254780489

254780489

3-oxoacyl-(acyl carrier protein) synthase II

GeneID in NCBI database:8209478Locus tag:CLIBASIA_01880
Protein GI in NCBI database:254780489Protein Accession:YP_003064902.1
Gene range:+(411579, 412556)Protein Length:325aa
Gene description:3-oxoacyl-(acyl carrier protein) synthase II
COG prediction:none
KEGG prediction:3-oxoacyl-(acyl carrier protein) synthase II (EC:2.3.1.41); K00648 3-oxoacyl-[acyl-carrier-protein] synthase III [EC:2.3.1.180]
SEED prediction:Biotin synthesis protein bioZ
Pathway involved in KEGG:Fatty acid biosynthesis [PATH:las00061]
Subsystem involved in SEED:Biotin biosynthesis
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOP2 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-----
MIKSSSCILGFGHAVPNQCIHNSIIERHLNLKLGVIEQKTGIKYRYWAEKHETLTDIAIQAGDIALRNANIKKDSISLTLLATSTPDHLLPPSSPLITHRLGLMQSGAIDLTGACAGFLYALVMADSYINSHQKPVLIIAANLLSRRINLEDKDTAIIFGDAAGAVVLAPSPLKDKSGILGIELTSDGSKYDLIKIPTGGSTSPAGTNTHDFYMRITNGADIFYNAVKIMAQSAKQSLRKSDLQPQDINRFIPHQANSRIIQKVCEKIGLSKRIMVNSLKDFGNSSSASIPLSLSLENQRKPFQKGEKILTISCRRGNDRGIYCL
ccccEEEEEEEEEEccccEEcHHHHHHHccccHHHHHHHcccEEEEEEcccccHHHHHHHHHHHHHHHccccHHHccEEEEEEcccccccccHHHHHHHHccccccEEEEEccHHHHHHHHHHHHHHHHHcccccEEEEEcHHHcccccccccccEEEEEcEEEEEEEEcccccccccEEEEEEEEccccccEEEccccccccccccccccccEEEEcHHHHHHHHHHHHHHHHHHHHHHccccHHHccEEEEccccHHHHHHHHHHccccHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccccEEEEEEEcccHHHHHHHc
cccEEcEEEEEEEEcccEEEEHHHHHccccccHHHHHHHHcccEEEEccccccHHHHHHHHHHHHHHHHcccHHHccEEEEEccccccccccHHHHHHHHHccccccEEEEccHHHHHHHHHHHHHHHHHHcccccEEEEEHHHHEEcccccccEEEEEcccccEEEEEcccccccccEEEEEEccccccccEEEccccccccccccccccccEEEEcHHHHHHHHHHHHHHHHHHHHHHccccHHHEEEEEEccccHHHHHHHHHHccccHHHEcccHHHHcEcHHHHHHHHHHHHHHccccccccEEEEEEEEccHHHHHHHc
mikssscilgfghavpnqcihnsIIERHLNLKLGVIEQKTGIKYRYWAEKHETLTDIAIQAGDIALRNANIKKDSISLTLlatstpdhllppssplitHRLGLMQSGAIDLTGACAGFLYALVMADsyinshqkPVLIIAANLLSRrinledkdtaiifgdaagavvlapsplkdksgilgieltsdgskydlikiptggstspagtnthDFYMRITNGADIFYNAVKIMAQSAKQslrksdlqpqdinrfiphqanSRIIQKVCEKIGLSKRIMVNSLkdfgnsssasiplslslenqrkpfqkgekILTISCRrgndrgiycl
MIKSSSCILGFGHAVPNQCIHNSIIERHLNLKLGVIEQKTGIKYRYWAEKHETLTDIAIQAGDIALRNANIKKDSISLTLLATSTPDHLLPPSSPLITHRLGLMQSGAIDLTGACAGFLYALVMADSYINSHQKPVLIIAANLLSRRINLEDKDTAIIFGDAAGAVVlapsplkdksgILGIELTSDGSKYDLIKIPtggstspagtNTHDFYMRITNGADIFYNAVKIMAQSAKQSLRKSDLQPQDINRfiphqansriiQKVCEKIGLSKRIMVNSLKDFGNSSSASIPLSlslenqrkpfqkgekiltiscrrgndrgiycl
MIKSSSCILGFGHAVPNQCIHNSIIERHLNLKLGVIEQKTGIKYRYWAEKHETLTDIAIQAGDIALRNANIKKDSISLTLLATSTPDHLLPPSSPLITHRLGLMQSGAIDLTGACAGFLYALVMADSYINSHQKPVLIIAANLLSRRINLEDKDTAIIFGDAAGAVVLAPSPLKDKSGILGIELTSDGSKYDLIKIPTGGSTSPAGTNTHDFYMRITNGADIFYNAVKIMAQSAKQSLRKSDLQPQDINRFIPHQANSRIIQKVCEKIGLSKRIMVNSLKDFGNsssasiplslslENQRKPFQKGEKILTISCRRGNDRGIYCL
****SSC**GFGHAVPNQCIHNSIIERHLNLKLGVIEQKTGIKYRYWAEKHETLTDIAIQAGDIALRNANIKKDSISLTLLATSTPDHLLPPSSPLITHRLGLMQSGAIDLTGACAGFLYALVMADSYINSHQKPVLIIAANLLSRRINLEDKDTAIIFGDAAGAVVLAPSPLKDKSGILGIELTSDGSKYDLIKIPTGGST*******HDFYMRITNGADIFYNAVKIMAQSAKQSLRKSDLQPQDINRFIPHQANSRIIQKVCEKIGLSKRIMVNSLKDFGNSSSASIPLSLSLENQRKPFQKGEKILTISCRRGNDRGIYCL
MIKSSSCILGFGHAVPNQCIHNSIIERHLNLKLGVIEQKTGIKYRYWAEKHETLTDIAIQAGDIALRNANIKKDSISLTLLATSTPDHLLPPSSPLITHRLGLMQSGAIDLTGACAGFLYALVMADSYINSHQKPVLIIAANLLSRRINLEDKDTAIIFGDAAGAVVLAPSPLKDKSGILGIELTSDGSKYDLIKIPTGGSTSPAGTNTHDFYMRITNGADIFYNAVKIMAQ**********LQPQDINRFIPHQANSRIIQKVCEKIGLSKRIMVNSLKDFGNSSSASIPLSLSLENQRKPFQKGEKILTISCRRGNDRGIYCL
*IKSSSCILGFGHAVPNQCIHNSIIERHLNLKLGVIEQKTGIKYRYWAEKHETLTDIAIQAGDIALRNANIKKDSISLTLLATSTPDHLLPPSSPLITHRLGLMQSGAIDLTGACAGFLYALVMADSYINSHQKPVLIIAANLLSRRINLEDKDTAIIFGDAAGAVVLAPSPLKDKSGILGIELTSDGSKYDLIKIPTGGSTSPAGTNTHDFYMRITNGADIFYNAVKIMAQSAKQSLRKSDLQPQDINRFIPHQANSRIIQKVCEKIGLSKRIMVNSLKDFGNSSSASIPLSLSLENQRKPFQKGEKILTISCRRGNDRGIYCL
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIKSSSCILGFGHAVPNQCIHNSIIERHLNLKLGVIEQKTGIKYRYWAEKHETLTDIAIQAGDIALRNANIKKDSISLTLLATSTPDHLLPPSSPLITHRLGLMQSGAIDLTGACAGFLYALVMADSYINSHQKPVLIIAANLLSRRINLEDKDTAIIFGDAAGAVVLAPSPLKDKSGILGIELTSDGSKYDLIKIPTGGSTSPAGTNTHDFYMRITNGADIFYNAVKIMAQSAKQSLRKSDLQPQDINRFIPHQANSRIIQKVCEKIGLSKRIMVNSLKDFGNSSSASIPLSLSLENQRKPFQKGEKILTISCRRGNDRGIYCL
MIKSSSCILGFGHAVPNQCIHNSIIERHLNLKLGVIEQKTGIKYRYWAEKHETLTDIAIQAGDIALRNANIKKDSISLTLLATSTPDHLLPPSSPLITHRLGLMQSGAIDLTGACAGFLYALVMADSYINSHQKPVLIIAANLLSRRINLEDKDTAIIFGDAAGAVVLAPSPLKDKSGILGIELTSDGSKYDLIKIPTGGSTSPAGTNTHDFYMRITNGADIFYNAVKIMAQSAKQSLRKSDLQPQDINRFIPHQANSRIIQKVCEKIGLSKRIMVNSLKDFGNSSSASIPLSLSLENQRKPFQKGEKILTISCRRGNDRGIYCL
MIKSSSCILGFGHAVPNQCIHNSIIERHLNLKLGVIEQKTGIKYRYWAEKHETLTDIAIQAGDIALRNANIKKDSISLTLLATSTPDHLLPPSSPLITHRLGLMQSGAIDLTGACAGFLYALVMADSYINSHQKPVLIIAANLLSRRINLEDKDTAIIFGDAAGAVVLAPSPLKDKSGILGIELTSDGSKYDLIKIPTGGSTSPAGTNTHDFYMRITNGADIFYNAVKIMAQSAKQSLRKSDLQPQDINRFIPHQANSRIIQKVCEKIGLSKRIMVNSLKDFGNSSSASIPLSLSLENQRKPFQKGEKILTISCRRGNDRGIYCL

