254780493

254780493

phosphoribosylaminoimidazole-succinocarboxamide synthase

GeneID in NCBI database:8209487Locus tag:CLIBASIA_01900
Protein GI in NCBI database:254780493Protein Accession:YP_003064906.1
Gene range:-(784943, 785914)Protein Length:323aa
Gene description:phosphoribosylaminoimidazole-succinocarboxamide synthase
COG prediction:none
KEGG prediction:purC; phosphoribosylaminoimidazole-succinocarboxamide synthase (EC:6.3.2.6); K01923 phosphoribosylaminoimidazole-succinocarboxamide synthase [EC:6.3.2.6]
SEED prediction:Phosphoribosylaminoimidazole-succinocarboxamide synthase (EC 6.3.2.6)
Pathway involved in KEGG:Purine metabolism [PATH:las00230]
Subsystem involved in SEED:De Novo Purine Biosynthesis
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320---
MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSELPPLERIRNNLRKYTHRHLSSRN
cccccHHHcccccEEEcccEEEEEEcccccEEEEEEcccccccccccccccHHHHHHHHHHHHHHHHHHHcccHHcccccccEEEEEEEEEEEEEEEEccHHHccHHHHHHHHHHccccccccccccccccccccccccEEEEEEEcccccccccccccHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEEEEEcccccEEEEEEEccccccccccccccccccccccccccccHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHccc
ccccHHcccccccccccccEEEEEEcccccEEEEEccccccHcEcccccccccHHHHHHHHHHHHHHHccccccccccccccEEEEEEcccccEEEEEEEEEEcccHHHHHHHHHccccEEEcEEcccccccHccccccccccccHHHcccccccccccHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHccEEEEEEEEEEccccccEEEEEEEcccccccccccccHHHHHcccccccccccHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHccc
mrilskayipelpnyysgkvrenyflsdgtriTIATDRLSAFdqniacipykgevLNQITQYWFHHtsdicsnhtldypdpnvlvgqqlqmfPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEyllpdnmsdnqklpypvitpttkssesasgcdqpispneiihrgiltrnQWETISSYALSLFERGCKLALENglilvdskyefgidkkqniiladeihtpdssryweVETYEKSFregitpigldkdfIRNWIltrcnpyrdnipdipeniilRTSQTYIAAYEKITGlkfiadnselppleRIRNNLRKYTHRHLSSRN
mrilskayipelpnyysgkvrenyFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYllpdnmsdnqKLPYPVITPttkssesasgcdqpisPNEIIHRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKkqniiladeihtpdssrYWEVETYEKSfregitpigldkdfIRNWILTRcnpyrdnipdipenIILRTSQTYIAAYEKITGLkfiadnselpplerirnnlrkythrhlssrn
MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSELPPLERIRNNLRKYTHRHLSSRN
**ILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFR*****IGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSELPPLERIRNNLRKYTHRHL****
MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITP************QPISPNEIIHRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSELPPLERIRNNLRKY*********
******AYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSELPPLERIRNNLRKYTHRHLS***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSELPPLERIRNNLRKYTHRHLSSRN
MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSELPPLERIRNNLRKYTHRHLSSRN
MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSELPPLERIRNNLRKYTHRHLSSRN

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target323 phosphoribosylaminoimidazole-succinocarboxamide synthas
315122329330 phosphoribosylaminoimidazole-succinocarboxamide synthas 1 1e-147
86359001314 phosphoribosylaminoimidazole-succinocarboxamide synthas 1 1e-114
116253612314 phosphoribosylaminoimidazole-succinocarboxamide synthas 1 1e-114
241206132314 phosphoribosylaminoimidazole-succinocarboxamide synthas 1 1e-114
327188985331 phosphoribosylamidoimidazolesuccinocarboxamide synthase 1 1e-114
325293919316 phosphoribosylaminoimidazole-succinocarboxamidesynthase 1 1e-113
15889807316 phosphoribosylaminoimidazole-succinocarboxamide synthas 1 1e-113
190893228314 phosphoribosylamidoimidazolesuccinocarboxamide synthase 1 1e-113
222106973316 phosphoribosylaminoimidazole-succinocarboxamide synthas 1 1e-112
218682337314 phosphoribosylaminoimidazole-succinocarboxamide synthas 1 1e-112
>gi|315122329|ref|YP_004062818.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 330 Back     alignment and organism information
 Score =  524 bits (1349), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 248/316 (78%), Positives = 279/316 (88%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQ 61
           RI+S+AYIPELPNYY GKVRENYFL+DGTRITIATDRLSAFD+NI CIP+KGE+LN+ITQ
Sbjct: 12  RIISEAYIPELPNYYPGKVRENYFLNDGTRITIATDRLSAFDRNITCIPHKGELLNKITQ 71

Query: 62  YWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKI 121
           YWF HTSDIC NH LDYPDPNVLVG+QLQMFPIELIVRGYLAGNTKTSLLTFYK G+R I
Sbjct: 72  YWFQHTSDICENHALDYPDPNVLVGKQLQMFPIELIVRGYLAGNTKTSLLTFYKKGQRTI 131

Query: 122 YEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYA 181
           Y + LPDNM DNQKLP+ +ITPTTKSS      D+PISP+EII +GILT+NQWETISSYA
Sbjct: 132 YGHSLPDNMHDNQKLPHTIITPTTKSSGPNFEHDKPISPHEIIQKGILTQNQWETISSYA 191

Query: 182 LSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREG 241
           L+LFERGCKLA E  LILVDSKYEFG+DKK NI+LADEIHTPDSSRYW+ ETYEKS +EG
Sbjct: 192 LALFERGCKLASERDLILVDSKYEFGLDKKNNIVLADEIHTPDSSRYWKAETYEKSLKEG 251

Query: 242 ITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSEL 301
            +P GLDKD IRNWILT CNPY+DNIP+IPENI+L  SQTY+ AYE+ITGLKFI +NS+ 
Sbjct: 252 TSPEGLDKDLIRNWILTHCNPYKDNIPNIPENILLHISQTYMTAYERITGLKFIGENSDF 311

