254780829

254780829

ATP-dependent protease ATP-binding subunit

GeneID in NCBI database:8209835Locus tag:CLIBASIA_03610
Protein GI in NCBI database:254780829Protein Accession:YP_003065242.1
Gene range:-(418594, 419907)Protein Length:437aa
Gene description:ATP-dependent protease ATP-binding subunit
COG prediction:[O] ATP-dependent protease HslVU (ClpYQ), ATPase subunit
KEGG prediction:hslU; ATP-dependent protease ATP-binding subunit; K03667 ATP-dependent HslUV protease ATP-binding subunit HslU
SEED prediction:ATP-dependent hsl protease ATP-binding subunit HslU
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Proteasome bacterial;
Proteolysis in bacteria, ATP-dependent
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------
MKLTFNFSPREIVSELDRYIIGQQDAKRAVAIALRNRWRRQQLPADLRDELMPKNILLVGPTGVGKTAISRRLARLAGAPFIKVEVTKFTEIGYVGRNVEQIIRDLVDVAINIVRESRRDEVREQASINAEERILDALVGKTATSNTREVFRKKLRDGEISDKEIDIEVADTSSDISNFDIPGGASVGILNLSELFSKVMGSGRKKKIRMSVQKCYPELMRDESDRLIDMDTVHRDSIQMVENYGIVFLDEFDKIVARDSGNGIGVSREGVQRDLLPLVEGSSVSTKYGSINTDHILFIASGAFHVSRPADLLPEIQGRFPVRVHLKSLNKSDFRLILTDTESNLILQYKELMKTEGIILDFTEDSIDALADVAVNLNSTVGDIGARRLQTVMERVLEDISFSASDLQEKTVVIDAEYVRLHIGDFPSETDMYHFIL
ccccccccHHHHHHHHcHHcccHHHHHHHHHHHHHHHHHHHHHccccccccccccEEEEccccccHHHHHHHHHHHHcccEEEEEcHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHcccccccccccccccccccccccccccccccccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHccccccccccHHHHHHHHHHHHccccccccccccccccEEEEEcccHHHHcHHHHHHHHHHcccEEEEcccccHHHHHHHHHcHHHHHHHHHHHHHHccccEEEEcHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHcccccccEEEEcHHHHHHHHHHHHHccHHHHHcc
ccccccccHHHHHHHHcccccccHHHHHHHHHHHHHHHHHccccHHHHHHcccccEEEEccccccHHHHHHHHHHHHcccEEEEEHHHHcccccccccccHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccccccEEEEEEccccccccccccccHHHHHHHHHHHHHHHHcccccccccEcEHHHHHHHHHHHHHHHcccHHHHHHHcHHHHHHHcEEEEEcHHHHcccccccccHHHHHHHHHHHHHHHHccEEEEccEEEEccccEEEEEEccccccHHHccHHHHHHccEEEEcccccHHHHHHHHHcccccHHHHHHHHHHHcccEEEEcHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHccccEEEEcHHHHHHHcccccccccHHHHcc
mkltfnfspreiVSELDRYIIGQQDAKRAVAIALRNRWRRqqlpadlrdelmpknillvgptgvgkTAISRRLARlagapfikveVTKFTEIGYVGRNVEQIIRDLVDVAINIVRESRRDEVREQASINAEERILDALVGKTATSNTREVFRKKLrdgeisdkeidievadtssdisnfdipggasvGILNLSELFSKVMGSGRKKKIRMSVQKCYPelmrdesdrlidmdtvhRDSIQMVENYGIVFLDEFDKIvardsgngigvsregvqrdllplvegssvstkygsintdhILFIAsgafhvsrpadllpeiqgrfpvrvhlkslnksdFRLILTDTESNLILQYKELMKTEGIILDFTEDSIDALADVAVNLNSTVGDIGARRLQTVMERVLEDISfsasdlqektvVIDAEYVrlhigdfpsetdmyhfil
mkltfnfspreiVSELDRYIIGQQDAKRAVAIALRNRWRRQqlpadlrdelmpkniLLVGPTGVGKTAISRRLArlagapfikvevtkfteigyvgrnveqIIRDLVDVAINIvresrrdevreqasinaeerildalvgktatsntrevfrkklrdgeisdkeiDIEVadtssdisnfdIPGGASVGILNLSELFSKVmgsgrkkkirmsvQKCYPELMRDESDRLIDMDTVHRDSIQMVENYGIVFLDEFDKIVARDSGNgigvsregvqrdllplvegssvstkygSINTDHILFIASGAFHVSRPADLLPEIQGRFPVRVHLkslnksdfrliLTDTESNLILQYKELMKTEGIILDFTEDSIDALADVAVNLNSTVGDIGARRLQTVMERVLEDIsfsasdlqektVVIDAEYVRLHigdfpsetdmyhfil
MKLTFNFSPREIVSELDRYIIGQQDAKRAVAIALRNRWRRQQLPADLRDELMPKNILLVGPTGVGKTAISRRLARLAGAPFIKVEVTKFTEIGYVGRNVEQIIRDLVDVAINIVRESRRDEVREQASINAEERILDALVGKTATSNTREVFRKKLRDGEISDKEIDIEVADTSSDISNFDIPGGASVGILNLSELFSKVMGSGRKKKIRMSVQKCYPELMRDESDRLIDMDTVHRDSIQMVENYGIVFLDEFDKIVARDSGNGIGVSREGVQRDLLPLVEGSSVSTKYGSINTDHILFIASGAFHVSRPADLLPEIQGRFPVRVHLKSLNKSDFRLILTDTESNLILQYKELMKTEGIILDFTEDSIDALADVAVNLNSTVGDIGARRLQTVMERVLEDISFSASDLQEKTVVIDAEYVRLHIGDFPSETDMYHFIL
*****NF***EIVSELDRYIIGQQDAKRAVAIALRNRWRRQQLPADLRDELMPKNILLVGPTGVGKTAISRRLARLAGAPFIKVEVTKFTEIGYVGRNVEQIIRDLVDVAINIV**************NAEERILDAL****************LRDGEISDKEIDIEV********************************************KCYPELMRDESDRLIDMDTVHRDSIQMVENYGIVFLDEFD******************QRDLLPLVEGSSVSTKYGSINTDHILFIASGAFHVSRPADLLPEIQGRFPVRVHLKSLNKSDFRLILTDTESNLILQYKELMKTEGIILDFTEDSIDALADVAVNLNSTVGDIGARRLQTVMERVLEDISFSASDLQEKTVVIDAEYVRLHIGDFPSETDMYHFIL
MKLTFNFSPREIVSELDRYIIGQQDAKRAVAIALRNRWRRQQLPADLRDELMPKNILLVGPTGVGKTAISRRLARLAGAPFIKVEVTKFTEIGYVGRNVEQIIRDLVDVAINIVRESRRDEVREQASINAEERILDALVGKTATSNTREVFRKKLRDGEISDKEIDIEVADTSSDISNFDIPGGASVGILNLSELFSKV**********MSVQKCYPELMRDESDRLIDMDTVHRDSIQMVENYGIVFLDEFDKIVARDSGNGIGVSREGVQRDLLPLVEGSSVSTKYGSINTDHILFIASGAFHVSRPADLLPEIQGRFPVRVHLKSLNKSDFRLILTDTESNLILQYKELMKTEGIILDFTEDSIDALADVAVNLNSTVGDIGARRLQTVMERVLEDISFSASDLQEKTVVIDAEYVRLHIGDFPSETDMYHFIL
*****NFSPREIVSELDRYIIGQQDAKRAVAIALRNRWRRQQLPADLRDELMPKNILLVGPTGVGKTAISRRLARLAGAPFIKVEVTKFTEIGYVGRNVEQIIRDLVDVAINIVRESRRDEVREQASINAEERILDALVGKTATSNTREVFRKKLRDGEISDKEIDIEVADTSSDISNFDIPGGASVGILNLSELFSKVMGSGRKKKIRMSVQKCYPELMRDESDRLIDMDTVHRDSIQMVENYGIVFLDEFDKIVARDSGNGIGVSREGVQRDLLPLVEGSSVSTKYGSINTDHILFIASGAFHVSRPADLLPEIQGRFPVRVHLKSLNKSDFRLILTDTESNLILQYKELMKTEGIILDFTEDSIDALADVAVNLNSTVGDIGARRLQTVMERVLEDISFSASDLQEKTVVIDAEYVRLHIGDFPSETDMYHFIL
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKLTFNFSPREIVSELDRYIIGQQDAKRAVAIALRNRWRRQQLPADLRDELMPKNILLVGPTGVGKTAISRRLARLAGAPFIKVEVTKFTEIGYVGRNVEQIIRDLVDVAINIVRESRRDEVREQASINAEERILDALVGKTATSNTREVFRKKLRDGEISDKEIDIEVADTSSDISNFDIPGGASVGILNLSELFSKVMGSGRKKKIRMSVQKCYPELMRDESDRLIDMDTVHRDSIQMVENYGIVFLDEFDKIVARDSGNGIGVSREGVQRDLLPLVEGSSVSTKYGSINTDHILFIASGAFHVSRPADLLPEIQGRFPVRVHLKSLNKSDFRLILTDTESNLILQYKELMKTEGIILDFTEDSIDALADVAVNLNSTVGDIGARRLQTVMERVLEDISFSASDLQEKTVVIDAEYVRLHIGDFPSETDMYHFIL
MKLTFNFSPREIVSELDRYIIGQQDAKRAVAIALRNRWRRQQLPADLRDELMPKNILLVGPTGVGKTAISRRLARLAGAPFIKVEVTKFTEIGYVGRNVEQIIRDLVDVAINIVRESRRDEVREQASINAEERILDALVGKTATSNTREVFRKKLRDGEISDKEIDIEVADTSSDISNFDIPGGASVGILNLSELFSKVMGSGRKKKIRMSVQKCYPELMRDESDRLIDMDTVHRDSIQMVENYGIVFLDEFDKIVARDSGNGIGVSREGVQRDLLPLVEGSSVSTKYGSINTDHILFIASGAFHVSRPADLLPEIQGRFPVRVHLKSLNKSDFRLILTDTESNLILQYKELMKTEGIILDFTEDSIDALADVAVNLNSTVGDIGARRLQTVMERVLEDISFSASDLQEKTVVIDAEYVRLHIGDFPSETDMYHFIL
MKLTFNFSPREIVSELDRYIIGQQDAKRAVAIALRNRWRRQQLPADLRDELMPKNILLVGPTGVGKTAISRRLARLAGAPFIKVEVTKFTEIGYVGRNVEQIIRDLVDVAINIVRESRRDEVREQASINAEERILDALVGKTATSNTREVFRKKLRDGEISDKEIDIEVADTSSDISNFDIPGGASVGILNLSELFSKVMGSGRKKKIRMSVQKCYPELMRDESDRLIDMDTVHRDSIQMVENYGIVFLDEFDKIVARDSGNGIGVSREGVQRDLLPLVEGSSVSTKYGSINTDHILFIASGAFHVSRPADLLPEIQGRFPVRVHLKSLNKSDFRLILTDTESNLILQYKELMKTEGIILDFTEDSIDALADVAVNLNSTVGDIGARRLQTVMERVLEDISFSASDLQEKTVVIDAEYVRLHIGDFPSETDMYHFIL