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target325 3-oxoacyl-(acyl carrier protein) synthase II [Candidatu
254780497324 3-oxoacyl-(acyl carrier protein) synthase III [Can 7e-45
>gi|254780497|ref|YP_003064910.1| 3-oxoacyl-(acyl carrier protein) synthase III [Candidatus Liberibacter asiaticus str. psy62] Length = 324 Back     alignment
 Score =  172 bits (436), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 105/315 (33%), Positives = 175/315 (55%), Gaps = 13/315 (4%)

Query: 1   MIKSSSCILGFGHAVPNQCIHNSIIERHLNLKLGVIEQKTGIKYRYWAEKHETLTDIAIQ 60
           MI+S+  + G G ++P + + NS +E  ++   G I+++ GI  R+ A K ET   +   
Sbjct: 1   MIRST--VRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEA 58

Query: 61  AGDIALRNANIKKDSISLTLLATSTPDHLLPPSSPLITHRLGLMQSGAIDLTGACAGFLY 120
           A   AL +A +  D I L ++ATSTPD   P ++  I +RLG+ +  A D+   C+GF+Y
Sbjct: 59  AARDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVY 118

Query: 121 ALVMADSYINSH-QKPVLIIAANLLSRRINLEDKDTAIIFGDAAGAVVLAPSPLKDKS-- 177
           A+  ADSYI S   + V++I ++  SR ++  D+ T ++FGD AGA++L    +K  S  
Sbjct: 119 AVTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMA 178

Query: 178 --GILGIELTSDGSKYDLIKIPTGGSTSPAGTNTHDFYMRITNGADIFYNAVKIMAQSAK 235
             GIL   L SDGS  D + +  G STS               G  +F  AV+   +  +
Sbjct: 179 DTGILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIR------MEGKAVFKYAVEKAVELIE 232

Query: 236 QSLRKSDLQPQDINRFIPHQANSRIIQKVCEKIGLSKRIMVNSLKDFGNSSSASIPLSLS 295
           +    + L  ++I+ F+PHQAN RII  + +K+ +    ++ ++   GN+S+ASIPL+L+
Sbjct: 233 KVFDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALA 292

Query: 296 LENQRKPFQKGEKIL 310
           +  +    +KG+ +L
Sbjct: 293 VAVKEGRVKKGDCLL 307

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target325 3-oxoacyl-(acyl carrier protein) synthase II [Candidatu
315122054328 3-oxoacyl-(acyl carrier protein) synthase II [Candidatu 1 1e-147
332716727328 3-oxoacyl-acyl carrier protein synthase II [Agrobacteri 1 1e-92
159185988328 3-oxoacyl-(acyl carrier protein) synthase II [Agrobacte 1 8e-91
306845844326 3-oxoacyl-(acyl carrier protein) synthase II [Brucella 1 3e-88
13488065327 3-oxoacyl-(acyl carrier protein) synthase II [Mesorhizo 1 4e-88
148558468326 3-oxoacyl-(acyl carrier protein) synthase II [Brucella 1 9e-88
17989124326 3-oxoacyl-(acyl carrier protein) synthase II [Brucella 1 1e-87
163844651326 3-oxoacyl-(acyl carrier protein) synthase II [Brucella 1 2e-87
254711696326 3-oxoacyl-(acyl carrier protein) synthase II [Brucella 1 5e-87
254720493326 3-oxoacyl-(acyl carrier protein) synthase II [Brucella 1 9e-87
>gi|315122054|ref|YP_004062543.1| 3-oxoacyl-(acyl carrier protein) synthase II [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 328 Back     alignment and organism information
 Score =  524 bits (1350), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 248/311 (79%), Positives = 288/311 (92%), Gaps = 2/311 (0%)