Query: 302 PPLERIRNNLRKYTHR 317
            PL RIRNNL +Y +R
Sbjct: 312 SPLHRIRNNLEQYINR 327


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|86359001|ref|YP_470893.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Rhizobium etli CFN 42] Length = 314 Back     alignment and organism information
>gi|116253612|ref|YP_769450.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Rhizobium leguminosarum bv. viciae 3841] Length = 314 Back     alignment and organism information
>gi|241206132|ref|YP_002977228.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 314 Back     alignment and organism information
>gi|327188985|gb|EGE56174.1| phosphoribosylamidoimidazolesuccinocarboxamide synthase protein [Rhizobium etli CNPAF512] Length = 331 Back     alignment and organism information
>gi|325293919|ref|YP_004279783.1| phosphoribosylaminoimidazole-succinocarboxamidesynthase [Agrobacterium sp. H13-3] Length = 316 Back     alignment and organism information
>gi|15889807|ref|NP_355488.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Agrobacterium tumefaciens str. C58] Length = 316 Back     alignment and organism information
>gi|190893228|ref|YP_001979770.1| phosphoribosylamidoimidazolesuccinocarboxamide synthase [Rhizobium etli CIAT 652] Length = 314 Back     alignment and organism information
>gi|222106973|ref|YP_002547764.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Agrobacterium vitis S4] Length = 316 Back     alignment and organism information
>gi|218682337|ref|ZP_03529938.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Rhizobium etli CIAT 894] Length = 314 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target323 phosphoribosylaminoimidazole-succinocarboxamide synthas
PRK12607313 PRK12607, PRK12607, phosphoribosylaminoimidazole-succin 1e-150
PLN02544370 PLN02544, PLN02544, phosphoribosylaminoimidazole-succin 1e-91
PRK13961296 PRK13961, PRK13961, phosphoribosylaminoimidazole-succin 4e-62
COG0152247 COG0152, PurC, Phosphoribosylaminoimidazolesuccinocarbo 4e-57
TIGR00081237 TIGR00081, purC, phosphoribosylaminoimidazole-succinoca 2e-33
TIGR02735365 TIGR02735, purC_vibrio, phosphoribosylaminoimidazole-su 4e-28
PRK13960367 PRK13960, PRK13960, phosphoribosylaminoimidazole-succin 3e-27
KOG2835373 KOG2835, KOG2835, KOG2835, Phosphoribosylamidoimidazole 4e-22
PRK13959341 PRK13959, PRK13959, phosphoribosylaminoimidazole-succin 5e-16
cd01414279 cd01414, SAICAR_synt_Sc, non-metazoan 5-aminoimidazole- 9e-94
pfam01259243 pfam01259, SAICAR_synt, SAICAR synthetase 1e-46
cd00476230 cd00476, SAICAR_synt, 5-aminoimidazole-4-(N-succinylcar 2e-28
PRK09362238 PRK09362, PRK09362, phosphoribosylaminoimidazole-succin 8e-22
cd01415230 cd01415, SAICAR_synt_PurC, bacterial and archaeal 5-ami 2e-21
cd01416252 cd01416, SAICAR_synt_Ade5, Ade5_like 5-aminoimidazole-4 4e-05
>gnl|CDD|183621 PRK12607, PRK12607, phosphoribosylaminoimidazole-succinocarboxamide synthase; Provisional Back     alignment and domain information
>gnl|CDD|178159 PLN02544, PLN02544, phosphoribosylaminoimidazole-succinocarboxamide synthase Back     alignment and domain information
>gnl|CDD|184421 PRK13961, PRK13961, phosphoribosylaminoimidazole-succinocarboxamide synthase; Provisional Back     alignment and domain information
>gnl|CDD|30501 COG0152, PurC, Phosphoribosylaminoimidazolesuccinocarboxamide (SAICAR) synthase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|161698 TIGR00081, purC, phosphoribosylaminoimidazole-succinocarboxamide synthase Back     alignment and domain information
>gnl|CDD|131782 TIGR02735, purC_vibrio, phosphoribosylaminoimidazole-succinocarboxamide synthase, Vibrio type Back     alignment and domain information
>gnl|CDD|184420 PRK13960, PRK13960, phosphoribosylaminoimidazole-succinocarboxamide synthase; Provisional Back     alignment and domain information
>gnl|CDD|38046 KOG2835, KOG2835, KOG2835, Phosphoribosylamidoimidazole-succinocarboxamide synthase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|184419 PRK13959, PRK13959, phosphoribosylaminoimidazole-succinocarboxamide synthase; Provisional Back     alignment and domain information
>gnl|CDD|133469 cd01414, SAICAR_synt_Sc, non-metazoan 5-aminoimidazole-4-(N-succinylcarboxamide) ribonucleotide (SAICAR) synthase Back     alignment and domain information
>gnl|CDD|110273 pfam01259, SAICAR_synt, SAICAR synthetase Back     alignment and domain information
>gnl|CDD|133468 cd00476, SAICAR_synt, 5-aminoimidazole-4-(N-succinylcarboxamide) ribonucleotide (SAICAR) synthase Back     alignment and domain information
>gnl|CDD|181800 PRK09362, PRK09362, phosphoribosylaminoimidazole-succinocarboxamide synthase; Reviewed Back     alignment and domain information
>gnl|CDD|133470 cd01415, SAICAR_synt_PurC, bacterial and archaeal 5-aminoimidazole-4-(N-succinylcarboxamide) ribonucleotide (SAICAR) synthase Back     alignment and domain information
>gnl|CDD|133471 cd01416, SAICAR_synt_Ade5, Ade5_like 5-aminoimidazole-4-(N-succinylcarboxamide) ribonucleotide (SAICAR) synthase Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 323 phosphoribosylaminoimidazole-succinocarboxamide synthas
PRK12607295 phosphoribosylaminoimidazole-succinocarboxamide synthas 100.0
PRK13961297 phosphoribosylaminoimidazole-succinocarboxamide synthas 100.0
cd01414279 SAICAR_synt_Sc non-metazoan 5-aminoimidazole-4-(N-succi 100.0
PRK13959335 phosphoribosylaminoimidazole-succinocarboxamide synthas 100.0
PRK13960367 phosphoribosylaminoimidazole-succinocarboxamide synthas 100.0
). ; GO: 0004639 phosphoribosylaminoimidazolesuccinocarboxamide synthase activity, 0006164 purine nucleotide biosynthetic process." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR00081">TIGR00081374 purC phosphoribosylaminoimidazole-succinocarboxamide sy 100.0
cd01415230 SAICAR_synt_PurC bacterial and archaeal 5-aminoimidazol 100.0
PRK09362238 phosphoribosylaminoimidazole-succinocarboxamide synthas 100.0
pfam01259243 SAICAR_synt SAICAR synthetase. Also known as Phosphorib 100.0
cd01416252 SAICAR_synt_Ade5 Ade5_like 5-aminoimidazole-4-(N-succin 100.0
COG0152247 PurC Phosphoribosylaminoimidazolesuccinocarboxamide (SA 100.0
cd00476230 SAICAR_synt 5-aminoimidazole-4-(N-succinylcarboxamide) 100.0
TIGR02735365 purC_vibrio phosphoribosylaminoimidazole-succinocarboxa 100.0
KOG2835373 consensus 100.0
KOG2835373 consensus 98.96
TIGR01648 611 hnRNP-R-Q hnRNP-R, Q splicing factor family; InterPro: 98.22
KOG0117 506 consensus 94.18
>PRK12607 phosphoribosylaminoimidazole-succinocarboxamide synthase; Provisional Back     alignment and domain information
>PRK13961 phosphoribosylaminoimidazole-succinocarboxamide synthase; Provisional Back     alignment and domain information
>cd01414 SAICAR_synt_Sc non-metazoan 5-aminoimidazole-4-(N-succinylcarboxamide) ribonucleotide (SAICAR) synthase Back     alignment and domain information
>PRK13959 phosphoribosylaminoimidazole-succinocarboxamide synthase; Provisional Back     alignment and domain information
>PRK13960 phosphoribosylaminoimidazole-succinocarboxamide synthase; Provisional Back     alignment and domain information
>TIGR00081 purC phosphoribosylaminoimidazole-succinocarboxamide synthase; InterPro: IPR001636 Phosphoribosylaminoimidazole-succinocarboxamide synthase (6 Back     alignment and domain information
>cd01415 SAICAR_synt_PurC bacterial and archaeal 5-aminoimidazole-4-(N-succinylcarboxamide) ribonucleotide (SAICAR) synthase Back     alignment and domain information
>PRK09362 phosphoribosylaminoimidazole-succinocarboxamide synthase; Reviewed Back     alignment and domain information
>pfam01259 SAICAR_synt SAICAR synthetase Back     alignment and domain information
>cd01416 SAICAR_synt_Ade5 Ade5_like 5-aminoimidazole-4-(N-succinylcarboxamide) ribonucleotide (SAICAR) synthase Back     alignment and domain information
>COG0152 PurC Phosphoribosylaminoimidazolesuccinocarboxamide (SAICAR) synthase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd00476 SAICAR_synt 5-aminoimidazole-4-(N-succinylcarboxamide) ribonucleotide (SAICAR) synthase Back     alignment and domain information
>TIGR02735 purC_vibrio phosphoribosylaminoimidazole-succinocarboxamide synthase; InterPro: IPR014106 Members of this protein family appear to represent a novel form of phosphoribosylaminoimidazole-succinocarboxamide synthase (SAICAR synthetase), significantly different in sequence from (IPR001636 from INTERPRO), which is found in a broad range of bacteria and eukaryotes Back     alignment and domain information
>KOG2835 consensus Back     alignment and domain information
>KOG2835 consensus Back     alignment and domain information
>TIGR01648 hnRNP-R-Q hnRNP-R, Q splicing factor family; InterPro: IPR006535 Sequences in this subfamily include the human heterogeneous nuclear ribonucleoproteins (hnRNP) R , Q and APOBEC-1 complementation factor (aka APOBEC-1 stimulating protein) Back     alignment and domain information
>KOG0117 consensus Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target323 phosphoribosylaminoimidazole-succinocarboxamide synthas
3r9r_A301 Structure Of A Phosphoribosylaminoimidazole-Succino 2e-62
1obg_A305 Saicar-Synthase Complexed With Atp Length = 305 3e-59
1a48_A306 Saicar Synthase Length = 306 3e-59
2yzl_A242 Crystal Structure Of Phosphoribosylaminoimidazole- 3e-34
2ywv_A244 Crystal Structure Of Saicar Synthetase From Geobaci 2e-35
3nua_A238 Crystal Structure Of Phosphoribosylaminoimidazole-S 2e-30
3kre_A263 Crystal Structure Of Phosphoribosylaminoimidazole- 5e-30
2gqs_A237 Saicar Synthetase Complexed With Cair-Mg2+ And Adp 6e-28
2h31_A 425 Crystal Structure Of Human Paics, A Bifunctional Ca 9e-27
2gqr_A237 Saicar Synthetase Complexed With Adp-Mg2+ Length = 2e-26
1kut_A230 Structural Genomics, Protein Tm1243, (Saicar Synthe 6e-22
>gi|329666292|pdb|3R9R|A Chain A, Structure Of A Phosphoribosylaminoimidazole-Succinocarboxamide Synthase From Mycobacterium Abscessus Atcc 19977 DSM 44196 Length = 301 Back     alignment and structure
 Score =  244 bits (622), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 86/299 (28%), Positives = 146/299 (48%), Gaps = 25/299 (8%)

