254780492

254780492

hypothetical protein CLIBASIA_01895

GeneID in NCBI database:8209483Locus tag:CLIBASIA_01895
Protein GI in NCBI database:254780492Protein Accession:YP_003064905.1
Gene range:-(416120, 416242)Protein Length:40aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:not defined as a protein in SEED
Pathway involved in KEGG:not defined
Subsystem involved in KEGG:not defined
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40
MTIDNESNQARKGIWWMPWHAQAMKDVICCDKLWGAANKH
cccccccHHHHccEEEcccHHHHHHHHHHHHHHHcccccc
ccccccHHHHHccccccHHHHHHHHHHEEHHHHHHHHccc
mtidnesnqarkgiwwmpwhAQAMKDVICCdklwgaankh
mtidnesnqarkgIWWMPWHAQAMKDVICCDKLWGAANKH
MTIDNESNQARKGIWWMPWHAQAMKDVICCDKLWGAANKH
*************IWWMPWHAQAMKDVICCDK*WG*****
*********ARKGIWWMPWHAQAMKDVICCDKLWGAANKH
*****ESNQARKGIWWMPWHAQAMKDVICCDKLWGAAN**
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooo
iiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooo
iiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
oooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTIDNESNQARKGIWWMPWHAQAMKDVICCDKLWGAANKH
MTIDNESNQARKGIWWMPWHAQAMKDVICCDKLWGAANKH
MTIDNESNQARKGIWWMPWHAQAMKDVICCDKLWGAANKH

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target40 hypothetical protein CLIBASIA_01895 [Candidatus Liberib
25478088040 hypothetical protein CLIBASIA_03885 [Candidatus Li 1e-19
25478083040 hypothetical protein CLIBASIA_03615 [Candidatus Li 1e-19
>gi|254780880|ref|YP_003065293.1| hypothetical protein CLIBASIA_03885 [Candidatus Liberibacter asiaticus str. psy62] Length = 40 Back     alignment
 Score = 85.9 bits (211), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 40/40 (100%), Positives = 40/40 (100%)

Query: 1  MTIDNESNQARKGIWWMPWHAQAMKDVICCDKLWGAANKH 40
          MTIDNESNQARKGIWWMPWHAQAMKDVICCDKLWGAANKH
Sbjct: 1  MTIDNESNQARKGIWWMPWHAQAMKDVICCDKLWGAANKH 40

>gi|254780830|ref|YP_003065243.1| hypothetical protein CLIBASIA_03615 [Candidatus Liberibacter asiaticus str. psy62] Length = 40 Back     alignment
 Score = 85.9 bits (211), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 40/40 (100%), Positives = 40/40 (100%)

Query: 1  MTIDNESNQARKGIWWMPWHAQAMKDVICCDKLWGAANKH 40
          MTIDNESNQARKGIWWMPWHAQAMKDVICCDKLWGAANKH
Sbjct: 1  MTIDNESNQARKGIWWMPWHAQAMKDVICCDKLWGAANKH 40

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target40 hypothetical protein CLIBASIA_01895 [Candidatus Liberib
29718245160 hypothetical protein [uncultured Rhodospirillales bacte 1 1e-04
21062397049 hypothetical protein CLOHIR_02088 [Clostridium hiranoni 1 0.002
29718472783 hypothetical protein [uncultured alpha proteobacterium 2 0.004
>gi|297182451|gb|ADI18614.1| hypothetical protein [uncultured Rhodospirillales bacterium HF4000_24M03] Length = 60 Back     alignment and organism information
 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/30 (70%), Positives = 25/30 (83%)

Query: 11 RKGIWWMPWHAQAMKDVICCDKLWGAANKH 40
          +KGIWWMPW  +AMKDVI C+K  GAAN+H
Sbjct: 31 KKGIWWMPWRQEAMKDVIGCEKPRGAANRH 60


Species: uncultured Rhodospirillales bacterium
Genus: 
Family: 
Order: Rhodospirillales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|210623970|ref|ZP_03294136.1| hypothetical protein CLOHIR_02088 [Clostridium hiranonis DSM 13275] Length = 49 Back     alignment and organism information
>gi|297184727|gb|ADI20838.1| hypothetical protein [uncultured alpha proteobacterium EF100_102A06] Length = 83 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

No hit with probability above 90.00


Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00