Query: 2   IKSSSCILGFGHAVPNQCIHNSIIERHLNLKLGVIEQKTGIKYRYWAEKHETLTDIAIQA 61
           +KSSSCILGFGH+VP+QCIHNSIIERHLNLK G+IE+KTGIKYRYWA K+ETLTDIAIQA
Sbjct: 1   MKSSSCILGFGHSVPSQCIHNSIIERHLNLKSGIIEKKTGIKYRYWAGKNETLTDIAIQA 60

Query: 62  GDIALRNANIKKDSISLTLLATSTPDHLLPPSSPLITHRLGLMQSGAIDLTGACAGFLYA 121
           GDIALRNANI KDSI+LTLLATSTPDHLLPPSSP++THRLGL++SGAIDLTGAC+GFLYA
Sbjct: 61  GDIALRNANINKDSIALTLLATSTPDHLLPPSSPVVTHRLGLLKSGAIDLTGACSGFLYA 120

Query: 122 LVMADSYINSHQKPVLIIAANLLSRRINLEDKDTAIIFGDAAGAVVLAPSPLKDKSGILG 181
           LV+ADSYIN HQKPVLIIAANLLSR +NLEDKDTAIIFGDAAGA+VLAPS LK  SGILG
Sbjct: 121 LVLADSYINLHQKPVLIIAANLLSRHVNLEDKDTAIIFGDAAGAIVLAPSSLKYTSGILG 180

Query: 182 IELTSDGSKYDLIKIPTGGSTSPA--GTNTHDFYMRITNGADIFYNAVKIMAQSAKQSLR 239
            EL SDGSKYDLIKIP GGST P    +N +DF++R+T+G+D+FYNAVKIM +SA ++L+
Sbjct: 181 TELMSDGSKYDLIKIPAGGSTVPTEKNSNPNDFFIRVTDGSDVFYNAVKIMTESALEALK 240

Query: 240 KSDLQPQDINRFIPHQANSRIIQKVCEKIGLSKRIMVNSLKDFGNSSSASIPLSLSLENQ 299
           ++ L+P+DI+RFIPHQAN+RI+QKVCEKIG+SK+ MVNSL +FGNSS+A+IPLSLSLEN+
Sbjct: 241 RAHLKPEDIDRFIPHQANTRILQKVCEKIGISKKTMVNSLSNFGNSSAATIPLSLSLENK 300

