAAFLVEPLILGAGGMQTYRPYILKEFMRITKKYDTLLIADEVMTGWGRTGKIFACNHADITPDILCLSKGITGGALPLAATLCSEEIFDSHLSSDKKKTFFHSSSYTANPIACAAALANLQIWEKEPVIERIKNLERMHADRLSLLKSNKKFVNIRQMGTIVALDFNVQNKGYFFDKNAKLKNFFREKKILIRPLGHIMYLMPPYCITATDLDHIYNTINEAVDFLEL

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target423 adenosylmethionine--8-amino-7-oxononanoate transaminase
254780432392 acetylornithine transaminase protein [Candidatus L 7e-34
>gi|254780432|ref|YP_003064845.1| acetylornithine transaminase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 392 Back     alignment
 Score =  136 bits (342), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 109/384 (28%), Positives = 183/384 (47%), Gaps = 31/384 (8%)

Query: 28  KTEGSYLIDENHDKIIDAISSWWVITHGHRHPIIMNAIRSASENYDQIIFSEYTHEPAEQ 87
           K +G++L  EN    +D  S   V + GH HP ++  ++S SE    +  + Y     E 
Sbjct: 20  KGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVS-NLYQSTQQEI 78

Query: 88  LARLLIKIAPLGLQYVFFSDSGSTSIEVALKMALGF-FNNNNMPRNKIVVMEHGYHGDTI 146
            A  LI         VFF++SG+ S+E A+K A  + +      + +IV  E  +HG T+
Sbjct: 79  FANHLIH--STFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTL 136

Query: 147 GSMSVSMRGAFNNSYEPLLFDVETIPFPHHNEEQKTLDDLEKHCSTQKIAAFLVEPLILG 206
            ++S   +  +   + P +   +   F         L  L+   S    AA L+EP I G
Sbjct: 137 ATISAGGKLQYLEGFGPKIEGFDQAKFCD-------LQSLKNQISNDT-AAILIEP-IQG 187

Query: 207 AGGMQTYRPYILKEFMRITKKYDTLLIADEVMTGWGRTGKIFACNHADITPDILCLSKGI 266
            GG++      L++  +I    D LLI DEV TG+GRTGK+FA   A++ PDI+ ++KG+
Sbjct: 188 EGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGM 247

Query: 267 TGGALPLAATLCSEEIFDSHLSSDKKKTFFHSSSYTANPIACAAALANLQIWEKEPVIER 326
            GG  P+ A L + E+              H S+Y  N +A       L I + +  +E 
Sbjct: 248 -GGGFPIGACLATNEVAACMNQGS------HGSTYGGNVLAMVLGEKVLNIIQSDGFLEN 300

Query: 327 IKNLERMHADRLSLLKSN--KKFVNIRQMGTIVALDFNVQNKGYFFDKNAKLKNFFREKK 384
           + N+ ++  + L+ +K+     F+ +R  G ++ L      K  F    A L   FR++ 
Sbjct: 301 VINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGL------KTVF--SPALLAAKFRDEC 352

Query: 385 ILIRPLG-HIMYLMPPYCITATDL 407
           +L  P   +++ ++PP  ITA ++
Sbjct: 353 LLTAPSSDNVVRILPPLTITAEEI 376

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target423 adenosylmethionine--8-amino-7-oxononanoate transaminase
315122055423 adenosylmethionine--8-amino-7-oxononanoate transaminase 1 0.0
239833332424 adenosylmethionine-8-amino-7-oxononanoate transaminase 1 1e-166
153010144424 adenosylmethionine--8-amino-7-oxononanoate transaminase 1 1e-158
332716726437 Adenosylmethionine-8-amino-7-oxononanoateaminotransfera 1 1e-155
227823049422 adenosylmethionine--8-amino-7-oxononanoate transaminase 1 1e-153
15890968430 adenosylmethionine--8-amino-7-oxononanoate transaminase 1 1e-153
256059303424 adenosylmethionine--8-amino-7-oxononanoate transaminase 1 1e-153
23500236424 adenosylmethionine--8-amino-7-oxononanoate transaminase 1 1e-153
17989123424 adenosylmethionine--8-amino-7-oxononanoate transaminase 1 1e-153
62317647424 adenosylmethionine--8-amino-7-oxononanoate transaminase 1 1e-152
>gi|315122055|ref|YP_004062544.1| adenosylmethionine--8-amino-7-oxononanoate transaminase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 423 Back     alignment and organism information
 Score =  743 bits (1919), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/423 (82%), Positives = 394/423 (93%)

Query: 1   MNHLHSNYPIWHPFVQHFCNPTFKKIIKTEGSYLIDENHDKIIDAISSWWVITHGHRHPI 60
           MN+ +  +PIWHPFVQHF NPTF KIIKT+G+YLIDE+H+KIIDAISSWWVITHGH +P 
Sbjct: 1   MNNSNYKFPIWHPFVQHFFNPTFNKIIKTQGTYLIDEDHNKIIDAISSWWVITHGHCYPK 60

Query: 61  IMNAIRSASENYDQIIFSEYTHEPAEQLARLLIKIAPLGLQYVFFSDSGSTSIEVALKMA 120
           IM AIRSAS+NYDQIIF+EYTHEPAE+LA+ LIKI P GLQYVFFSDSGSTS+EVALKMA
Sbjct: 61  IMRAIRSASKNYDQIIFAEYTHEPAEKLAKSLIKIVPPGLQYVFFSDSGSTSVEVALKMA 120

Query: 121 LGFFNNNNMPRNKIVVMEHGYHGDTIGSMSVSMRGAFNNSYEPLLFDVETIPFPHHNEEQ 180
           LGFF NNN+ R+KIVVMEHGYHGDTIG+MSV MRGAFNN Y+PLLFDVE IPFP+ + EQ
Sbjct: 121 LGFFYNNNIERHKIVVMEHGYHGDTIGAMSVGMRGAFNNPYQPLLFDVEKIPFPYPHSEQ 180

Query: 181 KTLDDLEKHCSTQKIAAFLVEPLILGAGGMQTYRPYILKEFMRITKKYDTLLIADEVMTG 240
           +T+D LE+HC T+KIAA L+EPLILGAGGM+TYRPY+LKEF+RITKKYDTLLIADEVMTG
Sbjct: 181 ETIDCLEQHCRTKKIAALLIEPLILGAGGMKTYRPYLLKEFIRITKKYDTLLIADEVMTG 240

Query: 241 WGRTGKIFACNHADITPDILCLSKGITGGALPLAATLCSEEIFDSHLSSDKKKTFFHSSS 300
           WGRTG++FACNHA+ITPDILCLSKGITGGALPLAATLCSEEIFDSH+SSD +KTFFHSSS
Sbjct: 241 WGRTGELFACNHANITPDILCLSKGITGGALPLAATLCSEEIFDSHVSSDPRKTFFHSSS 300