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target437 ATP-dependent protease ATP-binding subunit [Candidatus
254780271424 ATP-dependent protease ATP-binding subunit ClpX [C 2e-21
254780271424 ATP-dependent protease ATP-binding subunit ClpX [C 1e-14
254780545647 metalloprotease [Candidatus Liberibacter asiaticus 2e-06
254780877853 ATP-dependent Clp protease, ATP-binding subunit pr 4e-06
254780163798 ATP-dependent Clp protease ATP-binding subunit [Ca 3e-04
254780270820 ATP-dependent protease La [Candidatus Liberibacter 0.038
>gi|254780271|ref|YP_003064684.1| ATP-dependent protease ATP-binding subunit ClpX [Candidatus Liberibacter asiaticus str. psy62] Length = 424 Back     alignment
 Score = 95.1 bits (235), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 70/113 (61%), Gaps = 2/113 (1%)

Query: 8   SPREIVSELDRYIIGQQDAKRAVAIALRNRWRRQQLPADLRD-ELMPKNILLVGPTGVGK 66
           +P+EI+  LD Y+IGQ  AK+ +A+A+ N ++R    +   + EL   NILLVGPTG GK
Sbjct: 67  NPQEILRVLDEYVIGQGQAKKVLAVAVHNHYKRLAHSSKSSNVELAKSNILLVGPTGCGK 126

Query: 67  TAISRRLARLAGAPFIKVEVTKFTEIGYVGRNVEQIIRDLVDVA-INIVRESR 118
           T +++ LAR+   PF   + T  TE GYVG +VE II  L+  A  N+ R  R
Sbjct: 127 TYLAQTLARIIDVPFTMADATTLTEAGYVGEDVENIILKLLQAADYNVERAQR 179

>gi|254780271|ref|YP_003064684.1| ATP-dependent protease ATP-binding subunit ClpX [Candidatus Liberibacter asiaticus str. psy62] Length = 424 Back     alignment
 Score = 72.8 bits (177), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 64/222 (28%), Positives = 101/222 (45%), Gaps = 57/222 (25%)

Query: 245 GIVFLDEFDKIVARDSGNGIG--VSREGVQRDLLPLVEGSSVST-----------KYGSI 291
           GIV++DE DKI  +     I   VS EGVQ+ LL ++EG+  S            ++  +
Sbjct: 180 GIVYIDEVDKISRKSDNPSITRDVSGEGVQQALLKIMEGTIASVPPQGGRKHPQQEFLQV 239

Query: 292 NTDHILFIASGAFHV------------------------SRPAD---------------L 312
           +T +ILFI  GAF                          +RP                 L
Sbjct: 240 DTTNILFICGGAFAGLDRIISARGEKASIGFSAVVKDSDNRPVGEVLRNLESEDLVKFGL 299

Query: 313 LPEIQGRFPVRVHLKSLNKSDFRLILTDTESNLILQYKELMKTEGIILDFTEDSIDALAD 372
           +PE  GR PV   L+ L+++    IL++ ++ LI QY+ L   E + L F ED++  +A 
Sbjct: 300 IPEFIGRLPVLATLEDLDENSLIRILSEPKNALIKQYQCLFDMEDVELVFHEDALREIAR 359

Query: 373 VAVNLNSTVGDIGARRLQTVMERVLEDISFSASDLQEKTVVI 414
            A+   +     GAR L++++E++L D  F    L+  + VI
Sbjct: 360 CAIAHKT-----GARGLRSILEKILLDTMFELPMLKGVSSVI 396

>gi|254780545|ref|YP_003064958.1| metalloprotease [Candidatus Liberibacter asiaticus str. psy62] Length = 647 Back     alignment
 Score = 45.1 bits (105), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 36/61 (59%), Gaps = 2/61 (3%)

Query: 52  MPKNILLVGPTGVGKTAISRRLARLAGAPFIKVEVTKFTEIGYVGRNVEQIIRDLVDVAI 111
           +P  +LLVGP G GKT ++R +A  A  PF  +  + F E+ +VG    + +RD+ + A 
Sbjct: 180 IPHGVLLVGPPGTGKTLLARAVAGEANVPFFTISGSDFVEL-FVGVGASR-VRDMFEQAK 237

Query: 112 N 112
           N
Sbjct: 238 N 238

>gi|254780877|ref|YP_003065290.1| ATP-dependent Clp protease, ATP-binding subunit protein [Candidatus Liberibacter asiaticus str. psy62] Length = 853 Back     alignment
 Score = 44.3 bits (103), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 32/90 (35%), Positives = 52/90 (57%), Gaps = 10/90 (11%)

Query: 12  IVSELDRYIIGQQDAKRAVAIALRNRWRRQQLPADLRDELMP-KNILLVGPTGVGKTAIS 70
           I +E+ + +IGQ  A  +V+ ALR R+R     A L+D   P  + + +GPTGVGKT + 
Sbjct: 562 IETEISKSVIGQSAAVESVSNALR-RFR-----AGLQDPQRPMGSFMFLGPTGVGKTELV 615

Query: 71  RRLARLA---GAPFIKVEVTKFTEIGYVGR 97
           + LARL        I+++++++ E   V R
Sbjct: 616 KSLARLLFDDENSMIRIDMSEYMEKHSVSR 645