Query: 300 RKPFQKGEKIL 310
           RKPFQ GEKIL
Sbjct: 301 RKPFQAGEKIL 311


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|332716727|ref|YP_004444193.1| 3-oxoacyl-acyl carrier protein synthase II [Agrobacterium sp. H13-3] Length = 328 Back     alignment and organism information
>gi|159185988|ref|NP_356639.2| 3-oxoacyl-(acyl carrier protein) synthase II [Agrobacterium tumefaciens str. C58] Length = 328 Back     alignment and organism information
>gi|306845844|ref|ZP_07478412.1| 3-oxoacyl-(acyl carrier protein) synthase II [Brucella sp. BO1] Length = 326 Back     alignment and organism information
>gi|13488065|ref|NP_085659.1| 3-oxoacyl-(acyl carrier protein) synthase II [Mesorhizobium loti MAFF303099] Length = 327 Back     alignment and organism information
>gi|148558468|ref|YP_001257462.1| 3-oxoacyl-(acyl carrier protein) synthase II [Brucella ovis ATCC 25840] Length = 326 Back     alignment and organism information
>gi|17989124|ref|NP_541757.1| 3-oxoacyl-(acyl carrier protein) synthase II [Brucella melitensis bv. 1 str. 16M] Length = 326 Back     alignment and organism information
>gi|163844651|ref|YP_001622306.1| 3-oxoacyl-(acyl carrier protein) synthase II [Brucella suis ATCC 23445] Length = 326 Back     alignment and organism information
>gi|254711696|ref|ZP_05173507.1| 3-oxoacyl-(acyl carrier protein) synthase II [Brucella pinnipedialis B2/94] Length = 326 Back     alignment and organism information
>gi|254720493|ref|ZP_05182304.1| 3-oxoacyl-(acyl carrier protein) synthase II [Brucella sp. 83/13] Length = 326 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target325 3-oxoacyl-(acyl carrier protein) synthase II [Candidatu
PRK05963326 PRK05963, PRK05963, 3-oxoacyl-(acyl carrier protein) sy 1e-159
PRK09352319 PRK09352, PRK09352, 3-oxoacyl-(acyl carrier protein) sy 2e-79
COG0332323 COG0332, FabH, 3-oxoacyl-[acyl-carrier-protein] 6e-78
PRK12879325 PRK12879, PRK12879, 3-oxoacyl-(acyl carrier protein) sy 4e-72
TIGR00747318 TIGR00747, fabH, 3-oxoacyl-(acyl-carrier-protein) synth 8e-60
CHL00203326 CHL00203, fabH, 3-oxoacyl-acyl-carrier-protein synthase 1e-44
cd00827324 cd00827, init_cond_enzymes, "initiating" condensing enz 1e-33
PRK07204329 PRK07204, PRK07204, 3-oxoacyl-(acyl carrier protein) sy 2e-31
PRK12880353 PRK12880, PRK12880, 3-oxoacyl-(acyl carrier protein) sy 1e-27
PRK09258338 PRK09258, PRK09258, 3-oxoacyl-(acyl carrier protein) sy 4e-24
PRK06840339 PRK06840, PRK06840, hypothetical protein; Validated 1e-21
COG3425377 COG3425, PksG, 3-hydroxy-3-methylglutaryl CoA synthase 1e-18
COG3424356 COG3424, BcsA, Predicted naringenin-chalcone synthase [ 7e-12
cd00831361 cd00831, CHS_like, Chalcone and stilbene synthases; pla 4e-11
PRK06816378 PRK06816, PRK06816, 3-oxoacyl-(acyl carrier protein) sy 2e-10
PRK04262347 PRK04262, PRK04262, hypothetical protein; Provisional 4e-07
TIGR00748345 TIGR00748, HMG_CoA_syn_Arc, hydroxymethylglutaryl-CoA s 2e-04
cd00830320 cd00830, KAS_III, Ketoacyl-acyl carrier protein synthas 2e-83
PLN02326379 PLN02326, PLN02326, 3-oxoacyl-[acyl-carrier-protein] sy 1e-48
pfam0854580 pfam08545, ACP_syn_III, 3-Oxoacyl-[acyl-carrier-protein 1e-20
pfam0854190 pfam08541, ACP_syn_III_C, 3-Oxoacyl-[acyl-carrier-prote 4e-18
PRK07515372 PRK07515, PRK07515, 3-oxoacyl-(acyl carrier protein) sy 9e-15
cd00327254 cd00327, cond_enzymes, Condensing enzymes; Family of en 7e-13
cd00825332 cd00825, decarbox_cond_enzymes, decarboxylating condens 1e-14
cd00829375 cd00829, SCP-x_thiolase, Thiolase domain associated wit 0.003
>gnl|CDD|180328 PRK05963, PRK05963, 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>gnl|CDD|181792 PRK09352, PRK09352, 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>gnl|CDD|30680 COG0332, FabH, 3-oxoacyl-[acyl-carrier-protein] Back     alignment and domain information
>gnl|CDD|183809 PRK12879, PRK12879, 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>gnl|CDD|162020 TIGR00747, fabH, 3-oxoacyl-(acyl-carrier-protein) synthase III Back     alignment and domain information
>gnl|CDD|164577 CHL00203, fabH, 3-oxoacyl-acyl-carrier-protein synthase 3; Provisional Back     alignment and domain information
>gnl|CDD|29414 cd00827, init_cond_enzymes, "initiating" condensing enzymes are a subclass of decarboxylating condensing enzymes, including beta-ketoacyl [ACP] synthase, type III and polyketide synthases, type III, which include chalcone synthase and related enzymes Back     alignment and domain information
>gnl|CDD|180881 PRK07204, PRK07204, 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>gnl|CDD|171793 PRK12880, PRK12880, 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>gnl|CDD|181732 PRK09258, PRK09258, 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>gnl|CDD|180722 PRK06840, PRK06840, hypothetical protein; Validated Back     alignment and domain information
>gnl|CDD|33231 COG3425, PksG, 3-hydroxy-3-methylglutaryl CoA synthase [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|33230 COG3424, BcsA, Predicted naringenin-chalcone synthase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|29418 cd00831, CHS_like, Chalcone and stilbene synthases; plant-specific polyketide synthases (PKS) and related enzymes, also called type III PKSs Back     alignment and domain information
>gnl|CDD|180710 PRK06816, PRK06816, 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>gnl|CDD|179804 PRK04262, PRK04262, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|129831 TIGR00748, HMG_CoA_syn_Arc, hydroxymethylglutaryl-CoA synthase, putative Back     alignment and domain information
>gnl|CDD|29417 cd00830, KAS_III, Ketoacyl-acyl carrier protein synthase III (KASIII) initiates the elongation in type II fatty acid synthase systems Back     alignment and domain information
>gnl|CDD|177960 PLN02326, PLN02326, 3-oxoacyl-[acyl-carrier-protein] synthase III Back     alignment and domain information
>gnl|CDD|117122 pfam08545, ACP_syn_III, 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III Back     alignment and domain information
>gnl|CDD|117118 pfam08541, ACP_syn_III_C, 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C terminal Back     alignment and domain information
>gnl|CDD|181012 PRK07515, PRK07515, 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>gnl|CDD|73194 cd00327, cond_enzymes, Condensing enzymes; Family of enzymes that catalyze a (decarboxylating or non-decarboxylating) Claisen-like condensation reaction Back     alignment and domain information
>gnl|CDD|73238 cd00825, decarbox_cond_enzymes, decarboxylating condensing enzymes; Family of enzymes that catalyze the formation of a new carbon-carbon bond by a decarboxylating Claisen-like condensation reaction Back     alignment and domain information
>gnl|CDD|29416 cd00829, SCP-x_thiolase, Thiolase domain associated with sterol carrier protein (SCP)-x isoform and related proteins; SCP-2 has multiple roles in intracellular lipid circulation and metabolism Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 325 3-oxoacyl-(acyl carrier protein) synthase II [Candidatu
TIGR00747329 fabH 3-oxoacyl-(acyl-carrier-protein) synthase III; Int 100.0
COG0332323 FabH 3-oxoacyl-[acyl-carrier-protein] 100.0