Query: 301 YTANPIACAAALANLQIWEKEPVIERIKNLERMHADRLSLLKSNKKFVNIRQMGTIVALD 360
           YTANPIACAAALANL+IW+KEPV+ERIKNLE+MHAD+L L +SNKKF+NIRQ+GTIVALD
Sbjct: 301 YTANPIACAAALANLKIWQKEPVMERIKNLEKMHADKLLLFQSNKKFINIRQIGTIVALD 360

Query: 361 FNVQNKGYFFDKNAKLKNFFREKKILIRPLGHIMYLMPPYCITATDLDHIYNTINEAVDF 420
            NVQNKGYFF KNA+LK FFREK ILIRPLG+++YLMPPYCIT++D+DHIYNTINE VDF
Sbjct: 361 LNVQNKGYFFKKNAELKKFFREKNILIRPLGNVIYLMPPYCITSSDIDHIYNTINETVDF 420

Query: 421 LEL 423
           LEL
Sbjct: 421 LEL 423


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|239833332|ref|ZP_04681660.1| adenosylmethionine-8-amino-7-oxononanoate transaminase [Ochrobactrum intermedium LMG 3301] Length = 424 Back     alignment and organism information
>gi|153010144|ref|YP_001371358.1| adenosylmethionine--8-amino-7-oxononanoate transaminase [Ochrobactrum anthropi ATCC 49188] Length = 424 Back     alignment and organism information
>gi|332716726|ref|YP_004444192.1| Adenosylmethionine-8-amino-7-oxononanoateaminotransferase [Agrobacterium sp. H13-3] Length = 437 Back     alignment and organism information
>gi|227823049|ref|YP_002827021.1| adenosylmethionine--8-amino-7-oxononanoate transaminase [Sinorhizobium fredii NGR234] Length = 422 Back     alignment and organism information
>gi|15890968|ref|NP_356640.1| adenosylmethionine--8-amino-7-oxononanoate transaminase [Agrobacterium tumefaciens str. C58] Length = 430 Back     alignment and organism information
>gi|256059303|ref|ZP_05449505.1| adenosylmethionine--8-amino-7-oxononanoate transaminase [Brucella neotomae 5K33] Length = 424 Back     alignment and organism information
>gi|23500236|ref|NP_699676.1| adenosylmethionine--8-amino-7-oxononanoate transaminase [Brucella suis 1330] Length = 424 Back     alignment and organism information
>gi|17989123|ref|NP_541756.1| adenosylmethionine--8-amino-7-oxononanoate transaminase [Brucella melitensis bv. 1 str. 16M] Length = 424 Back     alignment and organism information
>gi|62317647|ref|YP_223500.1| adenosylmethionine--8-amino-7-oxononanoate transaminase [Brucella abortus bv. 1 str. 9-941] Length = 424 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target423 adenosylmethionine--8-amino-7-oxononanoate transaminase
PRK05964423 PRK05964, PRK05964, adenosylmethionine--8-amino-7-oxono 0.0
cd00610413 cd00610, OAT_like, Acetyl ornithine aminotransferase fa 1e-102
PRK07030466 PRK07030, PRK07030, adenosylmethionine--8-amino-7-oxono 4e-95
PRK06916460 PRK06916, PRK06916, adenosylmethionine--8-amino-7-oxono 9e-91
PRK07986428 PRK07986, PRK07986, adenosylmethionine--8-amino-7-oxono 3e-86
TIGR00508427 TIGR00508, bioA, adenosylmethionine-8-amino-7-oxononano 5e-86
PRK08742472 PRK08742, PRK08742, adenosylmethionine--8-amino-7-oxono 9e-85
PRK06943453 PRK06943, PRK06943, adenosylmethionine--8-amino-7-oxono 4e-80
PRK05630422 PRK05630, PRK05630, adenosylmethionine--8-amino-7-oxono 1e-77
PRK06173429 PRK06173, PRK06173, adenosylmethionine--8-amino-7-oxono 7e-76
COG4992404 COG4992, ArgD, Ornithine/acetylornithine aminotransfera 2e-65
COG0160447 COG0160, GabT, 4-aminobutyrate aminotransferase and rel 8e-65
PRK07481449 PRK07481, PRK07481, hypothetical protein; Provisional 9e-62
PRK09221445 PRK09221, PRK09221, beta alanine--pyruvate transaminase 1e-61
PRK13360442 PRK13360, PRK13360, omega amino acid--pyruvate transami 1e-60
PRK02627396 PRK02627, PRK02627, acetylornithine aminotransferase; P 5e-60
KOG1404442 KOG1404, KOG1404, KOG1404, Alanine-glyoxylate aminotran 8e-60
KOG1401433 KOG1401, KOG1401, KOG1401, Acetylornithine aminotransfe 5e-59
PRK08117433 PRK08117, PRK08117, 4-aminobutyrate aminotransferase; P 2e-55
PRK06105460 PRK06105, PRK06105, aminotransferase; Provisional 9e-55
PRK06917447 PRK06917, PRK06917, hypothetical protein; Provisional 2e-54
PRK07483443 PRK07483, PRK07483, hypothetical protein; Provisional 5e-54
TIGR00707379 TIGR00707, argD, acetylornithine and succinylornithine 1e-53
PRK07036466 PRK07036, PRK07036, hypothetical protein; Provisional 3e-53
KOG1402427 KOG1402, KOG1402, KOG1402, Ornithine aminotransferase [ 1e-52
PRK07480456 PRK07480, PRK07480, putative aminotransferase; Validate 2e-51
PRK07678451 PRK07678, PRK07678, aminotransferase; Validated 7e-51
PTZ00125400 PTZ00125, PTZ00125, ornithine aminotransferase-like pro 3e-49
PLN02974817 PLN02974, PLN02974, adenosylmethionine-8-amino-7-oxonon 4e-49
TIGR03372442 TIGR03372, putres_am_tran, putrescine aminotransferase 4e-48
PLN02760504 PLN02760, PLN02760, 4-aminobutyrate:pyruvate transamina 7e-44
PRK06082459 PRK06082, PRK06082, 4-aminobutyrate aminotransferase; P 3e-43
PRK01278389 PRK01278, argD, acetylornithine transaminase protein; P 4e-43
TIGR01885401 TIGR01885, Orn_aminotrans, ornithine aminotransferase 7e-43
PRK03244398 PRK03244, argD, acetylornithine aminotransferase; Provi 9e-42
PRK07482461 PRK07482, PRK07482, hypothetical protein; Provisional 2e-41
PRK08360443 PRK08360, PRK08360, 4-aminobutyrate aminotransferase; P 1e-40
PRK12403460 PRK12403, PRK12403, putative aminotransferase; Provisio 2e-40
PLN02624474 PLN02624, PLN02624, ornithine-delta-aminotransferase 3e-40
PRK08593445 PRK08593, PRK08593, 4-aminobutyrate aminotransferase; P 8e-38
PRK02936377 PRK02936, argD, acetylornithine aminotransferase; Provi 1e-37
PRK04073396 PRK04073, rocD, ornithine--oxo-acid transaminase; Provi 1e-37
PRK07495425 PRK07495, PRK07495, 4-aminobutyrate aminotransferase; P 9e-37
PRK04013364 PRK04013, argD, acetylornithine/acetyl-lysine aminotran 9e-36
COG0001432 COG0001, HemL, Glutamate-1-semialdehyde aminotransferas 2e-35
PRK06918451 PRK06918, PRK06918, 4-aminobutyrate aminotransferase; R 1e-34
PRK05965459 PRK05965, PRK05965, hypothetical protein; Provisional 6e-33