>gi|254780163|ref|YP_003064576.1| ATP-dependent Clp protease ATP-binding subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 798 Back     alignment
 Score = 38.1 bits (87), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 32/60 (53%), Gaps = 11/60 (18%)

Query: 60  GPTGVGKTAISRRLARLAGAPFIKVEVTKFTE-----------IGYVGRNVEQIIRDLVD 108
           GPTGVGKT IS++LA   G   ++ +++++ E            GYVG     I+ D VD
Sbjct: 514 GPTGVGKTEISKQLAFALGVQLLRFDMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVD 573

>gi|254780270|ref|YP_003064683.1| ATP-dependent protease La [Candidatus Liberibacter asiaticus str. psy62] Length = 820 Back     alignment
 Score = 31.2 bits (69), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 10/29 (34%), Positives = 21/29 (72%)

Query: 56  ILLVGPTGVGKTAISRRLARLAGAPFIKV 84
           +  VGP GVGKT++++ +A+  G  ++++
Sbjct: 369 LCFVGPPGVGKTSLAQSIAKATGRQYVRM 397

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target437 ATP-dependent protease ATP-binding subunit [Candidatus
315122053437 ATP-dependent protease ATP-binding subunit [Candidatus 1 0.0
190889691435 ATP-dependent heat shock protease HslVU protein, chaper 1 1e-177
327189983435 ATP-dependent heat shock protease HslVU protein, chaper 1 1e-177
209551554435 ATP-dependent protease ATP-binding subunit HslU [Rhizob 1 1e-176
116249817435 ATP-dependent protease ATP-binding subunit HslU [Rhizob 1 1e-176
86355717435 ATP-dependent protease ATP-binding subunit [Rhizobium e 1 1e-176
241206994435 ATP-dependent protease ATP-binding subunit HslU [Rhizob 1 1e-175
325291499435 ATP-dependent protease ATP-binding subunit HslU [Agroba 1 1e-175
15887403435 ATP-dependent protease ATP-binding subunit [Agrobacteri 1 1e-174
222084250436 heat shock protein HslVU, ATPase subunit HslU [Agrobact 1 1e-174
>gi|315122053|ref|YP_004062542.1| ATP-dependent protease ATP-binding subunit [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 437 Back     alignment and organism information
 Score =  777 bits (2007), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/436 (87%), Positives = 417/436 (95%), Gaps = 1/436 (0%)

Query: 3   LTFNFSPREIVSELDRYIIGQQDAKRAVAIALRNRWRRQQLPADLRDELMPKNILLVGPT 62
           LTFNFSPREIV+ELDRYI+GQ DAKRAVAIALRNRWRRQQL  +LRDE+MPKNILLVGPT
Sbjct: 2   LTFNFSPREIVAELDRYIVGQLDAKRAVAIALRNRWRRQQLSENLRDEVMPKNILLVGPT 61

Query: 63  GVGKTAISRRLARLAGAPFIKVEVTKFTEIGYVGRNVEQIIRDLVDVAINIVRESRRDEV 122
           GVGKTAISRRLA+LAGAPFIKVEVTKFTEIGYVGRNVEQIIRDLVDVA+N+VRE+RRDEV
Sbjct: 62  GVGKTAISRRLAKLAGAPFIKVEVTKFTEIGYVGRNVEQIIRDLVDVAVNLVRENRRDEV 121

Query: 123 REQASINAEERILDALVGKTATSNTREVFRKKLRDGEISDKEIDIEVADTSSDISNFDIP 182
           RE+AS+NAEERILDALVGKTATS TRE+FR+K RDGE+SDKEIDIEVADTS DIS+FDIP
Sbjct: 122 REKASLNAEERILDALVGKTATSTTRELFRQKFRDGEVSDKEIDIEVADTSPDISSFDIP 181

Query: 183 G-GASVGILNLSELFSKVMGSGRKKKIRMSVQKCYPELMRDESDRLIDMDTVHRDSIQMV 241
           G GA+VG+LNLSELFSKVMG  RKKKIRMSVQKCYPEL+RDESD+LID+DTVHR+SIQMV
Sbjct: 182 GAGANVGVLNLSELFSKVMGGVRKKKIRMSVQKCYPELVRDESDQLIDIDTVHRESIQMV 241

Query: 242 ENYGIVFLDEFDKIVARDSGNGIGVSREGVQRDLLPLVEGSSVSTKYGSINTDHILFIAS 301
           E+YGIVFLDE DKIVAR+SG+G GVSREGVQRDLLPLVEGSSVSTKYG++NT HILFIAS
Sbjct: 242 EHYGIVFLDEIDKIVARESGDGAGVSREGVQRDLLPLVEGSSVSTKYGTVNTQHILFIAS 301

Query: 302 GAFHVSRPADLLPEIQGRFPVRVHLKSLNKSDFRLILTDTESNLILQYKELMKTEGIILD 361
           GAFHVSRP+DLLPE+QGRFPVRVHLK L++ DFRLILTDTESNLI+QYKELMKTEG+ LD
Sbjct: 302 GAFHVSRPSDLLPEMQGRFPVRVHLKPLSRDDFRLILTDTESNLIVQYKELMKTEGVTLD 361

Query: 362 FTEDSIDALADVAVNLNSTVGDIGARRLQTVMERVLEDISFSASDLQEKTVVIDAEYVRL 421
           FTEDSIDAL+DVAVNLNS VGDIGARRLQTVMERVLEDISFSAS+LQEKTVVIDAEYVRL
Sbjct: 362 FTEDSIDALSDVAVNLNSVVGDIGARRLQTVMERVLEDISFSASELQEKTVVIDAEYVRL 421