PRK05963327 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed 100.0
PRK09352319 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed 100.0
PRK07204329 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed 100.0
PRK07515372 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed 100.0
PRK12879326 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed 100.0
CHL00203327 fabH 3-oxoacyl-acyl-carrier-protein synthase 3; Provisi 100.0
cd00830320 KAS_III Ketoacyl-acyl carrier protein synthase III (KAS 100.0
PRK12880353 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed 100.0
PRK06816378 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed 100.0
PRK06840337 hypothetical protein; Validated 100.0
PRK09258339 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed 100.0
PRK04262346 hypothetical protein; Provisional 100.0
cd00827324 init_cond_enzymes "initiating" condensing enzymes are a 100.0
cd00831361 CHS_like Chalcone and stilbene synthases; plant-specifi 100.0
COG3425377 PksG 3-hydroxy-3-methylglutaryl CoA synthase [Lipid met 100.0
COG3424356 BcsA Predicted naringenin-chalcone synthase [Secondary 100.0
TIGR00748347 HMG_CoA_syn_Arc hydroxymethylglutaryl-CoA synthase, put 99.98
TIGR01835412 HMG-CoA-S_prok hydroxymethylglutaryl-CoA synthase; Inte 99.96
TIGR01833461 HMG-CoA-S_euk hydroxymethylglutaryl-CoA synthase; Inter 99.89
KOG1393462 consensus 99.86
PRK06333424 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed 99.6
cd00834406 KAS_I_II Beta-ketoacyl-acyl carrier protein (ACP) synth 99.6
TIGR02845331 spore_V_AD stage V sporulation protein AD; InterPro: IP 99.58
PRK07314411 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed 99.57
PRK08768411 consensus 99.53
PTZ00050477 3-oxoacyl-acyl carrier protein synthase; Provisional 99.49
TIGR03150407 fabF 3-oxoacyl-[acyl-carrier-protein] synthase 2. FabB 99.49
PRK05952379 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed 99.48
PRK07103415 polyketide beta-ketoacyl:acyl carrier protein synthase; 99.47
PRK06501425 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed 99.47
PRK07855386 lipid-transfer protein; Provisional 99.43
cd00832399 CLF Chain-length factor (CLF) is a factor required for 99.38
PRK08439405 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed 99.25
pfam07451329 SpoVAD Stage V sporulation protein AD (SpoVAD). This fa 99.19
PRK12404334 stage V sporulation protein AD; Provisional 99.17
PRK08304336 stage V sporulation protein AD; Validated 99.16
PRK06519397 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed 99.02
cd00327254 cond_enzymes Condensing enzymes; Family of enzymes that 100.0
cd00825332 decarbox_cond_enzymes decarboxylating condensing enzyme 99.69
PRK06059399 lipid-transfer protein; Provisional 99.62
PRK06157400 acetyl-CoA acetyltransferase; Validated 99.57
PRK06065393 acetyl-CoA acetyltransferase; Provisional 99.54
smart00825424 PKS_KS Beta-ketoacyl synthase. The structure of beta-ke 99.41
cd00828407 elong_cond_enzymes "elongating" condensing enzymes are 99.4
PRK08142388 acetyl-CoA acetyltransferase; Provisional 99.38
cd00833421 PKS polyketide synthases (PKSs) polymerize simple fatty 99.3
PRK06147346 3-oxoacyl-(acyl carrier protein) synthase; Validated 99.27
PRK07937352 lipid-transfer protein; Provisional 99.25
PRK06066375 acetyl-CoA acetyltransferase; Provisional 99.16
COG3321 1061 Polyketide synthase modules and related proteins [Secon 99.09
KOG1390396 consensus 98.73
KOG1389435 consensus 98.63
pfam00195228 Chal_sti_synt_N Chalcone and stilbene synthases, N-term 99.95
pfam01154171 HMG_CoA_synt_N Hydroxymethylglutaryl-coenzyme A synthas 99.86
pfam08392290 FAE1_CUT1_RppA FAE1/Type III polyketide synthase-like p 99.77
pfam00109243 ketoacyl-synt Beta-ketoacyl synthase, N-terminal domain 98.69
pfam0854190 ACP_syn_III_C 3-Oxoacyl-[acyl-carrier-protein (ACP)] sy 99.88
pfam08540282 HMG_CoA_synt_C Hydroxymethylglutaryl-coenzyme A synthas 98.02
pfam00195228 Chal_sti_synt_N Chalcone and stilbene synthases, N-term 96.66
PRK06504390 acetyl-CoA acetyltransferase; Provisional 96.46
PRK13359400 beta-ketoadipyl CoA thiolase; Provisional 96.1
PRK06954397 acetyl-CoA acetyltransferase; Provisional 96.05
PRK06445394 acetyl-CoA acetyltransferase; Provisional 96.05
PRK07491392 consensus 96.04
PRK08041391 consensus 96.02
PRK05790393 acetyl-CoA acetyltransferase; Provisional 95.97
PRK07800393 consensus 95.96
PRK07025393 consensus 95.86
PRK08234400 consensus 95.76
PRK06366388 acetyl-CoA acetyltransferase; Provisional 95.73
pfam08392 290 FAE1_CUT1_RppA FAE1/Type III polyketide synthase-like p 95.7
PRK08242402 acetyl-CoA acetyltransferase; Validated 95.63
pfam02803123 Thiolase_C Thiolase, C-terminal domain. Thiolase is rep 95.61
PRK06205404 acetyl-CoA acetyltransferase; Provisional 95.61
PRK05656392 acetyl-CoA acetyltransferase; Provisional 95.55
PRK08131401 acetyl-CoA acetyltransferase; Provisional 95.52
PRK09051394 beta-ketothiolase; Provisional 95.49
PRK09050401 beta-ketoadipyl CoA thiolase; Validated 95.46
PRK08947387 fadA 3-ketoacyl-CoA thiolase; Reviewed 95.22
PRK07801382 acetyl-CoA acetyltransferase; Provisional 95.21
PRK06633392 acetyl-CoA acetyltransferase; Provisional 95.15
PRK06816378 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed 95.07
PRK07108392 acetyl-CoA acetyltransferase; Provisional 94.87
PRK08235393 acetyl-CoA acetyltransferase; Provisional 94.82
PRK06689391 consensus 94.64
PRK06025417 acetyl-CoA acetyltransferase; Provisional 94.6
PRK07661384 acetyl-CoA acetyltransferase; Provisional 94.59
PRK09052399 acetyl-CoA acetyltransferase; Provisional 94.42
TIGR02845 331 spore_V_AD stage V sporulation protein AD; InterPro: IP 94.37
PRK07850387 acetyl-CoA acetyltransferase; Provisional 94.23
PRK08963436 fadI 3-ketoacyl-CoA thiolase; Reviewed 93.87
pfam02801117 Ketoacyl-synt_C Beta-ketoacyl synthase, C-terminal doma 93.86
PRK08170426 acetyl-CoA acetyltransferase; Provisional 93.7
PRK06690361 acetyl-CoA acetyltransferase; Provisional 93.54
cd00751386 thiolase Thiolase are ubiquitous enzymes that catalyze 92.73
PRK09268428 acetyl-CoA acetyltransferase; Provisional 92.33
PRK08257 502 acetyl-CoA acetyltransferase; Validated 91.67
PRK07516389 acetyl-CoA acetyltransferase; Provisional 90.42
PRK07910418 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed 90.01
cd00829375 SCP-x_thiolase Thiolase domain associated with sterol c 99.73
PRK06064389 acetyl-CoA acetyltransferase; Provisional 99.63
PRK08256391 lipid-transfer protein; Provisional 99.62
PRK06364389 consensus 99.59
PRK06363387 consensus 99.55
PRK06158384 thiolase; Provisional 99.53
PRK06365415 acetyl-CoA acetyltransferase; Provisional 99.52
PRK08371388 consensus 99.47
PRK09116336 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed 99.34
COG0304412 FabB 3-oxoacyl-(acyl-carrier-protein) synthase [Lipid m 98.89
KOG1202 2376 consensus 98.15
TIGR02813 2773 omega_3_PfaA polyketide-type polyunsaturated fatty acid 96.05
pfam02797151 Chal_sti_synt_C Chalcone and stilbene synthases, C-term 99.68
pfam0854580 ACP_syn_III 3-Oxoacyl-[acyl-carrier-protein (ACP)] synt 99.65
PRK12578385 acetyl-CoA acetyltransferase; Provisional 99.64
cd00751386 thiolase Thiolase are ubiquitous enzymes that catalyze 99.63