TIGR02407412 TIGR02407, ectoine_ectB, diaminobutyrate--2-oxoglutarat 1e-30
KOG1403452 KOG1403, KOG1403, KOG1403, Predicted alanine-glyoxylate 1e-28
PRK09264425 PRK09264, PRK09264, diaminobutyrate--2-oxoglutarate ami 5e-28
PRK00854401 PRK00854, rocD, ornithine--oxo-acid transaminase; Revie 3e-27
PRK04260375 PRK04260, PRK04260, acetylornithine aminotransferase; P 3e-26
PRK05639457 PRK05639, PRK05639, 4-aminobutyrate aminotransferase; P 5e-26
PRK06931459 PRK06931, PRK06931, diaminobutyrate--2-oxoglutarate ami 2e-25
PRK061481013 PRK06148, PRK06148, hypothetical protein; Provisional 2e-21
COG0161449 COG0161, BioA, Adenosylmethionine-8-amino-7-oxononanoat 1e-128
pfam00202338 pfam00202, Aminotran_3, Aminotransferase class-III 4e-81
PRK05769441 PRK05769, PRK05769, 4-aminobutyrate aminotransferase; P 2e-51
TIGR00700420 TIGR00700, GABAtrnsam, 4-aminobutyrate aminotransferase 3e-41
PRK06062451 PRK06062, PRK06062, hypothetical protein; Provisional 1e-38
PRK03715395 PRK03715, argD, acetylornithine transaminase protein; P 7e-38
TIGR03246397 TIGR03246, arg_catab_astC, succinylornithine transamina 7e-36
PRK05093403 PRK05093, argD, bifunctional N-succinyldiaminopimelate- 3e-35
PRK06058443 PRK06058, PRK06058, 4-aminobutyrate aminotransferase; P 1e-34
PRK06777421 PRK06777, PRK06777, 4-aminobutyrate aminotransferase; P 3e-32
TIGR00709442 TIGR00709, dat, 2,4-diaminobutyrate 4-transaminases 1e-31
PRK12381406 PRK12381, PRK12381, bifunctional succinylornithine tran 2e-31
PRK09792421 PRK09792, PRK09792, 4-aminobutyrate transaminase; Provi 2e-31
TIGR00713423 TIGR00713, hemL, glutamate-1-semialdehyde-2,1-aminomuta 1e-29
PRK08088425 PRK08088, PRK08088, 4-aminobutyrate aminotransferase; V 1e-26
PRK00062426 PRK00062, PRK00062, glutamate-1-semialdehyde aminotrans 6e-23
KOG1405484 KOG1405, KOG1405, KOG1405, 4-aminobutyrate aminotransfe 4e-22
PRK12389428 PRK12389, PRK12389, glutamate-1-semialdehyde aminotrans 1e-17
PRK11522459 PRK11522, PRK11522, putrescine--2-oxoglutarate aminotra 1e-52
PRK06541460 PRK06541, PRK06541, hypothetical protein; Provisional 2e-45
PRK06938464 PRK06938, PRK06938, diaminobutyrate--2-oxoglutarate ami 2e-28
PRK04612408 PRK04612, argD, acetylornithine transaminase protein; P 7e-28
PRK06149972 PRK06149, PRK06149, hypothetical protein; Provisional 1e-18
PRK00615433 PRK00615, PRK00615, glutamate-1-semialdehyde aminotrans 3e-17
PLN02482474 PLN02482, PLN02482, glutamate-1-semialdehyde 2,1-aminom 6e-11
PLN00144382 PLN00144, PLN00144, acetylornithine transaminase 4e-26
TIGR00699464 TIGR00699, GABAtrns_euk, 4-aminobutyrate aminotransfera 1e-19
TIGR03251431 TIGR03251, LAT_fam, L-lysine 6-transaminase 3e-19
PRK08297443 PRK08297, PRK08297, L-lysine aminotransferase; Provisio 3e-16
PRK07046453 PRK07046, PRK07046, aminotransferase; Validated 6e-11
PRK06209431 PRK06209, PRK06209, glutamate-1-semialdehyde 2,1-aminom 2e-08
COG0156388 COG0156, BioF, 7-keto-8-aminopelargonate synthetase and 0.001
>gnl|CDD|180329 PRK05964, PRK05964, adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>gnl|CDD|99735 cd00610, OAT_like, Acetyl ornithine aminotransferase family Back     alignment and domain information
>gnl|CDD|180800 PRK07030, PRK07030, adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>gnl|CDD|180746 PRK06916, PRK06916, adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>gnl|CDD|181189 PRK07986, PRK07986, adenosylmethionine--8-amino-7-oxononanoate transaminase; Validated Back     alignment and domain information
>gnl|CDD|161905 TIGR00508, bioA, adenosylmethionine-8-amino-7-oxononanoate transaminase Back     alignment and domain information
>gnl|CDD|181545 PRK08742, PRK08742, adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>gnl|CDD|180767 PRK06943, PRK06943, adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>gnl|CDD|180174 PRK05630, PRK05630, adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>gnl|CDD|180441 PRK06173, PRK06173, adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>gnl|CDD|34597 COG4992, ArgD, Ornithine/acetylornithine aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|30509 COG0160, GabT, 4-aminobutyrate aminotransferase and related aminotransferases [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|168967 PRK07481, PRK07481, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|181707 PRK09221, PRK09221, beta alanine--pyruvate transaminase; Provisional Back     alignment and domain information
>gnl|CDD|183999 PRK13360, PRK13360, omega amino acid--pyruvate transaminase; Provisional Back     alignment and domain information
>gnl|CDD|179453 PRK02627, PRK02627, acetylornithine aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|36618 KOG1404, KOG1404, KOG1404, Alanine-glyoxylate aminotransferase AGT2 [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|36615 KOG1401, KOG1401, KOG1401, Acetylornithine aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|181234 PRK08117, PRK08117, 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|180401 PRK06105, PRK06105, aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|180747 PRK06917, PRK06917, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|180996 PRK07483, PRK07483, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|162005 TIGR00707, argD, acetylornithine and succinylornithine aminotransferases Back     alignment and domain information
>gnl|CDD|168777 PRK07036, PRK07036, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|36616 KOG1402, KOG1402, KOG1402, Ornithine aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|180994 PRK07480, PRK07480, putative aminotransferase; Validated Back     alignment and domain information
>gnl|CDD|181078 PRK07678, PRK07678, aminotransferase; Validated Back     alignment and domain information