Query: 8   YIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHH 66
            + +  +  SGKVRE Y + D   + +ATDR+SAFD  +   IP KG +L  ++ ++F  
Sbjct: 8   SLSDYQHVASGKVRELYRVDDEHLLFVATDRISAFDFVLDTPIPDKGRILTAMSVFFFGL 67

Query: 67  TSDICS-------NHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKR 119
            +               +      L+ ++L M P+E + RGYL G+              
Sbjct: 68  LTVPNHLAGPPDDPRIPEEVLGRALLVRRLDMLPVECVARGYLTGSGLLDYQR-----TG 122

Query: 120 KIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISS 179
            +  ++LP  + +  +L  P+ TP TK+       D  +  +     G++   +   +  
Sbjct: 123 AVCGHVLPQGLGEASRLDPPLFTPATKADIGE--HDMNV--DFAAVVGLVGAVRANQLRD 178

Query: 180 YALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFR 239
             + ++ R    AL  G+IL D+K+EFG+D + N++LADE+ TPDSSRYW+   Y+    
Sbjct: 179 ETIKIYTRAAAHALHKGIILADTKFEFGVDIEGNLVLADEVFTPDSSRYWDAAHYQPGVV 238

Query: 240 EGITPIGLDKDFIRNWILTRCNPYRD----NIPDIPENIILRTSQTYIAAYEKITGLKF 294
           +       DK F+RNW+    + +        P +P+ + + T + YI AYE+I+GL F
Sbjct: 239 Q----DSFDKQFVRNWLTGPESGWDRASDTPPPPLPDEVAVATRERYIEAYERISGLSF 293