Query: 422 HIGDFPSETDMYHFIL 437
           H+GDF SE+D+  +IL
Sbjct: 422 HMGDFSSESDISRYIL 437


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|190889691|ref|YP_001976233.1| ATP-dependent heat shock protease HslVU protein, chaperone ATP-binding subunit HslU [Rhizobium etli CIAT 652] Length = 435 Back     alignment and organism information
>gi|327189983|gb|EGE57105.1| ATP-dependent heat shock protease HslVU protein, chaperone ATP-binding subunit HslU [Rhizobium etli CNPAF512] Length = 435 Back     alignment and organism information
>gi|209551554|ref|YP_002283471.1| ATP-dependent protease ATP-binding subunit HslU [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 435 Back     alignment and organism information
>gi|116249817|ref|YP_765655.1| ATP-dependent protease ATP-binding subunit HslU [Rhizobium leguminosarum bv. viciae 3841] Length = 435 Back     alignment and organism information
>gi|86355717|ref|YP_467609.1| ATP-dependent protease ATP-binding subunit [Rhizobium etli CFN 42] Length = 435 Back     alignment and organism information
>gi|241206994|ref|YP_002978090.1| ATP-dependent protease ATP-binding subunit HslU [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 435 Back     alignment and organism information
>gi|325291499|ref|YP_004277363.1| ATP-dependent protease ATP-binding subunit HslU [Agrobacterium sp. H13-3] Length = 435 Back     alignment and organism information
>gi|15887403|ref|NP_353084.1| ATP-dependent protease ATP-binding subunit [Agrobacterium tumefaciens str. C58] Length = 435 Back     alignment and organism information
>gi|222084250|ref|YP_002542776.1| heat shock protein HslVU, ATPase subunit HslU [Agrobacterium radiobacter K84] Length = 436 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target437 ATP-dependent protease ATP-binding subunit [Candidatus
PRK05201443 PRK05201, hslU, ATP-dependent protease ATP-binding subu 0.0
TIGR00390441 TIGR00390, hslU, ATP-dependent protease HslVU, ATPase s 1e-146
COG1220444 COG1220, HslU, ATP-dependent protease HslVU (ClpYQ), AT 1e-169
PRK05342412 PRK05342, clpX, ATP-dependent protease ATP-binding subu 4e-28
KOG0745564 KOG0745, KOG0745, KOG0745, Putative ATP-dependent Clp-t 1e-24
COG1219408 COG1219, ClpX, ATP-dependent protease Clp, ATPase subun 1e-23
TIGR00382413 TIGR00382, clpX, endopeptidase Clp ATP-binding regulato 4e-22
PRK05342412 PRK05342, clpX, ATP-dependent protease ATP-binding subu 3e-23
COG1219408 COG1219, ClpX, ATP-dependent protease Clp, ATPase subun 3e-21
TIGR00382413 TIGR00382, clpX, endopeptidase Clp ATP-binding regulato 7e-19
KOG0745564 KOG0745, KOG0745, KOG0745, Putative ATP-dependent Clp-t 2e-14
COG1223368 COG1223, COG1223, Predicted ATPase (AAA+ superfamily) [ 7e-07
cd00009151 cd00009, AAA, The AAA+ (ATPases Associated with a wide 3e-06
COG0714329 COG0714, COG0714, MoxR-like ATPases [General function p 1e-05
TIGR02639731 TIGR02639, ClpA, ATP-dependent Clp protease ATP-binding 2e-05
TIGR01241495 TIGR01241, FtsH_fam, ATP-dependent metalloprotease FtsH 2e-04
PRK10733644 PRK10733, hflB, ATP-dependent metalloprotease; Reviewed 6e-04
KOG1051898 KOG1051, KOG1051, KOG1051, Chaperone HSP104 and related 8e-04
PRK10865857 PRK10865, PRK10865, protein disaggregation chaperone; P 0.001
pfam07724168 pfam07724, AAA_2, AAA domain (Cdc48 subfamily) 2e-16
KOG0734752 KOG0734, KOG0734, KOG0734, AAA+-type ATPase containing 1e-05
KOG0733 802 KOG0733, KOG0733, KOG0733, Nuclear AAA ATPase (VCP subf 4e-05
pfam00004131 pfam00004, AAA, ATPase family associated with various c 1e-04
KOG0737386 KOG0737, KOG0737, KOG0737, AAA+-type ATPase [Posttransl 2e-04
CHL00176638 CHL00176, ftsH, cell division protein; Validated 3e-04
KOG0731774 KOG0731, KOG0731, KOG0731, AAA+-type ATPase containing 3e-04
PRK13946184 PRK13946, PRK13946, shikimate kinase; Provisional 3e-04
PRK00131175 PRK00131, aroK, shikimate kinase; Reviewed 3e-04
COG0465596 COG0465, HflB, ATP-dependent Zn proteases [Posttranslat 4e-04
pfam07724168 pfam07724, AAA_2, AAA domain (Cdc48 subfamily) 0.001
COG0703172 COG0703, AroK, Shikimate kinase [Amino acid transport a 0.002
KOG0729435 KOG0729, KOG0729, KOG0729, 26S proteasome regulatory co 0.003
COG0464494 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslat 0.003
smart00382148 smart00382, AAA, ATPases associated with a variety of c 0.003
pfam07728139 pfam07728, AAA_5, AAA domain (dynein-related subfamily) 0.003
COG0324308 COG0324, MiaA, tRNA delta(2)-isopentenylpyrophosphate t 4e-04
PRK03992389 PRK03992, PRK03992, proteasome-activating nucleotidase; 7e-04
TIGR01243 733 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily 0.002
COG0542786 COG0542, ClpA, ATPases with chaperone activity, ATP-bin 4e-04
pfam01078207 pfam01078, Mg_chelatase, Magnesium chelatase, subunit C 0.001
TIGR03346852 TIGR03346, chaperone_ClpB, ATP-dependent chaperone ClpB 0.001
TIGR03499282 TIGR03499, FlhF, flagellar biosynthetic protein FlhF 0.002
PRK00091307 PRK00091, miaA, tRNA delta(2)-isopentenylpyrophosphate 0.003
>gnl|CDD|179962 PRK05201, hslU, ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>gnl|CDD|161852 TIGR00390, hslU, ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>gnl|CDD|31413 COG1220, HslU, ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|180029 PRK05342, clpX, ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>gnl|CDD|35964 KOG0745, KOG0745, KOG0745, Putative ATP-dependent Clp-type protease (AAA+ ATPase superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|31412 COG1219, ClpX, ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|161849 TIGR00382, clpX, endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>gnl|CDD|180029 PRK05342, clpX, ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>gnl|CDD|31412 COG1219, ClpX, ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|161849 TIGR00382, clpX, endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>gnl|CDD|35964 KOG0745, KOG0745, KOG0745, Putative ATP-dependent Clp-type protease (AAA+ ATPase superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|31416 COG1223, COG1223, Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>gnl|CDD|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>gnl|CDD|31058 COG0714, COG0714, MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|162958 TIGR02639, ClpA, ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>gnl|CDD|162266 TIGR01241, FtsH_fam, ATP-dependent metalloprotease FtsH Back     alignment and domain information
>gnl|CDD|182683 PRK10733, hflB, ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>gnl|CDD|36269 KOG1051, KOG1051, KOG1051, Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|182791 PRK10865, PRK10865, protein disaggregation chaperone; Provisional Back     alignment and domain information
>gnl|CDD|116338 pfam07724, AAA_2, AAA domain (Cdc48 subfamily) Back     alignment and domain information
>gnl|CDD|35953 KOG0734, KOG0734, KOG0734, AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|35952 KOG0733, KOG0733, KOG0733, Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|143797 pfam00004, AAA, ATPase family associated with various cellular activities (AAA) Back     alignment and domain information
>gnl|CDD|35956 KOG0737, KOG0737, KOG0737, AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|177080 CHL00176, ftsH, cell division protein; Validated Back     alignment and domain information
>gnl|CDD|35950 KOG0731, KOG0731, KOG0731, AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|184411 PRK13946, PRK13946, shikimate kinase; Provisional Back     alignment and domain information
>gnl|CDD|178887 PRK00131, aroK, shikimate kinase; Reviewed Back     alignment and domain information
>gnl|CDD|30813 COG0465, HflB, ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|116338 pfam07724, AAA_2, AAA domain (Cdc48 subfamily) Back     alignment and domain information
>gnl|CDD|31047 COG0703, AroK, Shikimate kinase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|35948 KOG0729, KOG0729, KOG0729, 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|30812 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|128665 smart00382, AAA, ATPases associated with a variety of cellular activities Back     alignment and domain information
>gnl|CDD|149019 pfam07728, AAA_5, AAA domain (dynein-related subfamily) Back     alignment and domain information
>gnl|CDD|30672 COG0324, MiaA, tRNA delta(2)-isopentenylpyrophosphate transferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|179699 PRK03992, PRK03992, proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>gnl|CDD|162267 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>gnl|CDD|30888 COG0542, ClpA, ATPases with chaperone activity, ATP-binding subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|144608 pfam01078, Mg_chelatase, Magnesium chelatase, subunit ChlI Back     alignment and domain information