>gnl|CDD|185461 PTZ00125, PTZ00125, ornithine aminotransferase-like protein; Provisional Back     alignment and domain information
>gnl|CDD|178557 PLN02974, PLN02974, adenosylmethionine-8-amino-7-oxononanoate transaminase Back     alignment and domain information
>gnl|CDD|132415 TIGR03372, putres_am_tran, putrescine aminotransferase Back     alignment and domain information
>gnl|CDD|178360 PLN02760, PLN02760, 4-aminobutyrate:pyruvate transaminase Back     alignment and domain information
>gnl|CDD|180390 PRK06082, PRK06082, 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|179270 PRK01278, argD, acetylornithine transaminase protein; Provisional Back     alignment and domain information
>gnl|CDD|130940 TIGR01885, Orn_aminotrans, ornithine aminotransferase Back     alignment and domain information
>gnl|CDD|179555 PRK03244, argD, acetylornithine aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|180995 PRK07482, PRK07482, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|181401 PRK08360, PRK08360, 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|171472 PRK12403, PRK12403, putative aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|178231 PLN02624, PLN02624, ornithine-delta-aminotransferase Back     alignment and domain information
>gnl|CDD|181493 PRK08593, PRK08593, 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|179505 PRK02936, argD, acetylornithine aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|179736 PRK04073, rocD, ornithine--oxo-acid transaminase; Provisional Back     alignment and domain information
>gnl|CDD|181002 PRK07495, PRK07495, 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|101376 PRK04013, argD, acetylornithine/acetyl-lysine aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|30350 COG0001, HemL, Glutamate-1-semialdehyde aminotransferase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|180748 PRK06918, PRK06918, 4-aminobutyrate aminotransferase; Reviewed Back     alignment and domain information
>gnl|CDD|180330 PRK05965, PRK05965, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|162844 TIGR02407, ectoine_ectB, diaminobutyrate--2-oxoglutarate aminotransferase Back     alignment and domain information
>gnl|CDD|36617 KOG1403, KOG1403, KOG1403, Predicted alanine-glyoxylate aminotransferase [General function prediction only] Back     alignment and domain information
>gnl|CDD|181737 PRK09264, PRK09264, diaminobutyrate--2-oxoglutarate aminotransferase; Validated Back     alignment and domain information
>gnl|CDD|167080 PRK00854, rocD, ornithine--oxo-acid transaminase; Reviewed Back     alignment and domain information
>gnl|CDD|179803 PRK04260, PRK04260, acetylornithine aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|168145 PRK05639, PRK05639, 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|180758 PRK06931, PRK06931, diaminobutyrate--2-oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|180426 PRK06148, PRK06148, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|30510 COG0161, BioA, Adenosylmethionine-8-amino-7-oxononanoate aminotransferase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|143959 pfam00202, Aminotran_3, Aminotransferase class-III Back     alignment and domain information
>gnl|CDD|180248 PRK05769, PRK05769, 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|129783 TIGR00700, GABAtrnsam, 4-aminobutyrate aminotransferase, prokaryotic type Back     alignment and domain information
>gnl|CDD|180376 PRK06062, PRK06062, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|179636 PRK03715, argD, acetylornithine transaminase protein; Provisional Back     alignment and domain information
>gnl|CDD|132290 TIGR03246, arg_catab_astC, succinylornithine transaminase family Back     alignment and domain information
>gnl|CDD|179933 PRK05093, argD, bifunctional N-succinyldiaminopimelate- aminotransferase/acetylornithine transaminase protein; Reviewed Back     alignment and domain information
>gnl|CDD|180372 PRK06058, PRK06058, 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|180690 PRK06777, PRK06777, 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|129792 TIGR00709, dat, 2,4-diaminobutyrate 4-transaminases Back     alignment and domain information
>gnl|CDD|183486 PRK12381, PRK12381, bifunctional succinylornithine transaminase/acetylornithine transaminase; Provisional Back     alignment and domain information
>gnl|CDD|182078 PRK09792, PRK09792, 4-aminobutyrate transaminase; Provisional Back     alignment and domain information
>gnl|CDD|162007 TIGR00713, hemL, glutamate-1-semialdehyde-2,1-aminomutase Back     alignment and domain information
>gnl|CDD|181227 PRK08088, PRK08088, 4-aminobutyrate aminotransferase; Validated Back     alignment and domain information
>gnl|CDD|178834 PRK00062, PRK00062, glutamate-1-semialdehyde aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|36619 KOG1405, KOG1405, KOG1405, 4-aminobutyrate aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|183493 PRK12389, PRK12389, glutamate-1-semialdehyde aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|183175 PRK11522, PRK11522, putrescine--2-oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|180611 PRK06541, PRK06541, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|180764 PRK06938, PRK06938, diaminobutyrate--2-oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|179868 PRK04612, argD, acetylornithine transaminase protein; Provisional Back     alignment and domain information
>gnl|CDD|180427 PRK06149, PRK06149, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|134334 PRK00615, PRK00615, glutamate-1-semialdehyde aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|178100 PLN02482, PLN02482, glutamate-1-semialdehyde 2,1-aminomutase Back     alignment and domain information