>gi|157879485|pdb|1OBG|A Chain A, Saicar-Synthase Complexed With Atp Length = 305 Back     alignment and structure
>gi|313507122|pdb|1A48|A Chain A, Saicar Synthase Length = 306 Back     alignment and structure
gi|160286255|pdb|2YZL|A Chain A, Crystal Structure Of Phosphoribosylaminoimidazole- Succinocarboxamide Synthase With Adp From Methanocaldococcus Jannaschii Length = 242 Back     alignment and structure
>gi|159795633|pdb|2YWV|A Chain A, Crystal Structure Of Saicar Synthetase From Geobacillus Kaustophilus Length = 244 Back     alignment and structure
>gi|304446033|pdb|3NUA|A Chain A, Crystal Structure Of Phosphoribosylaminoimidazole-Succinocarboxamide Synthase From Clostridium Perfringens Length = 238 Back     alignment and structure
>gi|270047866|pdb|3KRE|A Chain A, Crystal Structure Of Phosphoribosylaminoimidazole- Succinocarboxamide Synthase From Ehrlichia Chaffeensis At 1.8a Resolution Length = 263 Back     alignment and structure
gi|109157959|pdb|2GQS|A Chain A, Saicar Synthetase Complexed With Cair-Mg2+ And Adp Length = 237 Back     alignment and structure
>gi|126030593|pdb|2H31|A Chain A, Crystal Structure Of Human Paics, A Bifunctional Carboxylase And Synthetase In Purine Biosynthesis Length = 425 Back     alignment and structure
>gi|109157957|pdb|2GQR|A Chain A, Saicar Synthetase Complexed With Adp-Mg2+ Length = 237 Back     alignment and structure
>gi|23200290|pdb|1KUT|A Chain A, Structural Genomics, Protein Tm1243, (Saicar Synthetase) Length = 230 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target323 phosphoribosylaminoimidazole-succinocarboxamide synthas
2cnq_A306 Phosphoribosylaminoimidazole-succinocarboxamide synthas 8e-49
2h31_A 425 Multifunctional protein ADE2; alpha-beta-alpha, ligase, 3e-44
3nua_A238 Phosphoribosylaminoimidazole-succinocarboxamide S; alph 1e-43
2z02_A242 Phosphoribosylaminoimidazole-succinocarboxamide synthas 2e-41
2ywv_A244 Phosphoribosylaminoimidazole succinocarboxamide synthet 2e-38
1kut_A230 Phosphoribosylaminoimidazole-succinocarboxamide synthas 2e-38
3kre_A263 Phosphoribosylaminoimidazole-succinocarboxamide synthas 1e-36
2gqr_A237 Phosphoribosylaminoimidazole-succinocarboxamide synthas 6e-33
>2cnq_A Phosphoribosylaminoimidazole-succinocarboxamide synthase; ligase, phosphoribosylaminoimidazolesuccinocarboxamide (saicar) SYN ligase; HET: ADP AMZ AMP; 1.00A {Saccharomyces cerevisiae} SCOP: d.143.1.1 PDB: 1a48_A* 1obd_A* 2cnu_A* 2cnv_A* 1obg_A* Length = 306 Back     alignment and structure
 Score =  189 bits (481), Expect = 8e-49
 Identities = 90/308 (29%), Positives = 153/308 (49%), Gaps = 38/308 (12%)

Query: 11  ELPNYYSGKVRENYFLSDGTRITIATDRLSAFD-QNIACIPYKGEVLNQITQYWFHHTSD 69
            LP    GKVR+ Y +  GT + +ATDR+SA+D      IP KG +L +++++WF   S+
Sbjct: 11  ILPLVARGKVRDIYEVDAGTLLFVATDRISAYDVIMENSIPEKGILLTKLSEFWFKFLSN 70

Query: 70  ICSNHTLDYPDP----------------------NVLVGQQLQMFPIELIVRGYLAGNTK 107
              NH +D                            L+  + ++ P+E+IVRGY+ G+  
Sbjct: 71  DVRNHLVDIAPGKTIFDYLPAKLSEPKYKTQLEDRSLLVHKHKLIPLEVIVRGYITGSAW 130

Query: 108 TSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRG 167
                        ++    P  + ++Q+ P P+ TP+TK+ +     +   + +      
Sbjct: 131 KE-----YVKTGTVHGLKQPQGLKESQEFPEPIFTPSTKAEQ----GEHDENISPAQAAE 181

Query: 168 ILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQN-IILADEIHTPDSS 226
           ++  +    ++  A+ L+ +    A E G+I+ D+K+EFGID+K N IIL DE+ TPDSS
Sbjct: 182 LVGEDLSRRVAELAVKLYSKCKDYAKEKGIIIADTKFEFGIDEKTNEIILVDEVLTPDSS 241

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAY 286
           R+W   +Y    + G +    DK F+R+W+        +    +P++I+ RT   YI AY
Sbjct: 242 RFWNGASY----KVGESQDSYDKQFLRDWLTANKLNGVNG-VKMPQDIVDRTRAKYIEAY 296

Query: 287 EKITGLKF 294
           E +TG K+
Sbjct: 297 ETLTGSKW 304


>2h31_A Multifunctional protein ADE2; alpha-beta-alpha, ligase, lyase; 2.80A {Homo sapiens} Length = 425 Back     alignment and structure
>3nua_A Phosphoribosylaminoimidazole-succinocarboxamide S; alpha-beta structure, csgid, ligase; HET: ADP AMP CIT; 1.40A {Clostridium perfringens atcc 13124} Length = 238 Back     alignment and structure
>2z02_A Phosphoribosylaminoimidazole-succinocarboxamide synthase; 2-layer sandwich, ligase, purine biosynthesis, structural genomics; HET: ATP CIT; 2.03A {Methanocaldococcus jannaschii} PDB: 2yzl_A* Length = 242 Back     alignment and structure
>2ywv_A Phosphoribosylaminoimidazole succinocarboxamide synthetase; ADP complex, structural genomics, NPPSFA; HET: ADP; 1.75A {Geobacillus kaustophilus} Length = 244 Back     alignment and structure
>1kut_A Phosphoribosylaminoimidazole-succinocarboxamide synthase; structural genomics, saicar synthetase, PSI, protein structure initiative; 2.20A {Thermotoga maritima} SCOP: d.143.1.1 Length = 230 Back     alignment and structure
>3kre_A Phosphoribosylaminoimidazole-succinocarboxamide synthase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ATP-binding, ligase; 1.80A {Ehrlichia chaffeensis str} Length = 263 Back     alignment and structure
>2gqr_A Phosphoribosylaminoimidazole-succinocarboxamide synthase; PURC, ADE2, ADE1, nucleotide complex, octahedral magnesium coordination; HET: ADP; 2.00A {Escherichia coli} PDB: 2gqs_A* Length = 237 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target323 phosphoribosylaminoimidazole-succinocarboxamide synthas
2cnq_A306 Phosphoribosylaminoimidazole-succinocarboxamide synthas 100.0
2ywv_A244 Phosphoribosylaminoimidazole succinocarboxamide synthet 100.0
2z02_A242 Phosphoribosylaminoimidazole-succinocarboxamide synthas 100.0
3kre_A263 Phosphoribosylaminoimidazole-succinocarboxamide synthas 100.0
1kut_A230 Phosphoribosylaminoimidazole-succinocarboxamide synthas 100.0
3nua_A238 Phosphoribosylaminoimidazole-succinocarboxamide S; alph 100.0
2gqr_A237 Phosphoribosylaminoimidazole-succinocarboxamide synthas 100.0
2h31_A 425 Multifunctional protein ADE2; alpha-beta-alpha, ligase, 100.0
>2cnq_A Phosphoribosylaminoimidazole-succinocarboxamide synthase; ligase, phosphoribosylaminoimidazolesuccinocarboxamide (saicar) SYN ligase; HET: ADP AMZ AMP; 1.00A {Saccharomyces cerevisiae} SCOP: d.143.1.1 PDB: 1a48_A* 1obd_A* 2cnu_A* 2cnv_A* 1obg_A* Back     alignment and structure
Probab=100.00  E-value=0  Score=612.17  Aligned_cols=280  Identities=34%  Similarity=0.626  Sum_probs=259.0