PRK08235393 acetyl-CoA acetyltransferase; Provisional 99.61
PRK07800393 consensus 99.58
PRK07516389 acetyl-CoA acetyltransferase; Provisional 99.58
PRK06289 408 acetyl-CoA acetyltransferase; Provisional 99.57
PRK05790393 acetyl-CoA acetyltransferase; Provisional 99.55
PRK06845392 consensus 99.55
cd00826393 nondecarbox_cond_enzymes nondecarboxylating condensing 99.54
PRK07801382 acetyl-CoA acetyltransferase; Provisional 99.51
PRK07025393 consensus 99.5
PRK06366388 acetyl-CoA acetyltransferase; Provisional 99.5
PRK06689391 consensus 99.5
PRK06954397 acetyl-CoA acetyltransferase; Provisional 99.49
PRK07491392 consensus 99.48
PRK05656392 acetyl-CoA acetyltransferase; Provisional 99.48
PRK06025 417 acetyl-CoA acetyltransferase; Provisional 99.48
PRK08041391 consensus 99.47
PRK08242402 acetyl-CoA acetyltransferase; Validated 99.47
PRK07124 402 consensus 99.45
PRK07851 405 acetyl-CoA acetyltransferase; Provisional 99.44
PRK09051394 beta-ketothiolase; Provisional 99.43
PRK06504390 acetyl-CoA acetyltransferase; Provisional 99.42
PRK06445394 acetyl-CoA acetyltransferase; Provisional 99.42
PRK07108392 acetyl-CoA acetyltransferase; Provisional 99.41
PRK06205 404 acetyl-CoA acetyltransferase; Provisional 99.41
PRK08131 401 acetyl-CoA acetyltransferase; Provisional 99.41
PRK07850387 acetyl-CoA acetyltransferase; Provisional 99.4
PRK09052399 acetyl-CoA acetyltransferase; Provisional 99.4
PRK08963 436 fadI 3-ketoacyl-CoA thiolase; Reviewed 99.38
PRK08234400 consensus 99.38
PRK06633392 acetyl-CoA acetyltransferase; Provisional 99.35
PRK08947387 fadA 3-ketoacyl-CoA thiolase; Reviewed 99.34
PRK08170 426 acetyl-CoA acetyltransferase; Provisional 99.33
PRK09268 428 acetyl-CoA acetyltransferase; Provisional 99.32
PRK07661384 acetyl-CoA acetyltransferase; Provisional 99.27
PRK13359400 beta-ketoadipyl CoA thiolase; Provisional 99.25
PRK09050401 beta-ketoadipyl CoA thiolase; Validated 99.23
PRK06690361 acetyl-CoA acetyltransferase; Provisional 99.17
TIGR01930 447 AcCoA-C-Actrans acetyl-CoA acetyltransferases; InterPro 98.94
pfam00108264 Thiolase_N Thiolase, N-terminal domain. Thiolase is rep 98.89
PRK08257 502 acetyl-CoA acetyltransferase; Validated 98.77
KOG1391396 consensus 98.67
KOG1406 408 consensus 98.54
COG0183392 PaaJ Acetyl-CoA acetyltransferase [Lipid metabolism] 98.11
KOG1392 465 consensus 97.42
pfam02803123 Thiolase_C Thiolase, C-terminal domain. Thiolase is rep 95.49
PRK08722414 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed 99.57
PRK08313391 acetyl-CoA acetyltransferase; Provisional 99.56
PRK07910418 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed 99.41
PRK09185395 3-oxoacyl-(acyl carrier protein) synthase I; Reviewed 99.37
PRK07967406 3-oxoacyl-(acyl carrier protein) synthase I; Reviewed 99.35
KOG1394440 consensus 98.56
PRK06845392 consensus 96.38
cd00826393 nondecarbox_cond_enzymes nondecarboxylating condensing 92.69
TIGR01930447 AcCoA-C-Actrans acetyl-CoA acetyltransferases; InterPro 96.31
PRK07851405 acetyl-CoA acetyltransferase; Provisional 95.44
cd00831361 CHS_like Chalcone and stilbene synthases; plant-specifi 96.09
cd00327254 cond_enzymes Condensing enzymes; Family of enzymes that 93.86
PRK07855386 lipid-transfer protein; Provisional 93.45
PRK12879326 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed 95.1
PRK09352319 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed 94.56
PRK06840337 hypothetical protein; Validated 94.33
PRK09258339 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed 93.99
PRK07204329 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed 93.17
cd00830320 KAS_III Ketoacyl-acyl carrier protein synthase III (KAS 94.48
CHL00203327 fabH 3-oxoacyl-acyl-carrier-protein synthase 3; Provisi 94.48
PRK05963327 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed 93.6
cd00829375 SCP-x_thiolase Thiolase domain associated with sterol c 92.86
PRK04262346 hypothetical protein; Provisional 91.23
PRK06158384 thiolase; Provisional 93.0
PRK08371388 consensus 92.43
PRK08256391 lipid-transfer protein; Provisional 92.35
PRK08142388 acetyl-CoA acetyltransferase; Provisional 91.26
PRK06065393 acetyl-CoA acetyltransferase; Provisional 90.06
COG3424356 BcsA Predicted naringenin-chalcone synthase [Secondary 92.62
>TIGR00747 fabH 3-oxoacyl-(acyl-carrier-protein) synthase III; InterPro: IPR004655 Beta-ketoacyl-acyl carrier protein synthase III (FabH), in general, initiates elongation in type II fatty acid synthase systems found in bacteria and plants Back     alignment and domain information
>COG0332 FabH 3-oxoacyl-[acyl-carrier-protein] Back     alignment and domain information
>PRK05963 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>PRK09352 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>PRK07204 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>PRK07515 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>PRK12879 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>CHL00203 fabH 3-oxoacyl-acyl-carrier-protein synthase 3; Provisional Back     alignment and domain information
>cd00830 KAS_III Ketoacyl-acyl carrier protein synthase III (KASIII) initiates the elongation in type II fatty acid synthase systems Back     alignment and domain information
>PRK12880 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>PRK06816 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>PRK06840 hypothetical protein; Validated Back     alignment and domain information
>PRK09258 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>PRK04262 hypothetical protein; Provisional Back     alignment and domain information
>cd00827 init_cond_enzymes "initiating" condensing enzymes are a subclass of decarboxylating condensing enzymes, including beta-ketoacyl [ACP] synthase, type III and polyketide synthases, type III, which include chalcone synthase and related enzymes Back     alignment and domain information
>cd00831 CHS_like Chalcone and stilbene synthases; plant-specific polyketide synthases (PKS) and related enzymes, also called type III PKSs Back     alignment and domain information
>COG3425 PksG 3-hydroxy-3-methylglutaryl CoA synthase [Lipid metabolism] Back     alignment and domain information
>COG3424 BcsA Predicted naringenin-chalcone synthase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR00748 HMG_CoA_syn_Arc hydroxymethylglutaryl-CoA synthase, putative; InterPro: IPR004656 This family of archaeal proteins shows considerable homology and identical active site residues to FabH, the beta-ketoacyl-acyl carrier protein synthase III of bacteria and plants Back     alignment and domain information
>TIGR01835 HMG-CoA-S_prok hydroxymethylglutaryl-CoA synthase; InterPro: IPR011554 Synonym(s): 3-hydroxy-3-methylglutaryl-coenzyme A synthase, HMG-CoA synthase Back     alignment and domain information
>TIGR01833 HMG-CoA-S_euk hydroxymethylglutaryl-CoA synthase; InterPro: IPR010122 Synonym(s): 3-hydroxy-3-methylglutaryl-coenzyme A synthase, HMG-CoA synthase Back     alignment and domain information
>KOG1393 consensus Back     alignment and domain information
>PRK06333 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>cd00834 KAS_I_II Beta-ketoacyl-acyl carrier protein (ACP) synthase (KAS), type I and II Back     alignment and domain information