>gnl|CDD|163223 TIGR03346, chaperone_ClpB, ATP-dependent chaperone ClpB Back     alignment and domain information
>gnl|CDD|163294 TIGR03499, FlhF, flagellar biosynthetic protein FlhF Back     alignment and domain information
>gnl|CDD|178856 PRK00091, miaA, tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 437 ATP-dependent protease ATP-binding subunit [Candidatus
TIGR00390463 hslU heat shock protein HslVU, ATPase subunit HslU; Int 100.0
PRK05201442 hslU ATP-dependent protease ATP-binding subunit; Provis 100.0
COG1220444 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subun 100.0
TIGR00382452 clpX ATP-dependent Clp protease, ATP-binding subunit Cl 100.0
PRK05342411 clpX ATP-dependent protease ATP-binding subunit ClpX; P 100.0
KOG0745564 consensus 100.0
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [Posttr 100.0
) from Escherichia coli. ClpA is an ATP-dependent chaperone and part of the ClpAP protease that participates in regulatory protein degradation and the dissolution and degradation of protein aggregates . ClpA recognises sequences in specific proteins, which it then unfolds in an ATP-dependent manner and transports into the degradation chamber of the associated ClpP protein , . A small adaptor-like protein, ClpS, modulates the activity of ClpA and is an important regulatory factor for this protein . It protects ClpA from autodegradation and appears to redirect its activity away from soluble proteins and toward aggregated proteins.." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR02639">TIGR02639774 ClpA ATP-dependent Clp protease ATP-binding subunit Clp 100.0
CHL00095823 clpC Clp protease ATP binding subunit 99.98
PRK10865857 protein disaggregation chaperone; Provisional 99.98
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. Member 99.98
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ 99.97
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Members of 99.97
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subunit; Pr 99.97
KOG1051898 consensus 99.83
TIGR02903 616 spore_lon_C ATP-dependent protease, Lon family; InterPr 99.43
TIGR01241505 FtsH_fam ATP-dependent metallopeptidase HflB; InterPro: 100.0
CHL00176631 ftsH cell division protein; Validated 100.0
PRK10733644 hflB ATP-dependent metalloprotease; Reviewed 100.0
KOG0734752 consensus 100.0
COG0465596 HflB ATP-dependent Zn proteases [Posttranslational modi 100.0
KOG0731774 consensus 100.0
TIGR00763 941 lon ATP-dependent protease La; InterPro: IPR004815 Prot 99.26
PRK03992390 proteasome-activating nucleotidase; Provisional 99.93
KOG0730693 consensus 99.82
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational modi 99.68
TIGR01243980 CDC48 AAA family ATPase, CDC48 subfamily; InterPro: IPR 99.61
KOG0730 693 consensus 99.36
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subunit [P 99.92
TIGR01242364 26Sp45 26S proteasome subunit P45 family; InterPro: IPR 99.92
CHL00195491 ycf46 Ycf46; Provisional 99.79
KOG0733 802 consensus 99.77
KOG0733802 consensus 99.75
KOG0652424 consensus 99.72
KOG0729435 consensus 99.69
KOG0726440 consensus 99.58
KOG0737386 consensus 99.56
KOG0741744 consensus 99.27
KOG0732 1080 consensus 98.9
COG1223368 Predicted ATPase (AAA+ superfamily) [General function p 99.84
KOG0738491 consensus 99.7
KOG0735952 consensus 99.55
KOG0740428 consensus 99.41
KOG0739439 consensus 99.22
COG2256436 MGS1 ATPase related to the helicase subunit of the Holl 99.08
PRK06645507 DNA polymerase III subunits gamma and tau; Validated 98.58
PRK09111 600 DNA polymerase III subunits gamma and tau; Validated 97.74
pfam07724168 AAA_2 AAA domain (Cdc48 subfamily). This Pfam entry inc 99.65
KOG2004906 consensus 98.61
PRK05057172 aroK shikimate kinase I; Reviewed 98.43
cd00464154 SK Shikimate kinase (SK) is the fifth enzyme in the shi 98.28
KOG0735 952 consensus 98.26
KOG0743457 consensus 97.98
TIGR02173173 cyt_kin_arch cytidylate kinase, putative; InterPro: IPR 97.96
KOG0744423 consensus 97.95
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational modi 97.67
TIGR00972248 3a0107s01c2 phosphate ABC transporter, ATP-binding prot 97.1
PHA02244383 ATPase-like protein 97.05
TIGR00174307 miaA tRNA delta(2)-isopentenylpyrophosphate transferase 96.81
PRK08099411 nicotinamide-nucleotide adenylyltransferase; Provisiona 96.8
COG4618580 ArpD ABC-type protease/lipase transport system, ATPase 95.3
KOG0736953 consensus 99.64
KOG0651388 consensus 99.5
pfam00004131 AAA ATPase family associated with various cellular acti 99.3
KOG0742630 consensus 98.6
PRK10865 857 protein disaggregation chaperone; Provisional 98.08
CHL00095 823 clpC Clp protease ATP binding subunit 98.04
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Members of 97.8
PRK11034 758 clpA ATP-dependent Clp protease ATP-binding subunit; Pr 97.67
COG0542 786 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ 97.06
TIGR01193710 bacteriocin_ABC ABC-type bacteriocin transporter; Inter 96.46
KOG0728404 consensus 99.62
KOG0727408 consensus 99.6
TIGR01243 980 CDC48 AAA family ATPase, CDC48 subfamily; InterPro: IPR 99.53
PRK13341 726 recombination factor protein RarA/unknown domain fusion 99.56
pfam05496234 RuvB_N Holliday junction DNA helicase ruvB N-terminus. 99.54
PRK13342417 recombination factor protein RarA; Reviewed 99.49
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 99.43
CHL00181287 cbbX CbbX; Provisional 99.36
PRK10787784 DNA-binding ATP-dependent protease La; Provisional 99.33
TIGR00635305 ruvB Holliday junction DNA helicase RuvB; InterPro: IPR 99.26
cd00009151 AAA The AAA+ (ATPases Associated with a wide variety of 99.21
COG2255332 RuvB Holliday junction resolvasome, helicase subunit [D 99.17
COG0714329 MoxR-like ATPases [General function prediction only] 99.04
COG1224450 TIP49 DNA helicase TIP49, TBP-interacting protein [Tran 99.04
pfam06068395 TIP49 TIP49 C-terminus. This family consists of the C-t 99.01
KOG2028554 consensus 99.0
PRK04195403 replication factor C large subunit; Provisional 98.75
PRK00411394 cdc6 cell division control protein 6; Reviewed 98.75
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA 98.47
pfam06309127 Torsin Torsin. This family consists of several eukaryot 98.33
KOG1942456 consensus 98.22
pfam00158168 Sigma54_activat Sigma-54 interaction domain. 98.18
TIGR02928383 TIGR02928 orc1/cdc6 family replication initiation prote 98.12
PRK12422455 chromosomal replication initiation protein; Provisional 98.05
PRK11608325 pspF phage shock protein operon transcriptional activat 98.03
TIGR02640265 gas_vesic_GvpN gas vesicle protein GvpN; InterPro: IPR0 98.02
PRK05022510 anaerobic nitric oxide reductase transcription regulato 97.98
PRK08939306 primosomal protein DnaI; Reviewed 97.93
PRK13531498 regulatory ATPase RavA; Provisional 97.89
COG0593408 DnaA ATPase involved in DNA replication initiation [DNA 97.89
PRK10820513 DNA-binding transcriptional regulator TyrR; Provisional 97.66
PRK00149447 dnaA chromosomal replication initiation protein; Review 97.63
KOG2680454 consensus 97.54
COG3604550 FhlA Transcriptional regulator containing GAF, AAA-type 97.52
pfam00493327 MCM MCM2/3/5 family. 97.3
smart00350509 MCM minichromosome maintenance proteins. 96.72
TIGR01817574 nifA Nif-specific regulatory protein; InterPro: IPR0101 96.5
TIGR02915451 PEP_resp_reg putative PEP-CTERM system response regulat 96.41
pfam08298358 AAA_PrkA PrkA AAA domain. This is a family of PrkA bact 95.62
KOG0478804 consensus 95.54
COG0466 782 Lon ATP-dependent Lon protease, bacterial type [Posttra 99.28
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTERM lo 98.36
pfam1043189 ClpB_D2-small C-terminal, D2-small domain, of ClpB prot 98.15
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Members 97.66
PRK08903227 hypothetical protein; Validated 97.62
PRK05642234 DNA replication initiation factor; Validated 97.52
PRK08727233 hypothetical protein; Validated 97.24
PRK06893229 DNA replication initiation factor; Validated 97.16
PRK08084235 DNA replication initiation factor; Provisional 97.11
PRK13765 637 ATP-dependent protease Lon; Provisional 99.26
TIGR00368505 TIGR00368 Mg chelatase homolog; InterPro: IPR004482 Thi 99.24
PRK13407334 bchI magnesium chelatase subunit I; Provisional 99.11
PRK05563 541 DNA polymerase III subunits gamma and tau; Validated 98.96
PRK06305462 DNA polymerase III subunits gamma and tau; Validated 98.93
COG0606490 Predicted ATPase with chaperone activity [Posttranslati 98.91
PRK06647 560 DNA polymerase III subunits gamma and tau; Validated 98.91