Q ss_pred             CCCCCCCCCC-CCEEEECCEEEEEECCCCCEEEEEECCEEEECCCCC-CCCCHHHHHHHHHHHHHHHHHHHCCCCEECCC
Q ss_conf             5300054889-960230440265875999489998188125557657-77878899999999999985410233121357
Q gi|254780493|r    2 RILSKAYIPE-LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHTSDICSNHTLDYP   79 (323)
Q Consensus         2 ~~l~~~~~~~-l~liy~GKvk~vY~~~d~~ll~v~tDriSAfD~~~~-~Ip~KG~~l~~iS~~~F~~l~~~i~tH~i~~~   79 (323)
                      .++++|++++ ||++|+||||+||+++++.+||+|||||||||++++ .|||||++||+||+|||++|+++|+||||+.+
T Consensus         1 ~~~~~~~~~~~l~liy~GKvK~vY~~d~~~ll~~~~DriSafD~~~~~~Ip~KG~~l~~iS~~~F~~l~~gi~tH~i~~~   80 (306)
T 2cnq_A            1 XSITKTELDGILPLVARGKVRDIYEVDAGTLLFVATDRISAYDVIMENSIPEKGILLTKLSEFWFKFLSNDVRNHLVDIA   80 (306)
T ss_dssp             -CCCSCCCTTSSCEEEECSSEEEEEEETTEEEEEECSCCEETTEECSSCCTTHHHHHHHHHHHHHHHTTTTSEESBCCCC
T ss_pred             CCCEEECCCCCCCCEECCCCEEEEECCCCEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCEECCC
T ss_conf             96345326776740001577058971899699999488616464267889976899999999999986544666521257


Q ss_pred             ----------------------CCCCCEEEECCCCCCEEEEECCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             ----------------------7630000002546505788521224432200122102476513446632122235688
Q gi|254780493|r   80 ----------------------DPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLP  137 (323)
Q Consensus        80 ----------------------~~~~~~v~k~~~iPiE~VvR~y~~GS~~~~~~~~~k~~~~~~~g~~lp~gl~~~~~l~  137 (323)
                                            ++++|+|+||+|||||||||||+|||+|++|.+     .+.+||+.+|+++.++++||
T Consensus        81 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~vkk~~~IPlEvIvR~~~~GS~~~ry~~-----~~~~~g~~l~~~l~e~~~l~  155 (306)
T 2cnq_A           81 PGKTIFDYLPAKLSEPKYKTQLEDRSLLVHKHKLIPLEVIVRGYITGSAWKEYVK-----TGTVHGLKQPQGLKESQEFP  155 (306)
T ss_dssp             TTCCGGGGSCGGGGSHHHHHHHTTSEEEEECCEECSSBEEEEEECCHHHHHHHHH-----HSEETTEECCTTCCTTCEEE
T ss_pred             CCCCHHHCCCCCCCCCCHHHCCCCCEEEEEECCEEEEEEEEEEEEECCCEEECCC-----CCCCCCCCCCCCCCCCCCCC
T ss_conf             7521000122223462033214780158885325648999984230343321124-----57545866886634113789


Q ss_pred             CCCEEEEEECCCCCCCCCCCCCHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEEEEEEECCC-CCEEE
Q ss_conf             74022321033334577755554566653049989998999999999999999988679788742324455088-62576
Q gi|254780493|r  138 YPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKK-QNIIL  216 (323)
Q Consensus       138 ~Pi~tpstK~~~~~~~~D~~i~~~~~~~~~~~~~~~~~~i~~~sl~i~~~~~~~~~~~GliLvD~K~EFG~~~~-g~iiL  216 (323)
                      +|+|||+||++.+  .||++++.+++  .++++.+++++|++.++++|+.++++|+++||+|||||||||++.+ ++|+|
T Consensus       156 ~pi~~p~tK~e~~--d~d~~~~~~~~--~~~~~~~~~~~i~~~~l~i~~~l~~~~~~~Gl~LvD~K~EFG~d~~g~~iil  231 (306)
T 2cnq_A          156 EPIFTPSTKAEQG--EHDENISPAQA--AELVGEDLSRRVAELAVKLYSKCKDYAKEKGIIIADTKFEFGIDEKTNEIIL  231 (306)
T ss_dssp             EEEECCBCCCC-----CCCBCCHHHH--HHHHCHHHHHHHHHHHHHHHHHHHHHHHHHTEEEEEEEEEEEEETTTTEEEE
T ss_pred             CCCCCCCCCCCCC--CCCCCCCHHHH--HHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEEEEEEEECCCCCEEE
T ss_conf             8654752213345--52011368999--9985368999999999999999999999779746501688657658980799


Q ss_pred             ECCCCCCCCCHHHCCCHHHHHHHCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             2000481000000000001233125444432378887655311223679999989899999999999999986088664
Q gi|254780493|r  217 ADEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFI  295 (323)
Q Consensus       217 ~DEv~TPDssR~W~~~~ye~~~~~g~~~~s~DKq~~R~wl~~~~~~~~~~~P~LP~~vv~~~~~~Y~~~~e~lTG~~f~  295 (323)
                      +||++||||||||++++|+.    |..++|||||++|+||.+++|++.+ +|+||+|++..++++|+++||||||++|.
T Consensus       232 ~DeviTPDs~R~Wd~~~y~~----g~~~~~~DKq~~R~~l~~~~~~~~~-~p~lP~eii~~~~~~Y~~~~e~lTG~~f~  305 (306)
T 2cnq_A          232 VDEVLTPDSSRFWNGASYKV----GESQDSYDKQFLRDWLTANKLNGVN-GVKMPQDIVDRTRAKYIEAYETLTGSKWS  305 (306)
T ss_dssp             ESCCSCTTTEEEEETTTCCT----TSCCCCSSTHHHHHHHHHTTCTTCT-TCCCCHHHHHHHHHHHHHHHHHHHSSCCC
T ss_pred             EEEECCCCCCCCCCCCCCCC----CCCCCCCCHHHHHHHHHHCCCCCCC-CCCCCHHHHHHHHHHHHHHHHHHHCCCCC
T ss_conf             86511687542021533347----8874242549998889765777898-88899999999999999999998777678