>gnl|CDD|177748 PLN00144, PLN00144, acetylornithine transaminase Back     alignment and domain information
>gnl|CDD|129782 TIGR00699, GABAtrns_euk, 4-aminobutyrate aminotransferase, eukaryotic type Back     alignment and domain information
>gnl|CDD|132295 TIGR03251, LAT_fam, L-lysine 6-transaminase Back     alignment and domain information
>gnl|CDD|181363 PRK08297, PRK08297, L-lysine aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|180807 PRK07046, PRK07046, aminotransferase; Validated Back     alignment and domain information
>gnl|CDD|180471 PRK06209, PRK06209, glutamate-1-semialdehyde 2,1-aminomutase; Provisional Back     alignment and domain information
>gnl|CDD|30505 COG0156, BioF, 7-keto-8-aminopelargonate synthetase and related enzymes [Coenzyme metabolism] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 423 adenosylmethionine--8-amino-7-oxononanoate transaminase
TIGR00707402 argD acetylornithine and succinylornithine aminotransfe 100.0
PRK07030467 adenosylmethionine--8-amino-7-oxononanoate transaminase 100.0
PRK08742472 adenosylmethionine--8-amino-7-oxononanoate transaminase 100.0
PRK05964421 adenosylmethionine--8-amino-7-oxononanoate transaminase 100.0
COG0161449 BioA Adenosylmethionine-8-amino-7-oxononanoate aminotra 100.0
PRK13360441 omega amino acid--pyruvate transaminase; Provisional 100.0
PRK06943452 adenosylmethionine--8-amino-7-oxononanoate transaminase 100.0
PRK06105460 aminotransferase; Provisional 100.0
PRK09221445 beta alanine--pyruvate transaminase; Provisional 100.0
PRK06916462 adenosylmethionine--8-amino-7-oxononanoate transaminase 100.0
PRK09044418 consensus 100.0
PRK05965459 hypothetical protein; Provisional 100.0
PRK06541460 hypothetical protein; Provisional 100.0
PRK07482461 hypothetical protein; Provisional 100.0
PRK07480459 putative aminotransferase; Validated 100.0
PRK08466430 consensus 100.0
PRK07481448 hypothetical protein; Provisional 100.0
PRK07894430 consensus 100.0
PRK07986428 adenosylmethionine--8-amino-7-oxononanoate transaminase 100.0
PRK07036466 hypothetical protein; Provisional 100.0
PRK05630423 adenosylmethionine--8-amino-7-oxononanoate transaminase 100.0
PRK06173429 adenosylmethionine--8-amino-7-oxononanoate transaminase 100.0
PRK07678451 aminotransferase; Validated 100.0
PRK12403460 putative aminotransferase; Provisional 100.0
TIGR01885426 Orn_aminotrans ornithine--oxo-acid transaminase; InterP 100.0
COG4992404 ArgD Ornithine/acetylornithine aminotransferase [Amino 100.0
PRK07483443 hypothetical protein; Provisional 100.0
PRK06062434 hypothetical protein; Provisional 100.0
PRK06917447 hypothetical protein; Provisional 100.0
PRK02627398 acetylornithine aminotransferase; Provisional 100.0
cd00610413 OAT_like Acetyl ornithine aminotransferase family. This 100.0
PRK11522468 putrescine--2-oxoglutarate aminotransferase; Provisiona 100.0
PRK061481015 hypothetical protein; Provisional 100.0
PRK08593448 4-aminobutyrate aminotransferase; Provisional 100.0
COG0160447 GabT 4-aminobutyrate aminotransferase and related amino 100.0
PRK07495422 4-aminobutyrate aminotransferase; Provisional 100.0
PRK06058446 4-aminobutyrate aminotransferase; Provisional 100.0
PRK08360443 4-aminobutyrate aminotransferase; Provisional 100.0
PRK08117429 4-aminobutyrate aminotransferase; Provisional 100.0
PRK07323443 consensus 100.0
PRK06918454 4-aminobutyrate aminotransferase; Reviewed 100.0
PRK05093403 argD bifunctional N-succinyldiaminopimelate-aminotransf 100.0
PRK05769442 4-aminobutyrate aminotransferase; Provisional 100.0
PRK04612408 argD bifunctional N-succinyldiaminopimelate-aminotransf 100.0
PRK06149972 hypothetical protein; Provisional 100.0
PTZ00125415 ornithine aminotransferase; Provisional 100.0
PRK06777421 4-aminobutyrate aminotransferase; Provisional 100.0
PRK12381406 bifunctional succinylornithine transaminase/acetylornit 100.0
PRK06938464 diaminobutyrate--2-oxoglutarate aminotransferase; Provi 100.0
PRK06931454 diaminobutyrate--2-oxoglutarate aminotransferase; Provi 100.0
PRK05639457 4-aminobutyrate aminotransferase; Provisional 100.0
TIGR03246397 arg_catab_astC succinylornithine transaminase family. M 100.0
PRK03244398 argD acetylornithine aminotransferase; Provisional 100.0
PRK06082460 4-aminobutyrate aminotransferase; Provisional 100.0
PRK09792421 PLP-dependent GABA aminotransferase; Provisional 100.0
PRK08088426 4-aminobutyrate aminotransferase; Validated 100.0
PRK08555443 consensus 100.0
PRK01278389 argD bifunctional N-succinyldiaminopimelate-aminotransf 100.0
PRK03715395 argD bifunctional N-succinyldiaminopimelate-aminotransf 100.0
PRK04073396 rocD ornithine--oxo-acid transaminase; Provisional 100.0
PRK09264426 diaminobutyrate--2-oxoglutarate aminotransferase; Valid 100.0
PRK00854404 rocD ornithine--oxo-acid transaminase; Reviewed 100.0
TIGR03372442 putres_am_tran putrescine aminotransferase. Members of 100.0
PRK02936377 argD acetylornithine aminotransferase; Provisional 100.0
TIGR03251431 LAT_fam L-lysine 6-transaminase. Characterized members 100.0
PRK08297449 L-lysine aminotransferase; Provisional 100.0
PRK04260375 acetylornithine aminotransferase; Provisional 100.0
PRK04013364 argD acetylornithine/acetyl-lysine aminotransferase; Pr 100.0
KOG1404442 consensus 100.0
TIGR00700427 GABAtrnsam 4-aminobutyrate transaminase; InterPro: IPR0 100.0
PRK00062429 glutamate-1-semialdehyde aminotransferase; Provisional 100.0
TIGR02407413 ectoine_ectB diaminobutyrate--2-oxoglutarate aminotrans 100.0
PRK12389429 glutamate-1-semialdehyde aminotransferase; Provisional 100.0
PRK00615433 glutamate-1-semialdehyde aminotransferase; Provisional 100.0
PRK06942425 glutamate-1-semialdehyde 2,1-aminomutase; Validated 100.0