>TIGR02845 spore_V_AD stage V sporulation protein AD; InterPro: IPR010894 This family contains the bacterial stage V sporulation protein AD (SpoVAD), which is approximately 340 residues long Back     alignment and domain information
>PRK07314 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>PRK08768 consensus Back     alignment and domain information
>PTZ00050 3-oxoacyl-acyl carrier protein synthase; Provisional Back     alignment and domain information
>TIGR03150 fabF 3-oxoacyl-[acyl-carrier-protein] synthase 2 Back     alignment and domain information
>PRK05952 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>PRK07103 polyketide beta-ketoacyl:acyl carrier protein synthase; Validated Back     alignment and domain information
>PRK06501 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>PRK07855 lipid-transfer protein; Provisional Back     alignment and domain information
>cd00832 CLF Chain-length factor (CLF) is a factor required for polyketide chain initiation of aromatic antibiotic-producing polyketide synthases (PKSs) of filamentous bacteria Back     alignment and domain information
>PRK08439 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>pfam07451 SpoVAD Stage V sporulation protein AD (SpoVAD) Back     alignment and domain information
>PRK12404 stage V sporulation protein AD; Provisional Back     alignment and domain information
>PRK08304 stage V sporulation protein AD; Validated Back     alignment and domain information
>PRK06519 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>cd00327 cond_enzymes Condensing enzymes; Family of enzymes that catalyze a (decarboxylating or non-decarboxylating) Claisen-like condensation reaction Back     alignment and domain information
>cd00825 decarbox_cond_enzymes decarboxylating condensing enzymes; Family of enzymes that catalyze the formation of a new carbon-carbon bond by a decarboxylating Claisen-like condensation reaction Back     alignment and domain information
>PRK06059 lipid-transfer protein; Provisional Back     alignment and domain information
>PRK06157 acetyl-CoA acetyltransferase; Validated Back     alignment and domain information
>PRK06065 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>smart00825 PKS_KS Beta-ketoacyl synthase Back     alignment and domain information
>cd00828 elong_cond_enzymes "elongating" condensing enzymes are a subclass of decarboxylating condensing enzymes, including beta-ketoacyl [ACP] synthase, type I and II and polyketide synthases Back     alignment and domain information
>PRK08142 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>cd00833 PKS polyketide synthases (PKSs) polymerize simple fatty acids into a large variety of different products, called polyketides, by successive decarboxylating Claisen condensations Back     alignment and domain information
>PRK06147 3-oxoacyl-(acyl carrier protein) synthase; Validated Back     alignment and domain information
>PRK07937 lipid-transfer protein; Provisional Back     alignment and domain information
>PRK06066 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>COG3321 Polyketide synthase modules and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>KOG1390 consensus Back     alignment and domain information
>KOG1389 consensus Back     alignment and domain information
>pfam00195 Chal_sti_synt_N Chalcone and stilbene synthases, N-terminal domain Back     alignment and domain information
>pfam01154 HMG_CoA_synt_N Hydroxymethylglutaryl-coenzyme A synthase N terminal Back     alignment and domain information
>pfam08392 FAE1_CUT1_RppA FAE1/Type III polyketide synthase-like protein Back     alignment and domain information
>pfam00109 ketoacyl-synt Beta-ketoacyl synthase, N-terminal domain Back     alignment and domain information
>pfam08541 ACP_syn_III_C 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C terminal Back     alignment and domain information
>pfam08540 HMG_CoA_synt_C Hydroxymethylglutaryl-coenzyme A synthase C terminal Back     alignment and domain information
>pfam00195 Chal_sti_synt_N Chalcone and stilbene synthases, N-terminal domain Back     alignment and domain information
>PRK06504 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK13359 beta-ketoadipyl CoA thiolase; Provisional Back     alignment and domain information
>PRK06954 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06445 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK07491 consensus Back     alignment and domain information
>PRK08041 consensus Back     alignment and domain information
>PRK05790 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK07800 consensus Back     alignment and domain information
>PRK07025 consensus Back     alignment and domain information
>PRK08234 consensus Back     alignment and domain information
>PRK06366 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>pfam08392 FAE1_CUT1_RppA FAE1/Type III polyketide synthase-like protein Back     alignment and domain information
>PRK08242 acetyl-CoA acetyltransferase; Validated Back     alignment and domain information
>pfam02803 Thiolase_C Thiolase, C-terminal domain Back     alignment and domain information
>PRK06205 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK05656 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK08131 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK09051 beta-ketothiolase; Provisional Back     alignment and domain information
>PRK09050 beta-ketoadipyl CoA thiolase; Validated Back     alignment and domain information
>PRK08947 fadA 3-ketoacyl-CoA thiolase; Reviewed Back     alignment and domain information
>PRK07801 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06633 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06816 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>PRK07108 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK08235 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06689 consensus Back     alignment and domain information
>PRK06025 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK07661 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK09052 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>TIGR02845 spore_V_AD stage V sporulation protein AD; InterPro: IPR010894 This family contains the bacterial stage V sporulation protein AD (SpoVAD), which is approximately 340 residues long Back     alignment and domain information
>PRK07850 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK08963 fadI 3-ketoacyl-CoA thiolase; Reviewed Back     alignment and domain information
>pfam02801 Ketoacyl-synt_C Beta-ketoacyl synthase, C-terminal domain Back     alignment and domain information
>PRK08170 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06690 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>cd00751 thiolase Thiolase are ubiquitous enzymes that catalyze the reversible thiolytic cleavage of 3-ketoacyl-CoA into acyl-CoA and acetyl-CoA, a 2-step reaction involving a covalent intermediate formed with a catalytic cysteine Back     alignment and domain information