>2ywv_A Phosphoribosylaminoimidazole succinocarboxamide synthetase; ADP complex, structural genomics, NPPSFA; HET: ADP; 1.75A {Geobacillus kaustophilus} Back     alignment and structure
>2z02_A Phosphoribosylaminoimidazole-succinocarboxamide synthase; 2-layer sandwich, ligase, purine biosynthesis, structural genomics; HET: ATP CIT; 2.03A {Methanocaldococcus jannaschii} PDB: 2yzl_A* Back     alignment and structure
>3kre_A Phosphoribosylaminoimidazole-succinocarboxamide synthase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ATP-binding, ligase; 1.80A {Ehrlichia chaffeensis str} Back     alignment and structure
>1kut_A Phosphoribosylaminoimidazole-succinocarboxamide synthase; structural genomics, saicar synthetase, PSI, protein structure initiative; 2.20A {Thermotoga maritima} SCOP: d.143.1.1 Back     alignment and structure
>3nua_A Phosphoribosylaminoimidazole-succinocarboxamide S; alpha-beta structure, csgid, ligase; HET: ADP AMP CIT; 1.40A {Clostridium perfringens atcc 13124} Back     alignment and structure
>2gqr_A Phosphoribosylaminoimidazole-succinocarboxamide synthase; PURC, ADE2, ADE1, nucleotide complex, octahedral magnesium coordination; HET: ADP; 2.00A {Escherichia coli} PDB: 2gqs_A* Back     alignment and structure
>2h31_A Multifunctional protein ADE2; alpha-beta-alpha, ligase, lyase; 2.80A {Homo sapiens} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 323 phosphoribosylaminoimidazole-succinocarboxamide synthas
d2cnqa1304 d.143.1.1 (A:2-305) SAICAR synthase {Baker's yeast (Sac 5e-48
d1kuta_224 d.143.1.1 (A:) SAICAR synthase {Thermotoga maritima [Ta 2e-31
>d2cnqa1 d.143.1.1 (A:2-305) SAICAR synthase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 304 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: SAICAR synthase-like
superfamily: SAICAR synthase-like
family: SAICAR synthase
domain: SAICAR synthase
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
 Score =  185 bits (470), Expect = 5e-48
 Identities = 90/308 (29%), Positives = 153/308 (49%), Gaps = 38/308 (12%)

Query: 11  ELPNYYSGKVRENYFLSDGTRITIATDRLSAFD-QNIACIPYKGEVLNQITQYWFHHTSD 69
            LP    GKVR+ Y +  GT + +ATDR+SA+D      IP KG +L +++++WF   S+
Sbjct: 10  ILPLVARGKVRDIYEVDAGTLLFVATDRISAYDVIMENSIPEKGILLTKLSEFWFKFLSN 69

Query: 70  ICSNHTLDYPDP----------------------NVLVGQQLQMFPIELIVRGYLAGNTK 107
              NH +D                            L+  + ++ P+E+IVRGY+ G+  
Sbjct: 70  DVRNHLVDIAPGKTIFDYLPAKLSEPKYKTQLEDRSLLVHKHKLIPLEVIVRGYITGSAW 129

Query: 108 TSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRG 167
                        ++    P  + ++Q+ P P+ TP+TK+ +     +   + +      
Sbjct: 130 KE-----YVKTGTVHGLKQPQGLKESQEFPEPIFTPSTKAEQ----GEHDENISPAQAAE 180

Query: 168 ILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQN-IILADEIHTPDSS 226
           ++  +    ++  A+ L+ +    A E G+I+ D+K+EFGID+K N IIL DE+ TPDSS
Sbjct: 181 LVGEDLSRRVAELAVKLYSKCKDYAKEKGIIIADTKFEFGIDEKTNEIILVDEVLTPDSS 240

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAY 286
           R+W   +Y+     G +    DK F+R+W+        +    +P++I+ RT   YI AY
Sbjct: 241 RFWNGASYK----VGESQDSYDKQFLRDWLTANKLNGVNG-VKMPQDIVDRTRAKYIEAY 295

Query: 287 EKITGLKF 294
           E +TG K+
Sbjct: 296 ETLTGSKW 303


>d1kuta_ d.143.1.1 (A:) SAICAR synthase {Thermotoga maritima [TaxId: 2336]} Length = 224 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target323 phosphoribosylaminoimidazole-succinocarboxamide synthas
d2cnqa1304 SAICAR synthase {Baker's yeast (Saccharomyces cerevisia 100.0
d1kuta_224 SAICAR synthase {Thermotoga maritima [TaxId: 2336]} 100.0
>d2cnqa1 d.143.1.1 (A:2-305) SAICAR synthase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: SAICAR synthase-like
superfamily: SAICAR synthase-like
family: SAICAR synthase
domain: SAICAR synthase
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=100.00  E-value=0  Score=627.91  Aligned_cols=279  Identities=34%  Similarity=0.632  Sum_probs=258.9

Q ss_pred             CCCCCCCCC-CCEEEECCEEEEEECCCCCEEEEEECCEEEECCCCC-CCCCHHHHHHHHHHHHHHHHHHHCCCCEECCC-
Q ss_conf             300054889-960230440265875999489998188125557657-77878899999999999985410233121357-
Q gi|254780493|r    3 ILSKAYIPE-LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHTSDICSNHTLDYP-   79 (323)
Q Consensus         3 ~l~~~~~~~-l~liy~GKvk~vY~~~d~~ll~v~tDriSAfD~~~~-~Ip~KG~~l~~iS~~~F~~l~~~i~tH~i~~~-   79 (323)
                      ++++|+|++ ||++|+||||+||+++++.+||+|||||||||++++ .|||||++||+||+|||++|+++|+||||+.+ 
T Consensus         1 ~~~~~~~~~~l~ll~~GKvK~vY~~d~~~ll~~~tDriSAfD~~~~~~Ip~KG~~l~~is~~~F~~l~~gi~tH~i~~~~   80 (304)
T d2cnqa1           1 SITKTELDGILPLVARGKVRDIYEVDAGTLLFVATDRISAYDVIMENSIPEKGILLTKLSEFWFKFLSNDVRNHLVDIAP   80 (304)
T ss_dssp             CCCSCCCTTSSCEEEECSSEEEEEEETTEEEEEECSCCEETTEECSSCCTTHHHHHHHHHHHHHHHTTTTSEESBCCCCT
T ss_pred             CCEEECCCCCCCCEECCCCEEEEECCCCEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCEECCCC
T ss_conf             94351267877510005662689708997999997984034642678899768999999999999865547765223688


Q ss_pred             ---------------------CCCCCEEEECCCCCCEEEEECCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             ---------------------76300000025465057885212244322001221024765134466321222356887
Q gi|254780493|r   80 ---------------------DPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPY  138 (323)
Q Consensus        80 ---------------------~~~~~~v~k~~~iPiE~VvR~y~~GS~~~~~~~~~k~~~~~~~g~~lp~gl~~~~~l~~  138 (323)
                                           ++++|+|++|+|||||||||||+|||+|++|.     +.+++||+++|+|+.++++||+
T Consensus        81 ~~~~~~~~~~~~~~~~~~~~~~~r~~~vkk~~~iPiE~VvR~y~tGS~~~~y~-----~~~~~~g~~lp~gl~~~~~l~~  155 (304)
T d2cnqa1          81 GKTIFDYLPAKLSEPKYKTQLEDRSLLVHKHKLIPLEVIVRGYITGSAWKEYV-----KTGTVHGLKQPQGLKESQEFPE  155 (304)
T ss_dssp             TCCGGGGSCGGGGSHHHHHHHTTSEEEEECCEECSSBEEEEEECCHHHHHHHH-----HHSEETTEECCTTCCTTCEEEE
T ss_pred             CHHHHHCCCCCCCCCCHHHCCCCCEEEEEEEEEEEEEEEEECCEECCCEEECC-----CCCEECCCCCCCCCCCCCCCCC
T ss_conf             31110013222246202321488305887513300699996345013222113-----4760216668877532334774