PRK07046452 aminotransferase; Validated 100.0
KOG1402427 consensus 100.0
TIGR00713434 hemL glutamate-1-semialdehyde-2,1-aminomutase; InterPro 100.0
PRK06209431 glutamate-1-semialdehyde 2,1-aminomutase; Provisional 100.0
KOG1401433 consensus 100.0
TIGR00709445 dat 2,4-diaminobutyrate 4-transaminase; InterPro: IPR00 100.0
COG0001432 HemL Glutamate-1-semialdehyde aminotransferase [Coenzym 100.0
KOG1403452 consensus 100.0
TIGR00699469 GABAtrns_euk 4-aminobutyrate aminotransferase; InterPro 100.0
KOG1405484 consensus 100.0
TIGR00508466 bioA adenosylmethionine-8-amino-7-oxononanoate transami 100.0
PRK05958387 8-amino-7-oxononanoate synthase; Reviewed 99.92
PRK06939395 2-amino-3-ketobutyrate coenzyme A ligase; Provisional 99.91
cd06454349 KBL_like KBL_like; this family belongs to the pyridoxal 99.9
PRK13392410 5-aminolevulinate synthase; Provisional 99.9
PRK07505405 hypothetical protein; Provisional 99.89
PRK09064406 5-aminolevulinate synthase; Validated 99.88
PRK07179408 hypothetical protein; Provisional 99.88
PRK13393404 5-aminolevulinate synthase; Provisional 99.88
TIGR00858378 bioF 8-amino-7-oxononanoate synthase; InterPro: IPR0047 99.87
TIGR01822395 2am3keto_CoA 2-amino-3-ketobutyrate coenzyme A ligase; 99.8
PRK05937370 8-amino-7-oxononanoate synthase; Provisional 99.79
COG0156388 BioF 7-keto-8-aminopelargonate synthetase and related e 99.79
TIGR01825392 gly_Cac_T_rel pyridoxal phosphate-dependent acyltransfe 99.75
PRK05764389 aspartate aminotransferase; Provisional 99.71
PRK07367385 consensus 99.7
PRK05794397 consensus 99.7
pfam00155351 Aminotran_1_2 Aminotransferase class I and II. 99.69
PRK08960387 hypothetical protein; Provisional 99.69
PRK08362389 consensus 99.69
PRK07212378 consensus 99.68
TIGR01821427 5aminolev_synth 5-aminolevulinic acid synthase; InterPr 99.68
PRK07337388 aminotransferase; Validated 99.68
PRK08443388 consensus 99.67
PRK06056402 consensus 99.67
PRK07310395 consensus 99.67
PRK06107402 aspartate aminotransferase; Provisional 99.67
PRK08361390 aspartate aminotransferase; Provisional 99.67
PRK07778386 consensus 99.66
PRK09148406 aminotransferase; Validated 99.65
PRK05957389 aspartate aminotransferase; Provisional 99.65
PRK08069390 consensus 99.65
PRK06375381 consensus 99.65
PRK02731367 histidinol-phosphate aminotransferase; Validated 99.64
PRK07682378 hypothetical protein; Validated 99.64
PRK09265404 aminotransferase AlaT; Validated 99.64
PRK07543400 consensus 99.63
PRK00950369 histidinol-phosphate aminotransferase; Validated 99.63
PRK07550387 hypothetical protein; Provisional 99.63
PRK07366388 succinyldiaminopimelate transaminase; Validated 99.63
PRK06575399 consensus 99.62
PRK03566365 consensus 99.62
PRK05942394 aspartate aminotransferase; Provisional 99.62
PRK08068389 transaminase; Reviewed 99.62
PRK07683387 aminotransferase A; Validated 99.6
PRK08175395 aminotransferase; Validated 99.6
PRK10874401 cysteine sulfinate desulfinase; Provisional 99.6
PRK06290411 aspartate aminotransferase; Provisional 99.6
PRK08912387 hypothetical protein; Provisional 99.6
PRK09276385 aspartate aminotransferase; Provisional 99.59
TIGR03540383 DapC_direct LL-diaminopimelate aminotransferase. This c 99.59
PRK06507400 consensus 99.59
PRK07681399 aspartate aminotransferase; Provisional 99.59
PRK03158359 histidinol-phosphate aminotransferase; Provisional 99.59
TIGR03392398 FeS_syn_CsdA cysteine desulfurase, catalytic subunit Cs 99.59
PRK06108382 aspartate aminotransferase; Provisional 99.59
PRK04152364 consensus 99.58
PRK08636403 aspartate aminotransferase; Provisional 99.58
PRK06220384 consensus 99.58
PRK06358354 threonine-phosphate decarboxylase; Provisional 99.58
PRK01533366 histidinol-phosphate aminotransferase; Validated 99.57
PRK08363398 alanine aminotransferase; Validated 99.57
PRK09147397 aminotransferase; Provisional 99.55
PRK07568396 aspartate aminotransferase; Provisional 99.55
PRK05166374 histidinol-phosphate aminotransferase; Provisional 99.55
PRK07777386 aminotransferase; Validated 99.53
PRK12414384 putative aminotransferase; Provisional 99.51
PRK09295406 selenocysteine lyase; Validated 99.51
TIGR03538394 DapC_gpp succinyldiaminopimelate transaminase. This fam 99.5
PRK07392358 threonine-phosphate decarboxylase; Validated 99.48
PRK07309390 aromatic amino acid aminotransferase; Validated 99.47
PRK08056356 threonine-phosphate decarboxylase; Provisional 99.47
PRK13355518 bifunctional HTH-domain containing protein/aminotransfe 99.43
KOG1359417 consensus 99.42
COG0436393 Aspartate/tyrosine/aromatic aminotransferase [Amino aci 99.42
PRK07590409 L,L-diaminopimelate aminotransferase; Validated 99.42
TIGR03539357 DapC_actino succinyldiaminopimelate transaminase. This 99.39
PRK05387353 histidinol-phosphate aminotransferase; Provisional 99.39
PRK07865364 N-succinyldiaminopimelate aminotransferase; Reviewed 99.33
COG0520405 csdA Selenocysteine lyase/Cysteine desulfurase [Posttra 99.33
PRK05839376 hypothetical protein; Provisional 99.32
TIGR03542402 DAPAT_plant LL-diaminopimelate aminotransferase. This c 99.31
COG1167459 ARO8 Transcriptional regulators containing a DNA-bindin 99.22
PRK08354312 putative aminotransferase; Provisional 99.19
PRK06855433 aminotransferase; Validated 99.18
PRK03967337 histidinol-phosphate aminotransferase; Provisional 99.17
PRK07908346 hypothetical protein; Provisional 99.16
PRK05664330 threonine-phosphate decarboxylase; Reviewed 99.15
PRK06425332 histidinol-phosphate aminotransferase; Validated 99.14
COG1168388 MalY Bifunctional PLP-dependent enzyme with beta-cystat 99.01
KOG1549428 consensus 98.97
TIGR01979409 sufS cysteine desulfurases, SufS subfamily; InterPro: I 98.61
KOG1358467 consensus 98.56
PRK13238461 tnaA tryptophanase; Provisional 98.34