pfam01078207 Mg_chelatase Magnesium chelatase, subunit ChlI. Magnesi 98.89
PRK08451 523 DNA polymerase III subunits gamma and tau; Validated 98.83
PRK07270 557 DNA polymerase III subunits gamma and tau; Validated 98.82
PRK06674 563 DNA polymerase III subunits gamma and tau; Validated 98.81
PRK07133 718 DNA polymerase III subunits gamma and tau; Validated 98.79
PRK09862506 putative ATP-dependent protease; Provisional 98.79
PRK05896 613 DNA polymerase III subunits gamma and tau; Validated 98.77
CHL00081347 chlI Mg-protoporyphyrin IX chelatase 98.75
TIGR02397363 dnaX_nterm DNA polymerase III, subunits gamma and tau; 98.74
PRK07764 775 DNA polymerase III subunits gamma and tau; Validated 98.69
PRK12402337 replication factor C small subunit 2; Reviewed 98.68
PRK08691 704 DNA polymerase III subunits gamma and tau; Validated 98.65
PRK07003 816 DNA polymerase III subunits gamma and tau; Validated 98.65
PRK12323 721 DNA polymerase III subunits gamma and tau; Provisional 98.57
PRK07994 643 DNA polymerase III subunits gamma and tau; Validated 98.53
PRK08853 717 DNA polymerase III subunits gamma and tau; Validated 98.51
PRK00440318 rfc replication factor C small subunit; Reviewed 98.39
PRK08770 663 DNA polymerase III subunits gamma and tau; Validated 98.34
PRK05648 705 DNA polymerase III subunits gamma and tau; Reviewed 98.34
PRK05564313 DNA polymerase III subunit delta'; Validated 98.25
PRK08116262 hypothetical protein; Validated 98.25
PRK07471363 DNA polymerase III subunit delta'; Validated 98.23
PRK07940395 DNA polymerase III subunit delta'; Validated 98.14
PRK09112352 DNA polymerase III subunit delta'; Validated 98.14
PRK07952242 DNA replication protein DnaC; Validated 98.06
KOG0989346 consensus 98.02
PRK04132 863 replication factor C small subunit; Provisional 98.0
PRK07399314 DNA polymerase III subunit delta'; Validated 97.88
PRK08058329 DNA polymerase III subunit delta'; Validated 97.88
PRK06872 696 DNA polymerase III subunits gamma and tau; Provisional 97.87
PRK09087226 hypothetical protein; Validated 97.6
TIGR02982220 heterocyst_DevA ABC exporter ATP-binding subunit, DevA 97.43
COG2812515 DnaX DNA polymerase III, gamma/tau subunits [DNA replic 97.41
COG0470325 HolB ATPase involved in DNA replication [DNA replicatio 97.36
COG2074299 2-phosphoglycerate kinase [Carbohydrate transport and m 97.31
KOG2170344 consensus 97.18
COG1239423 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolism] 97.16
PRK06620214 hypothetical protein; Validated 97.06
KOG0991333 consensus 97.0
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA bact 96.52
TIGR02442 688 Cob-chelat-sub cobaltochelatase subunit; InterPro: IPR0 96.42
pfam03969361 AFG1_ATPase AFG1-like ATPase. This family of proteins c 96.33
PRK04220306 2-phosphoglycerate kinase; Provisional 96.3
pfam01057271 Parvo_NS1 Parvovirus non-structural protein NS1. This f 96.3
cd03234226 ABCG_White The White subfamily represents ABC transport 96.21
cd01882225 BMS1 Bms1. Bms1 is an essential, evolutionarily conserv 96.09
pfam05621302 TniB Bacterial TniB protein. This family consists of se 96.01
PRK05707328 DNA polymerase III subunit delta'; Validated 95.86
PRK06964342 DNA polymerase III subunit delta'; Validated 95.78
PRK12337492 2-phosphoglycerate kinase; Provisional 95.62
KOG1051 898 consensus 95.62
TIGR02030340 BchI-ChlI magnesium chelatase ATPase subunit I; InterPr 95.2
COG1485367 Predicted ATPase [General function prediction only] 95.19
TIGR02881261 spore_V_K stage V sporulation protein K; InterPro: IPR0 98.84
pfam00308219 Bac_DnaA Bacterial dnaA protein. 98.33
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP-bindi 97.37
PRK11176581 lipid transporter ATP-binding/permease protein; Provisi 97.21
TIGR00764 662 lon_rel ATP-dependent protease, putative; InterPro: IPR 97.06
PRK10790593 putative multidrug transporter membrane\ATP-binding com 97.01
PRK10789569 putative multidrug transporter membrane\ATP-binding com 96.8
PRK13657585 cyclic beta-1,2-glucan ABC transporter; Provisional 96.6
TIGR03375694 type_I_sec_LssB type I secretion system ATPase, LssB fa 96.14
PRK11160575 cysteine/glutathione ABC transporter membrane/ATP-bindi 96.14
pfam07726131 AAA_3 ATPase family associated with various cellular ac 98.59
pfam07728139 AAA_5 AAA domain (dynein-related subfamily). This Pfam 98.45
PRK00131175 aroK shikimate kinase; Reviewed 98.34
PRK13946195 shikimate kinase; Provisional 98.27
PRK03731172 aroL shikimate kinase II; Reviewed 98.21
PRK13947171 shikimate kinase; Provisional 98.21
PRK08181269 transposase; Validated 98.18
PRK13948182 shikimate kinase; Provisional 98.16
PRK06526254 transposase; Provisional 98.15
PRK13949169 shikimate kinase; Provisional 98.14
PRK09183258 transposase/IS protein; Provisional 98.13
PRK11331459 5-methylcytosine-specific restriction enzyme subunit Mc 98.11
PRK00625173 shikimate kinase; Provisional 98.0
pfam01695178 IstB IstB-like ATP binding protein. This protein contai 98.0
COG0703172 AroK Shikimate kinase [Amino acid transport and metabol 97.99
smart00382148 AAA ATPases associated with a variety of cellular activ 97.96
PRK07261171 topology modulation protein; Provisional 97.94
PRK11361457 acetoacetate metabolism regulatory protein AtoC; Provis 97.93
PRK06835330 DNA replication protein DnaC; Validated 97.93
PRK08118167 topology modulation protein; Reviewed 97.91
PRK10365441 transcriptional regulatory protein ZraR; Provisional 97.91
PRK10923469 glnG nitrogen regulation protein NR(I); Provisional 97.84
PRK12377248 putative replication protein; Provisional 97.83
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phosphoryl t 97.81
COG1484254 DnaC DNA replication protein [DNA replication, recombin 97.78
PRK09825176 idnK D-gluconate kinase; Provisional 97.77
COG1221403 PspF Transcriptional regulators containing an AAA-type 97.73
PRK00091304 miaA tRNA delta(2)-isopentenylpyrophosphate transferase 97.73
PRK11545177 gntK gluconate kinase 1; Provisional 97.71
KOG0736 953 consensus 97.71
TIGR01187331 potA polyamine ABC transporter, ATP-binding protein; In 97.7
PRK13951 488 bifunctional shikimate kinase/3-dehydroquinate synthase 97.64
CHL00026 2286 ycf2 Ycf2 97.63
PRK11388639 DNA-binding transcriptional regulator DhaR; Provisional 97.63
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 97.62
COG0324308 MiaA tRNA delta(2)-isopentenylpyrophosphate transferase 97.59
PTZ00088225 adenylate kinase 1; Provisional 97.58
PRK00279215 adk adenylate kinase; Reviewed 97.57
KOG0741744 consensus 97.52
cd01428194 ADK Adenylate kinase (ADK) catalyzes the reversible pho 97.51
COG0563178 Adk Adenylate kinase and related kinases [Nucleotide tr 97.51
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. Member 97.49
PRK06921265 hypothetical protein; Provisional 97.46
PRK05703412 flhF flagellar biosynthesis regulator FlhF; Validated 97.44
CHL00178 2133 consensus 97.42
PRK02496185 adk adenylate kinase; Provisional 97.41
COG2204464 AtoC Response regulator containing CheY-like receiver, 97.39
COG3842352 PotA ABC-type spermidine/putrescine transport systems, 97.37
PRK13900332 type IV secretion system ATPase VirB11; Provisional 97.37
PRK06217185 hypothetical protein; Validated 97.35
CHL00179 2262 consensus 97.35
TIGR01313175 therm_gnt_kin carbohydrate kinase, thermoresistant gluc 97.33
PRK06995404 flhF flagellar biosynthesis regulator FlhF; Validated 97.32
TIGR03263180 guanyl_kin guanylate kinase. Members of this family are 97.31
pfam01745232 IPT Isopentenyl transferase. Isopentenyl transferase / 97.31
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 97.29
KOG3347176 consensus 97.26
COG1102179 Cmk Cytidylate kinase [Nucleotide transport and metabol 97.26
PRK08154304 anaerobic benzoate catabolism transcriptional regulator 97.24
TIGR00602 670 rad24 checkpoint protein rad24; InterPro: IPR004582 To 97.22
cd01130186 VirB11-like_ATPase Type IV secretory pathway component 97.16
TIGR02782315 TrbB_P P-type conjugative transfer ATPase TrbB; InterPr 97.16
TIGR02868566 CydC ABC transporter, CydDC cysteine exporter (CydDC-E) 97.15
pfam06414191 Zeta_toxin Zeta toxin. This family consists of several 97.14
PRK00300208 gmk guanylate kinase; Provisional 97.12
pfam00437283 GSPII_E Type II/IV secretion system protein. This famil 97.12
PRK13808297 adenylate kinase; Provisional 97.1
PRK13851343 type IV secretion system protein VirB11; Provisional 97.09
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Validated 97.09
PRK03839180 putative kinase; Provisional 97.07
TIGR01351232 adk adenylate kinases; InterPro: IPR006259 Most members 97.03
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility and s 97.03
COG3854308 SpoIIIAA ncharacterized protein conserved in bacteria [ 97.03