Q ss_pred             CCEEEEEECCCCCCCCCCCCCHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEEEEEEECCCC-CEEEE
Q ss_conf             40223210333345777555545666530499899989999999999999999886797887423244550886-25762
Q gi|254780493|r  139 PVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQ-NIILA  217 (323)
Q Consensus       139 Pi~tpstK~~~~~~~~D~~i~~~~~~~~~~~~~~~~~~i~~~sl~i~~~~~~~~~~~GliLvD~K~EFG~~~~g-~iiL~  217 (323)
                      |+|||+||++.|  .||++++..++  .++++.+++++|++.++++|+.++++++++||+|||||||||++.+| +|+|+
T Consensus       156 pi~tpstK~e~g--d~d~~~~~~~~--~~i~~~~~~~~i~~~sl~i~~~~~~~~~~~GliLvD~K~EFG~~~~~~eiili  231 (304)
T d2cnqa1         156 PIFTPSTKAEQG--EHDENISPAQA--AELVGEDLSRRVAELAVKLYSKCKDYAKEKGIIIADTKFEFGIDEKTNEIILV  231 (304)
T ss_dssp             EEECCBCCCC-----CCCBCCHHHH--HHHHCHHHHHHHHHHHHHHHHHHHHHHHHHTEEEEEEEEEEEEETTTTEEEEE
T ss_pred             CCCCCHHHHHCC--HHHHHHHHHHH--HHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEEEEEEEECCCCCCEEEE
T ss_conf             102320000000--02455657899--99861899999999999999999999974792788757999860455522787


Q ss_pred             CCCCCCCCCHHHCCCHHHHHHHCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             000481000000000001233125444432378887655311223679999989899999999999999986088664
Q gi|254780493|r  218 DEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFI  295 (323)
Q Consensus       218 DEv~TPDssR~W~~~~ye~~~~~g~~~~s~DKq~~R~wl~~~~~~~~~~~P~LP~~vv~~~~~~Y~~~~e~lTG~~f~  295 (323)
                      ||++||||||||++++|+.    |..+++||||++|+|+.+++|++.++ |+||+||++.++++|+++||||||++|.
T Consensus       232 DEv~TPDs~R~W~~~~y~~----g~~~~~lDKq~~Rd~l~~~~~~~~~~-p~lP~ei~~~~~~~Y~~~~~~ltG~~f~  304 (304)
T d2cnqa1         232 DEVLTPDSSRFWNGASYKV----GESQDSYDKQFLRDWLTANKLNGVNG-VKMPQDIVDRTRAKYIEAYETLTGSKWS  304 (304)
T ss_dssp             SCCSCTTTEEEEETTTCCT----TSCCCCSSTHHHHHHHHHTTCTTCTT-CCCCHHHHHHHHHHHHHHHHHHHSSCCC
T ss_pred             EEECCCCCCCEECCCCCCC----CCCCCCCCHHHHHHHHHHCCCCCCCC-CCCCHHHHHHHHHHHHHHHHHHHCCCCC
T ss_conf             6633798532330543357----88764523699998998658678988-8999999999999999999998688898