cd00617431 Tnase_like Tryptophanase family (Tnase). This family be 98.3
PRK13237459 tyrosine phenol-lyase; Provisional 98.27
COG3844407 Kynureninase [Amino acid transport and metabolism] 98.15
COG3033471 TnaA Tryptophanase [Amino acid transport and metabolism 98.0
TIGR01264415 tyr_amTase_E tyrosine aminotransferase; InterPro: IPR00 97.89
TIGR01140349 CobD L-threonine-O-3-phosphate decarboxylase, putative; 97.21
KOG1383491 consensus 96.37
TIGR02617468 tnaA_trp_ase tryptophanase; InterPro: IPR013440 Protein 94.13
TIGR01437391 selA_rel pyridoxal phosphate-dependent enzyme, putative 91.19
pfam00202338 Aminotran_3 Aminotransferase class-III. 100.0
TIGR03235354 DNA_S_dndA cysteine desulfurase DndA. This model descri 98.59
PRK06225375 aspartate aminotransferase; Provisional 99.72
TIGR03537350 DapC succinyldiaminopimelate transaminase. Note: the de 99.64
PRK06348383 aspartate aminotransferase; Provisional 99.64
cd06453373 SufS_like Cysteine desulfurase (SufS)-like. This family 99.62
PRK03321352 putative aminotransferase; Provisional 99.6
cd06502338 TA_like Low-specificity threonine aldolase (TA). This f 99.56
PRK06207406 aspartate aminotransferase; Provisional 99.54
PRK08153370 histidinol-phosphate aminotransferase; Provisional 99.54
PRK09082386 putative aminotransferase; Validated 99.53
PRK02948381 cysteine desulfurase; Provisional 99.5
PRK10534333 L-threonine aldolase; Provisional 99.5
PRK06836396 aspartate aminotransferase; Provisional 99.49
PRK13479368 2-aminoethylphosphonate--pyruvate transaminase; Provisi 99.48
pfam00266371 Aminotran_5 Aminotransferase class-V. This domain is fo 99.46
TIGR03403382 nifS_epsilon cysteine desulfurase, NifS family, epsilon 99.46
COG2008342 GLY1 Threonine aldolase [Amino acid transport and metab 99.45
PRK02610369 histidinol-phosphate aminotransferase; Provisional 99.44
PRK04870356 histidinol-phosphate aminotransferase; Provisional 99.42
cd00609350 AAT_like Aspartate aminotransferase family. This family 99.42
cd06452361 SepCysS Sep-tRNA:Cys-tRNA synthase. This family belongs 99.42
TIGR03301355 PhnW-AepZ 2-aminoethylphosphonate aminotransferase. Thi 99.4
PRK09105374 putative aminotransferase; Provisional 99.39
COG1104386 NifS Cysteine sulfinate desulfinase/cysteine desulfuras 99.39
PRK03317369 histidinol-phosphate aminotransferase; Provisional 99.38
TIGR03402379 FeS_nifS cysteine desulfurase NifS. Members of this pro 99.36
PRK09440416 avtA valine--pyruvate transaminase; Provisional 99.36
TIGR01141377 hisC histidinol-phosphate aminotransferase; InterPro: I 99.35
COG0079356 HisC Histidinol-phosphate/aromatic aminotransferase and 99.29
KOG1368384 consensus 99.21
TIGR01977384 am_tr_V_EF2568 cysteine desulfurase family protein; Int 99.06
COG0075383 Serine-pyruvate aminotransferase/archaeal aspartate ami 99.06
PRK13520375 L-tyrosine decarboxylase; Provisional 99.04
KOG1360570 consensus 99.03
TIGR03588380 PseC UDP-4-keto-6-deoxy-N-acetylglucosamine 4-aminotran 99.02
PRK04366490 glycine dehydrogenase subunit 2; Validated 99.0
pfam01041363 DegT_DnrJ_EryC1 DegT/DnrJ/EryC1/StrS aminotransferase f 98.99
PRK09331386 Sep-tRNA:Cys-tRNA synthetase; Provisional 98.99
TIGR01265424 tyr_nico_aTase tyrosine/nicotianamine aminotransferases 98.93
PRK11706375 TDP-4-oxo-6-deoxy-D-glucose transaminase; Provisional 98.87
PRK11658379 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotran 98.86
cd00616352 AHBA_syn 3-amino-5-hydroxybenzoic acid synthase family 98.86
KOG2862385 consensus 98.83
PRK00451449 glycine dehydrogenase subunit 1; Validated 98.78
KOG0259447 consensus 98.75
cd00613398 GDC-P Glycine cleavage system P-protein, alpha- and bet 98.62
PRK07504397 O-succinylhomoserine sulfhydrylase; Reviewed 98.54
COG0399374 WecE Predicted pyridoxal phosphate-dependent enzyme app 98.47
PRK04311465 selenocysteine synthase; Provisional 98.19
TIGR02326366 transamin_PhnW 2-aminoethylphosphonate--pyruvate transa 98.01
COG0112413 GlyA Glycine/serine hydroxymethyltransferase [Amino aci 97.7
COG0403450 GcvP Glycine cleavage system protein P (pyridoxal-bindi 97.24
TIGR02006404 IscS cysteine desulfurase IscS; InterPro: IPR010240 Thi 96.79
pfam02347429 GDC-P Glycine cleavage system P-protein. This family co 96.55
KOG3846465 consensus 96.34
TIGR01976410 am_tr_V_VC1184 cysteine desulfurase family protein; Int 96.15
TIGR00461965 gcvP glycine dehydrogenase; InterPro: IPR003437 This fa 96.05
TIGR01814444 kynureninase kynureninase; InterPro: IPR010111 This ent 95.61
TIGR02080383 O_succ_thio_ly O-succinylhomoserine (thiol)-lyase; Inte 94.94
PRK07324373 transaminase; Validated 99.62
cd06451356 AGAT_like Alanine-glyoxylate aminotransferase (AGAT) fa 99.58
PRK04635346 histidinol-phosphate aminotransferase; Provisional 99.24
PRK04781362 histidinol-phosphate aminotransferase; Provisional 99.23
PRK01688355 histidinol-phosphate aminotransferase; Provisional 99.09
PRK03262355 consensus 99.06
PRK08637386 hypothetical protein; Provisional 98.93
PRK08064390 cystathionine beta-lyase; Provisional 98.79
COG1003496 GcvP Glycine cleavage system protein P (pyridoxal-bindi 98.74
PRK08247366 cystathionine gamma-synthase; Reviewed 98.72
PRK09028394 cystathionine beta-lyase; Provisional 98.71
PRK06176379 cystathionine gamma-synthase/cystathionine beta-lyase; 98.71
PRK05967392 cystathionine beta-lyase; Provisional 98.66
PRK06460375 hypothetical protein; Provisional 98.63
PRK12566954 glycine dehydrogenase; Provisional 98.56
PRK07503403 methionine gamma-lyase; Provisional 98.55
PRK05968389 hypothetical protein; Provisional 98.52
pfam01053381 Cys_Met_Meta_PP Cys/Met metabolism PLP-dependent enzyme 98.51
PRK05367955 glycine dehydrogenase; Provisional 98.51
PRK07811386 cystathionine gamma-synthase; Provisional 98.49