cd03115173 SRP The signal recognition particle (SRP) mediates the 97.02
PRK13894320 conjugal transfer ATPase TrbB; Provisional 97.01
COG3839338 MalK ABC-type sugar transport systems, ATPase component 96.99
pfam00448196 SRP54 SRP54-type protein, GTPase domain. This family in 96.96
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7.4.8), 96.93
pfam00625182 Guanylate_kin Guanylate kinase. 96.88
KOG2543438 consensus 96.87
COG4178604 ABC-type uncharacterized transport system, permease and 96.86
pfam03215490 Rad17 Rad17 cell cycle checkpoint protein. 96.86
PRK13833323 conjugal transfer protein TrbB; Provisional 96.85
pfam00406186 ADK Adenylate kinase. 96.79
PRK00889175 adenylylsulfate kinase; Provisional 96.79
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is of f 96.79
TIGR01420350 pilT_fam twitching motility protein; InterPro: IPR00632 96.77
COG4088261 Predicted nucleotide kinase [Nucleotide transport and m 96.76
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 96.76
PRK11022327 dppD dipeptide transporter ATP-binding subunit; Provisi 96.76
PRK11432351 fbpC ferric transporter ATP-binding subunit; Provisiona 96.73
PRK10536262 hypothetical protein; Provisional 96.73
pfam01583157 APS_kinase Adenylylsulphate kinase. Enzyme that catalys 96.73
pfam00910105 RNA_helicase RNA helicase. This family includes RNA hel 96.72
cd02020147 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the 96.71
PRK04182178 cytidylate kinase; Provisional 96.71
PRK05541176 adenylylsulfate kinase; Provisional 96.69
TIGR03258362 PhnT 2-aminoethylphosphonate ABC transport system, ATP- 96.65
KOG3354191 consensus 96.64
TIGR02528144 EutP ethanolamine utilization protein, EutP; InterPro: 96.62
PRK10418254 nikD nickel transporter ATP-binding protein; Provisiona 96.61
TIGR03167311 tRNA_sel_U_synt tRNA 2-selenouridine synthase. The Esch 96.59
TIGR03265353 PhnT2 putative 2-aminoethylphosphonate ABC transport sy 96.59
smart00072184 GuKc Guanylate kinase homologues. Active enzymes cataly 96.58
PRK13649280 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.56
TIGR00968241 3a0106s01 sulfate ABC transporter, ATP-binding protein; 96.54
PRK07667190 uridine kinase; Provisional 96.53
PRK03846198 adenylylsulfate kinase; Provisional 96.52
COG1122235 CbiO ABC-type cobalt transport system, ATPase component 96.52
KOG1969 877 consensus 96.5
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the glycine 96.5
PRK09473330 oppD oligopeptide transporter ATP-binding component; Pr 96.48
PRK00023225 cmk cytidylate kinase; Provisional 96.47
PRK13764605 ATPase; Provisional 96.47
cd03246173 ABCC_Protease_Secretion This family represents the ABC 96.43
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transport s 96.42
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette 96.42
PRK06696227 uridine kinase; Validated 96.42
PRK13651304 cobalt transporter ATP-binding subunit; Provisional 96.4
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyze 96.4
PRK08769319 DNA polymerase III subunit delta'; Validated 96.39
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transporter c 96.39
PRK12727557 flagellar biosynthesis regulator FlhF; Provisional 96.38
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the maltose 96.37
TIGR03415382 ABC_choXWV_ATP choline ABC transporter, ATP-binding pro 96.37
COG3829560 RocR Transcriptional regulator containing PAS, AAA-type 96.36
COG1936180 Predicted nucleotide kinase (related to CMP and AMP kin 96.35
cd03257228 ABC_NikE_OppD_transporters The ABC transporter subfamil 96.34
TIGR02322183 phosphon_PhnN phosphonate metabolism protein/1,5-bispho 96.34
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pigment 96.32
TIGR00455187 apsK adenylylsulfate kinase; InterPro: IPR002891 Enzyme 96.32
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provisional 96.31
KOG0060659 consensus 96.31
PRK11248255 tauB taurine transporter ATP-binding subunit; Provision 96.31
cd03299235 ABC_ModC_like Archeal protein closely related to ModC. 96.31
PRK11650358 ugpC glycerol-3-phosphate transporter ATP-binding subun 96.3
PRK09452378 potA putrescine/spermidine ABC transporter ATPase prote 96.3
PRK11000369 maltose/maltodextrin transporter ATP-binding protein; P 96.3
PRK10636 638 putative ABC transporter ATP-binding protein; Provision 96.29
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding com 96.28
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transport s 96.28
cd03229178 ABC_Class3 This class is comprised of all BPD (Binding 96.27
PRK10078184 ribose 1,5-bisphosphokinase; Provisional 96.27
PRK11144352 modC molybdate transporter ATP-binding protein; Provisi 96.27
PRK10851352 sulfate/thiosulfate transporter subunit; Provisional 96.26
PRK11784333 tRNA 2-selenouridine synthase; Provisional 96.26
PRK10070400 glycine betaine transporter ATP-binding subunit; Provis 96.24
pfam00485196 PRK Phosphoribulokinase / Uridine kinase family. In Ara 96.24
PRK13644274 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.23
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ07 96.21
PRK10247225 putative ABC transporter ATP-binding protein YbbL; Prov 96.21
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the ATPa 96.21
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-type tra 96.21
PRK06871324 DNA polymerase III subunit delta'; Validated 96.2
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding component 96.17
PRK10744257 phosphate transporter subunit; Provisional 96.16
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1.48), 96.13
pfam07931174 CPT Chloramphenicol phosphotransferase-like protein. Th 96.13
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-bi 96.12
cd02028179 UMPK_like Uridine monophosphate kinase_like (UMPK_like) 96.1
PRK13635279 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.09
PRK10419266 nikE nickel transporter ATP-binding protein; Provisiona 96.09
pfam10412386 TrwB_AAD_bind Type IV secretion-system coupling protein 96.09
COG0194191 Gmk Guanylate kinase [Nucleotide transport and metaboli 96.08
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-bindi 96.07
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) f 96.07
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) tr 96.07
PRK05917290 DNA polymerase III subunit delta'; Validated 96.05
PRK13650276 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.04
PRK13768253 GTPase; Provisional 96.04
PRK13640283 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.04
pfam00519432 PPV_E1_C Papillomavirus helicase. This protein is a DNA 96.01
cd01124187 KaiC KaiC is a circadian clock protein primarily found 96.0
PRK13648269 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.98
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein; Rev 95.98
TIGR02142361 modC_ABC molybdate ABC transporter, ATP-binding protein 95.97
PRK08699325 DNA polymerase III subunit delta'; Validated 95.97
KOG1970 634 consensus 95.95
pfam03266168 DUF265 Protein of unknown function, DUF265. 95.94
COG4650531 RtcR Sigma54-dependent transcription regulator containi 95.94
PRK11701258 phnK phosphonates transport ATP-binding protein; Provis 95.94
COG4525259 TauB ABC-type taurine transport system, ATPase componen 95.93
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNa 95.92
PRK09302501 circadian clock protein KaiC; Reviewed 95.91
COG2804500 PulE Type II secretory pathway, ATPase PulE/Tfp pilus a 95.89
pfam05729165 NACHT NACHT domain. This NTPase domain is found in apop 95.88
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC component 95.88
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 95.88
PRK13637287 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.88
PRK13632273 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.87
COG1118345 CysA ABC-type sulfate/molybdate transport systems, ATPa 95.87
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). Cm-i 95.87
PRK06547184 hypothetical protein; Provisional 95.86
pfam01202158 SKI Shikimate kinase. 95.85
COG1201 814 Lhr Lhr-like helicases [General function prediction onl 95.85
TIGR03269 520 met_CoM_red_A2 methyl coenzyme M reductase system, comp 95.85
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC component o 95.85
PRK09270230 frcK putative fructose transport system kinase; Reviewe 95.85
PRK11607377 potG putrescine transporter ATP-binding subunit; Provis 95.84
PRK13642277 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.84
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 95.84
PRK11147 632 ABC transporter ATPase component; Reviewed 95.83
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding subunit 95.83
PRK11264248 putative amino-acid ABC transporter ATP-binding protein 95.83