>d1kuta_ d.143.1.1 (A:) SAICAR synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 323 phosphoribosylaminoimidazole-succinocarboxamide sy
2cnq_A_113-252140 (A:113-252) Phosphoribosylaminoimidazole-succinoca 3e-32
2z02_A_92-222131 (A:92-222) Phosphoribosylaminoimidazole-succinocar 2e-30
2ywv_A_89-219131 (A:89-219) Phosphoribosylaminoimidazole succinocar 6e-30
3kre_A_105-240136 (A:105-240) Phosphoribosylaminoimidazole-succinoca 4e-29
2gqr_A_86-237152 (A:86-237) Phosphoribosylaminoimidazole-succinocar 7e-29
2h31_A_90-234145 (A:90-234) Multifunctional protein ADE2; alpha-bet 7e-29
1kut_A_79-199121 (A:79-199) Phosphoribosylaminoimidazole-succinocar 2e-25
2cnq_A_1-112_253-305165 (A:1-112,A:253-305) Phosphoribosylaminoimidazole-s 1e-18
2z02_A_1-91_223-242111 (A:1-91,A:223-242) Phosphoribosylaminoimidazole-su 2e-16
3kre_A_1-104_241-263127 (A:1-104,A:241-263) Phosphoribosylaminoimidazole-s 4e-15
2ywv_A_1-88_220-244113 (A:1-88,A:220-244) Phosphoribosylaminoimidazole su 2e-14
2h31_A_1-89_235-260_395-425146 (A:1-89,A:235-260,A:395-425) Multifunctional prote 1e-13
2gqr_A_1-8585 (A:1-85) Phosphoribosylaminoimidazole-succinocarbo 1e-13
1kut_A_1-78_200-230109 (A:1-78,A:200-230) Phosphoribosylaminoimidazole-su 5e-13
2cnq_A_1-112_253-305165 (A:1-112,A:253-305) Phosphoribosylaminoimidazole-s 1e-11
>2z02_A (A:92-222) Phosphoribosylaminoimidazole-succinocarboxamide synthase; 2-layer sandwich, ligase, purine biosynthesis, structural genomics; HET: ATP CIT; 2.03A {Methanocaldococcus jannaschii} PDB: 2yzl_A*Length = 131 Back     alignment and structure
>2ywv_A (A:89-219) Phosphoribosylaminoimidazole succinocarboxamide synthetase; ADP complex, structural genomics, NPPSFA; HET: ADP; 1.75A {Geobacillus kaustophilus}Length = 131 Back     alignment and structure
>3kre_A (A:105-240) Phosphoribosylaminoimidazole-succinocarboxamide synthase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ATP-binding, ligase; 1.80A {Ehrlichia chaffeensis str}Length = 136 Back     alignment and structure
>2gqr_A (A:86-237) Phosphoribosylaminoimidazole-succinocarboxamide synthase; PURC, ADE2, ADE1, nucleotide complex, octahedral magnesium coordination; HET: ADP; 2.00A {Escherichia coli} PDB: 2gqs_A*Length = 152 Back     alignment and structure
>2h31_A (A:90-234) Multifunctional protein ADE2; alpha-beta-alpha, ligase, lyase; 2.80A {Homo sapiens}Length = 145 Back     alignment and structure
>1kut_A (A:79-199) Phosphoribosylaminoimidazole-succinocarboxamide synthase; structural genomics, saicar synthetase, PSI, protein structure initiative; 2.20A {Thermotoga maritima}Length = 121 Back     alignment and structure
>2z02_A (A:1-91,A:223-242) Phosphoribosylaminoimidazole-succinocarboxamide synthase; 2-layer sandwich, ligase, purine biosynthesis, structural genomics; HET: ATP CIT; 2.03A {Methanocaldococcus jannaschii} PDB: 2yzl_A*Length = 111 Back     alignment and structure
>3kre_A (A:1-104,A:241-263) Phosphoribosylaminoimidazole-succinocarboxamide synthase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ATP-binding, ligase; 1.80A {Ehrlichia chaffeensis str}Length = 127 Back     alignment and structure
>2ywv_A (A:1-88,A:220-244) Phosphoribosylaminoimidazole succinocarboxamide synthetase; ADP complex, structural genomics, NPPSFA; HET: ADP; 1.75A {Geobacillus kaustophilus}Length = 113 Back     alignment and structure
>2h31_A (A:1-89,A:235-260,A:395-425) Multifunctional protein ADE2; alpha-beta-alpha, ligase, lyase; 2.80A {Homo sapiens}Length = 146 Back     alignment and structure
>2gqr_A (A:1-85) Phosphoribosylaminoimidazole-succinocarboxamide synthase; PURC, ADE2, ADE1, nucleotide complex, octahedral magnesium coordination; HET: ADP; 2.00A {Escherichia coli} PDB: 2gqs_A*Length = 85 Back     alignment and structure
>1kut_A (A:1-78,A:200-230) Phosphoribosylaminoimidazole-succinocarboxamide synthase; structural genomics, saicar synthetase, PSI, protein structure initiative; 2.20A {Thermotoga maritima}Length = 109 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target323 phosphoribosylaminoimidazole-succinocarboxamide synthas
2cnq_A_1-112_253-305165 Phosphoribosylaminoimidazole-succinocarboxamide sy 100.0
2gqr_A_86-237152 Phosphoribosylaminoimidazole-succinocarboxamide sy 100.0
3kre_A_105-240136 Phosphoribosylaminoimidazole-succinocarboxamide sy 100.0
2z02_A_92-222131 Phosphoribosylaminoimidazole-succinocarboxamide sy 100.0
2ywv_A_89-219131 Phosphoribosylaminoimidazole succinocarboxamide sy 100.0
2cnq_A_113-252140 Phosphoribosylaminoimidazole-succinocarboxamide sy 100.0
2h31_A_90-234145 Multifunctional protein ADE2; alpha-beta-alpha, li 100.0
1kut_A_79-199121 Phosphoribosylaminoimidazole-succinocarboxamide sy 100.0
2z02_A_1-91_223-242111 Phosphoribosylaminoimidazole-succinocarboxamide sy 99.92
3kre_A_1-104_241-263127 Phosphoribosylaminoimidazole-succinocarboxamide sy 99.92
2ywv_A_1-88_220-244113 Phosphoribosylaminoimidazole succinocarboxamide sy 99.92
2gqr_A_1-8585 Phosphoribosylaminoimidazole-succinocarboxamide sy 99.91
1kut_A_1-78_200-230109 Phosphoribosylaminoimidazole-succinocarboxamide sy 99.9
2h31_A_1-89_235-260_395-425146 Multifunctional protein ADE2; alpha-beta-alpha, li 99.88
2h31_A_90-234145 Multifunctional protein ADE2; alpha-beta-alpha, li 91.68
>2gqr_A (A:86-237) Phosphoribosylaminoimidazole-succinocarboxamide synthase; PURC, ADE2, ADE1, nucleotide complex, octahedral magnesium coordination; HET: ADP; 2.00A {Escherichia coli} PDB: 2gqs_A* Back     alignment and structure
>3kre_A (A:105-240) Phosphoribosylaminoimidazole-succinocarboxamide synthase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ATP-binding, ligase; 1.80A {Ehrlichia chaffeensis str} Back     alignment and structure
>2z02_A (A:92-222) Phosphoribosylaminoimidazole-succinocarboxamide synthase; 2-layer sandwich, ligase, purine biosynthesis, structural genomics; HET: ATP CIT; 2.03A {Methanocaldococcus jannaschii} PDB: 2yzl_A* Back     alignment and structure
>2ywv_A (A:89-219) Phosphoribosylaminoimidazole succinocarboxamide synthetase; ADP complex, structural genomics, NPPSFA; HET: ADP; 1.75A {Geobacillus kaustophilus} Back     alignment and structure
>2h31_A (A:90-234) Multifunctional protein ADE2; alpha-beta-alpha, ligase, lyase; 2.80A {Homo sapiens} Back     alignment and structure
>1kut_A (A:79-199) Phosphoribosylaminoimidazole-succinocarboxamide synthase; structural genomics, saicar synthetase, PSI, protein structure initiative; 2.20A {Thermotoga maritima} Back     alignment and structure
>2z02_A (A:1-91,A:223-242) Phosphoribosylaminoimidazole-succinocarboxamide synthase; 2-layer sandwich, ligase, purine biosynthesis, structural genomics; HET: ATP CIT; 2.03A {Methanocaldococcus jannaschii} PDB: 2yzl_A* Back     alignment and structure
>3kre_A (A:1-104,A:241-263) Phosphoribosylaminoimidazole-succinocarboxamide synthase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ATP-binding, ligase; 1.80A {Ehrlichia chaffeensis str} Back     alignment and structure
>2ywv_A (A:1-88,A:220-244) Phosphoribosylaminoimidazole succinocarboxamide synthetase; ADP complex, structural genomics, NPPSFA; HET: ADP; 1.75A {Geobacillus kaustophilus} Back     alignment and structure
>2gqr_A (A:1-85) Phosphoribosylaminoimidazole-succinocarboxamide synthase; PURC, ADE2, ADE1, nucleotide complex, octahedral magnesium coordination; HET: ADP; 2.00A {Escherichia coli} PDB: 2gqs_A* Back     alignment and structure
>1kut_A (A:1-78,A:200-230) Phosphoribosylaminoimidazole-succinocarboxamide synthase; structural genomics, saicar synthetase, PSI, protein structure initiative; 2.20A {Thermotoga maritima} Back     alignment and structure
>2h31_A (A:1-89,A:235-260,A:395-425) Multifunctional protein ADE2; alpha-beta-alpha, ligase, lyase; 2.80A {Homo sapiens} Back     alignment and structure
>2h31_A (A:90-234) Multifunctional protein ADE2; alpha-beta-alpha, ligase, lyase; 2.80A {Homo sapiens} Back     alignment and structure