>PRK09268 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK08257 acetyl-CoA acetyltransferase; Validated Back     alignment and domain information
>PRK07516 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK07910 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>cd00829 SCP-x_thiolase Thiolase domain associated with sterol carrier protein (SCP)-x isoform and related proteins; SCP-2 has multiple roles in intracellular lipid circulation and metabolism Back     alignment and domain information
>PRK06064 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK08256 lipid-transfer protein; Provisional Back     alignment and domain information
>PRK06364 consensus Back     alignment and domain information
>PRK06363 consensus Back     alignment and domain information
>PRK06158 thiolase; Provisional Back     alignment and domain information
>PRK06365 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK08371 consensus Back     alignment and domain information
>PRK09116 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>COG0304 FabB 3-oxoacyl-(acyl-carrier-protein) synthase [Lipid metabolism / Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>KOG1202 consensus Back     alignment and domain information
>TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA; InterPro: IPR004432 Members of this entry represent PfaA, which is involved in omega-3 polyunsaturated fatty acid biosynthesis, for example PfaA from the eicosapentaenoic acid biosynthesis operon in Photobacterium profundum strain SS9 Back     alignment and domain information
>pfam02797 Chal_sti_synt_C Chalcone and stilbene synthases, C-terminal domain Back     alignment and domain information
>pfam08545 ACP_syn_III 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III Back     alignment and domain information
>PRK12578 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>cd00751 thiolase Thiolase are ubiquitous enzymes that catalyze the reversible thiolytic cleavage of 3-ketoacyl-CoA into acyl-CoA and acetyl-CoA, a 2-step reaction involving a covalent intermediate formed with a catalytic cysteine Back     alignment and domain information
>PRK08235 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK07800 consensus Back     alignment and domain information
>PRK07516 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06289 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK05790 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06845 consensus Back     alignment and domain information
>cd00826 nondecarbox_cond_enzymes nondecarboxylating condensing enzymes; In general, thiolases catalyze the reversible thiolytic cleavage of 3-ketoacyl-CoA into acyl-CoA and acetyl-CoA, a 2-step reaction involving a covalent intermediate formed with a catalytic cysteine Back     alignment and domain information
>PRK07801 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK07025 consensus Back     alignment and domain information
>PRK06366 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06689 consensus Back     alignment and domain information
>PRK06954 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK07491 consensus Back     alignment and domain information
>PRK05656 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06025 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK08041 consensus Back     alignment and domain information
>PRK08242 acetyl-CoA acetyltransferase; Validated Back     alignment and domain information
>PRK07124 consensus Back     alignment and domain information
>PRK07851 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK09051 beta-ketothiolase; Provisional Back     alignment and domain information
>PRK06504 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06445 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK07108 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06205 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK08131 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK07850 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK09052 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK08963 fadI 3-ketoacyl-CoA thiolase; Reviewed Back     alignment and domain information
>PRK08234 consensus Back     alignment and domain information
>PRK06633 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK08947 fadA 3-ketoacyl-CoA thiolase; Reviewed Back     alignment and domain information
>PRK08170 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK09268 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK07661 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK13359 beta-ketoadipyl CoA thiolase; Provisional Back     alignment and domain information
>PRK09050 beta-ketoadipyl CoA thiolase; Validated Back     alignment and domain information
>PRK06690 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>TIGR01930 AcCoA-C-Actrans acetyl-CoA acetyltransferases; InterPro: IPR002155 Two different types of thiolase , , are found both in eukaryotes and in prokaryotes: acetoacetyl-CoA thiolase (2 Back     alignment and domain information
>pfam00108 Thiolase_N Thiolase, N-terminal domain Back     alignment and domain information
>PRK08257 acetyl-CoA acetyltransferase; Validated Back     alignment and domain information
>KOG1391 consensus Back     alignment and domain information
>KOG1406 consensus Back     alignment and domain information
>COG0183 PaaJ Acetyl-CoA acetyltransferase [Lipid metabolism] Back     alignment and domain information
>KOG1392 consensus Back     alignment and domain information
>pfam02803 Thiolase_C Thiolase, C-terminal domain Back     alignment and domain information
>PRK08722 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>PRK08313 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK07910 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>PRK09185 3-oxoacyl-(acyl carrier protein) synthase I; Reviewed Back     alignment and domain information
>PRK07967 3-oxoacyl-(acyl carrier protein) synthase I; Reviewed Back     alignment and domain information
>KOG1394 consensus Back     alignment and domain information
>PRK06845 consensus Back     alignment and domain information
>cd00826 nondecarbox_cond_enzymes nondecarboxylating condensing enzymes; In general, thiolases catalyze the reversible thiolytic cleavage of 3-ketoacyl-CoA into acyl-CoA and acetyl-CoA, a 2-step reaction involving a covalent intermediate formed with a catalytic cysteine Back     alignment and domain information
>TIGR01930 AcCoA-C-Actrans acetyl-CoA acetyltransferases; InterPro: IPR002155 Two different types of thiolase , , are found both in eukaryotes and in prokaryotes: acetoacetyl-CoA thiolase (2 Back     alignment and domain information
>PRK07851 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>cd00831 CHS_like Chalcone and stilbene synthases; plant-specific polyketide synthases (PKS) and related enzymes, also called type III PKSs Back     alignment and domain information
>cd00327 cond_enzymes Condensing enzymes; Family of enzymes that catalyze a (decarboxylating or non-decarboxylating) Claisen-like condensation reaction Back     alignment and domain information
>PRK07855 lipid-transfer protein; Provisional Back     alignment and domain information