PRK13539206 cytochrome c biogenesis protein CcmA; Provisional 95.82
pfam04851103 ResIII Type III restriction enzyme, res subunit. 95.82
PRK10771233 thiQ thiamine transporter ATP-binding subunit; Provisio 95.82
PRK13633281 cobalt transporter ATP-binding subunit; Provisional 95.82
cd01127410 TrwB Bacterial conjugation protein TrwB, ATP binding do 95.82
COG1123 539 ATPase components of various ABC-type transport systems 95.81
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC transpor 95.81
PRK10619257 histidine/lysine/arginine/ornithine transporter subunit 95.81
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; Provi 95.81
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonate tra 95.81
PRK11831269 putative ABC transporter ATP-binding protein YrbF; Prov 95.8
cd01120165 RecA-like_NTPases RecA-like NTPases. This family includ 95.79
TIGR02788328 VirB11 P-type DNA transfer ATPase VirB11; InterPro: IPR 95.79
PRK05480209 uridine kinase; Provisional 95.77
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranpor 95.77
PRK13646286 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.77
cd03236255 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNa 95.76
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic fibr 95.75
PRK13549513 xylose transporter ATP-binding subunit; Provisional 95.75
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type tr 95.74
cd03278197 ABC_SMC_barmotin Barmotin is a tight junction-associate 95.74
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in cyto 95.73
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter that i 95.73
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucleotide 95.72
PRK11308327 dppF dipeptide transporter ATP-binding subunit; Provisi 95.72
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. This 95.72
pfam02562205 PhoH PhoH-like protein. PhoH is a cytoplasmic protein a 95.72
PRK11147632 ABC transporter ATPase component; Reviewed 95.71
PRK10908222 cell division protein FtsE; Provisional 95.7
PRK13634276 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.7
COG1618179 Predicted nucleotide kinase [Nucleotide transport and m 95.69
cd03290218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea receptor 95.69
PRK06090319 DNA polymerase III subunit delta'; Validated 95.68
PRK04328250 hypothetical protein; Provisional 95.67
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-lik 95.65
PRK13547273 hmuV hemin importer ATP-binding subunit; Provisional 95.62
CHL00131252 ycf16 sulfate ABC transporter protein; Validated 95.62
PRK10584228 putative ABC transporter ATP-binding protein YbbA; Prov 95.62
PRK13695174 putative NTPase; Provisional 95.61
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. This 95.59
PTZ00301210 uridine kinase; Provisional 95.57
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 95.57
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter nucle 95.57
cd03291282 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic fibr 95.56
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin exporte 95.55
PRK10762501 D-ribose transporter ATP binding protein; Provisional 95.54
PRK13544208 consensus 95.53
cd03288257 ABCC_SUR2 The SUR domain 2. The sulfonylurea receptor S 95.53
PRK09580248 sufC cysteine desulfurase ATPase component; Reviewed 95.52
PRK13639275 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.52
PRK11819 556 putative ABC transporter ATP-binding protein; Reviewed 95.52
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse family 95.51
PRK13647273 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.51
PRK13652277 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.5
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-b 95.5
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-binding p 95.48
PRK13645289 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.47
PRK10261 623 glutathione transporter ATP-binding protein; Provisiona 95.47
COG0572218 Udk Uridine kinase [Nucleotide transport and metabolism 95.46
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a 95.46
pfam06745231 KaiC KaiC. This family represents a conserved region wi 95.46
cd03235213 ABC_Metallic_Cations ABC component of the metal-type tr 95.45
pfam00270167 DEAD DEAD/DEAH box helicase. Members of this family inc 95.45
PRK10938490 putative molybdenum transport ATP-binding protein ModF; 95.44
PRK13631320 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.44
PRK10253265 iron-enterobactin transporter ATP-binding protein; Prov 95.43
cd02024187 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme in 95.41
PRK08233182 hypothetical protein; Provisional 95.38
cd03258233 ABC_MetN_methionine_transporter MetN (also known as Yus 95.37
COG1855604 ATPase (PilT family) [General function prediction only] 95.36
PRK13636285 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.35
COG1117253 PstB ABC-type phosphate transport system, ATPase compon 95.35
pfam02367123 UPF0079 Uncharacterized P-loop hydrolase UPF0079. This 95.34
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, invol 95.34
COG1131293 CcmA ABC-type multidrug transport system, ATPase compon 95.34
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cyt 95.33
PRK13643288 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.31
PRK11124242 artP arginine transporter ATP-binding subunit; Provisio 95.31
cd02025220 PanK Pantothenate kinase (PanK) catalyzes the phosphory 95.28
TIGR02858282 spore_III_AA stage III sporulation protein AA; InterPro 95.27
PRK09544251 znuC high-affinity zinc transporter ATPase; Reviewed 95.27
TIGR00678216 holB DNA polymerase III, delta' subunit; InterPro: IPR0 95.26
PRK11231255 fecE iron-dicitrate transporter ATP-binding subunit; Pr 95.26
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-like (P 95.26
PRK11860 662 bifunctional 3-phosphoshikimate 1-carboxyvinyltransfera 95.26
PRK13477512 bifunctional pantoate ligase/cytidylate kinase; Provisi 95.25
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, closely 95.23
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Trans 95.22
cd04157162 Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a subfamil 95.21
COG0630312 VirB11 Type IV secretory pathway, VirB11 components, an 95.2
cd03240204 ABC_Rad50 The catalytic domains of Rad50 are similar to 95.2
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; Provi 95.2
PRK13548257 hmuV hemin importer ATP-binding subunit; Provisional 95.14
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.12
PRK07993334 DNA polymerase III subunit delta'; Validated 95.1
COG1126240 GlnQ ABC-type polar amino acid transport system, ATPase 95.09
TIGR00382452 clpX ATP-dependent Clp protease, ATP-binding subunit Cl 98.38
PRK05342411 clpX ATP-dependent protease ATP-binding subunit ClpX; P 98.26
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [Posttr 97.42
KOG0745564 consensus 97.39
TIGR02533495 type_II_gspE general secretory pathway protein E; Inter 96.66
TIGR02902 532 spore_lonB ATP-dependent protease LonB; InterPro: IPR01 98.28
pfam01434192 Peptidase_M41 Peptidase family M41. 97.91
TIGR02538577 type_IV_pilB type IV-A pilus assembly ATPase PilB; Inte 96.82
COG3265161 GntK Gluconate kinase [Carbohydrate transport and metab 95.91
PRK10522547 multidrug transporter membrane component/ATP-binding co 95.66
>TIGR00390 hslU heat shock protein HslVU, ATPase subunit HslU; InterPro: IPR004491 This family of proteins represent HslU, a bacterial clpX homolog, which is an ATPase and chaperone belonging to the AAA Clp/Hsp100 family and a component of the eubacterial proteasome Back     alignment and domain information
>PRK05201 hslU ATP-dependent protease ATP-binding subunit; Provisional Back     alignment and domain information
>COG1220 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00382 clpX ATP-dependent Clp protease, ATP-binding subunit ClpX; InterPro: IPR004487 ClpX is a member of the HSP (heat-shock protein) 100 family Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>KOG0745 consensus Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit ClpA; InterPro: IPR013461 Proteins in this entry are related to ClpA () from Escherichia coli Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>KOG1051 consensus Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family; InterPro: IPR014252 This entry shows some relation to the widely distributed ATP-dependent protease La, also called Lon or LonA (IPR004815 from INTERPRO), but is more closely related to LonB (IPR014251 from INTERPRO), a LonA paralog found only in endospore-forming bacteria Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metallopeptidase HflB; InterPro: IPR005936 Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information