PRK06767386 methionine gamma-lyase; Provisional 98.47
PRK08249398 cystathionine gamma-synthase; Provisional 98.47
PRK06234399 methionine gamma-lyase; Provisional 98.43
cd06450345 DOPA_deC_like DOPA decarboxylase family. This family be 98.42
PRK13034422 serine hydroxymethyltransferase; Reviewed 98.42
TIGR02539381 SepCysS Sep-tRNA:Cys-tRNA synthase; InterPro: IPR013375 98.41
PRK08114395 cystathionine beta-lyase; Provisional 98.39
PRK08045386 cystathionine gamma-synthase; Provisional 98.37
PRK08574384 cystathionine gamma-synthase; Provisional 98.34
PRK02769380 histidine decarboxylase; Provisional 98.33
PRK08133391 O-succinylhomoserine sulfhydrylase; Validated 98.33
PRK07049427 methionine gamma-lyase; Validated 98.29
KOG0256471 consensus 98.27
PRK07582370 cystathionine gamma-lyase; Validated 98.26
COG0626396 MetC Cystathionine beta-lyases/cystathionine gamma-synt 98.17
PRK00011415 glyA serine hydroxymethyltransferase; Reviewed 98.16
cd00378402 SHMT Serine-glycine hydroxymethyltransferase (SHMT). Th 98.14
PTZ00094450 serine hydroxymethyltransferase; Provisional 98.08
COG1103382 Archaea-specific pyridoxal phosphate-dependent enzymes 98.02
KOG20401001 consensus 98.02
PRK09257397 aromatic amino acid aminotransferase; Provisional 97.84
pfam00464380 SHMT Serine hydroxymethyltransferase. 97.82
KOG0634472 consensus 96.86
KOG0633375 consensus 96.6
KOG0629510 consensus 94.32
TIGR01328392 met_gam_lyase methionine gamma-lyase; InterPro: IPR0062 92.7
cd01494170 AAT_I Aspartate aminotransferase (AAT) superfamily (fol 99.33
PRK08134433 O-acetylhomoserine aminocarboxypropyltransferase; Valid 98.54
PRK05613437 O-acetylhomoserine aminocarboxypropyltransferase; Valid 98.49
PRK08248431 O-acetylhomoserine aminocarboxypropyltransferase; Valid 98.44
PRK06084424 O-acetylhomoserine aminocarboxypropyltransferase; Valid 98.39
PRK07812436 O-acetylhomoserine aminocarboxypropyltransferase; Valid 98.38
PRK05994426 O-acetylhomoserine aminocarboxypropyltransferase; Valid 98.36
PRK05939396 hypothetical protein; Provisional 98.33
PRK06702432 O-acetylhomoserine aminocarboxypropyltransferase; Valid 98.19
KOG0053409 consensus 97.73
cd00615294 Orn_deC_like Ornithine decarboxylase family. This famil 96.92
pfam00282370 Pyridoxal_deC Pyridoxal-dependent decarboxylase conserv 96.32
PRK06959339 putative threonine-phosphate decarboxylase; Provisional 99.18
KOG1357519 consensus 98.77
COG3977417 Alanine-alpha-ketoisovalerate (or valine-pyruvate) amin 97.99
pfam05889389 SLA_LP_auto_ag Soluble liver antigen/liver pancreas ant 97.27
PRK13580493 serine hydroxymethyltransferase; Provisional 97.18
TIGR03531444 selenium_SpcS O-phosphoseryl-tRNA(Sec) selenium transfe 96.95
COG1448396 TyrB Aspartate/tyrosine/aromatic aminotransferase [Amin 96.18
TIGR03576346 pyridox_MJ0158 pyridoxal phosphate enzyme, MJ0158 famil 94.85
PRK03080381 phosphoserine aminotransferase; Provisional 93.35
PRK05367 955 glycine dehydrogenase; Provisional 92.7
pfam01212288 Beta_elim_lyase Beta-eliminating lyase. 98.94
cd00614369 CGS_like CGS_like: Cystathionine gamma-synthase is a PL 98.59
PRK08776405 cystathionine gamma-synthase; Provisional 98.51
PRK07671377 cystathionine beta-lyase; Provisional 98.49
PRK08861388 cystathionine gamma-synthase; Provisional 98.48
PRK07810406 O-succinylhomoserine sulfhydrylase; Provisional 98.47
COG0076460 GadB Glutamate decarboxylase and related PLP-dependent 98.47
PRK07050394 cystathionine beta-lyase; Provisional 98.31
PRK07269364 cystathionine gamma-synthase; Reviewed 98.23
PRK06434384 cystathionine gamma-lyase; Validated 97.94
TIGR01325386 O_suc_HS_sulf O-succinylhomoserine sulfhydrylase; Inter 97.23
COG1921395 SelA Selenocysteine synthase [seryl-tRNASer selenium tr 92.49
COG2873426 MET17 O-acetylhomoserine sulfhydrylase [Amino acid tran 98.4
TIGR01326434 OAH_OAS_sulfhy O-acetylhomoserine aminocarboxypropyltra 97.98
KOG0257420 consensus 97.95
COG1453391 Predicted oxidoreductases of the aldo/keto reductase fa 93.31
pfam03841367 SelA L-seryl-tRNA selenium transferase. 97.82
pfam01276417 OKR_DC_1 Orn/Lys/Arg decarboxylase, major domain. 97.46
KOG0258475 consensus 94.09
PRK13578 720 ornithine decarboxylase; Provisional 92.52
>TIGR00707 argD acetylornithine and succinylornithine aminotransferases; InterPro: IPR004636 This family of proteins, for which ornithine aminotransferases form an outgroup, consists mostly of proteins designated acetylornithine aminotransferase Back     alignment and domain information
>PRK07030 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK08742 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK05964 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>COG0161 BioA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase [Coenzyme metabolism] Back     alignment and domain information
>PRK13360 omega amino acid--pyruvate transaminase; Provisional Back     alignment and domain information
>PRK06943 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK06105 aminotransferase; Provisional Back     alignment and domain information
>PRK09221 beta alanine--pyruvate transaminase; Provisional Back     alignment and domain information
>PRK06916 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK09044 consensus Back     alignment and domain information
>PRK05965 hypothetical protein; Provisional Back     alignment and domain information
>PRK06541 hypothetical protein; Provisional Back     alignment and domain information
>PRK07482 hypothetical protein; Provisional Back     alignment and domain information
>PRK07480 putative aminotransferase; Validated Back     alignment and domain information
>PRK08466 consensus Back     alignment and domain information
>PRK07481 hypothetical protein; Provisional Back     alignment and domain information